(data stored in ACNUC8465 zone)

EMBL: CP000878

ID   CP000878; SV 1; circular; genomic DNA; STD; PRO; 1688963 BP.
AC   CP000878; AALP01000000-AALP01000114;
PR   Project:PRJNA13551;
DT   15-NOV-2007 (Rel. 93, Created)
DT   08-MAY-2017 (Rel. 132, Last updated, Version 9)
DE   Prochlorococcus marinus str. MIT 9211 genome.
KW   .
OS   Prochlorococcus marinus str. MIT 9211
OC   Bacteria; Cyanobacteria; Synechococcales; Prochloraceae; Prochlorococcus.
RN   [1]
RP   1-1688963
RX   DOI; 10.1371/journal.pgen.0030231.
RX   PUBMED; 18159947.
RA   Kettler G.C., Martiny A.C., Huang K., Zucker J., Coleman M.L., Rodrigue S.,
RA   Chen F., Lapidus A., Ferriera S., Johnson J., Steglich C., Church G.M.,
RA   Richardson P., Chisholm S.W.;
RT   "Patterns and implications of gene gain and loss in the evolution of
RT   Prochlorococcus";
RL   PloS Genet. 3(12):E231-E231(2007).
RN   [2]
RP   1-1688963
RA   Chisholm S., Huang K., Martiny A., Kettler G., Coleman M., Coe A.,
RA   Ferriera S., Johnson J., Frazier M., Venter J.C.;
RT   ;
RL   Submitted (24-OCT-2007) to the INSDC.
RL   Civil and Environmental Engineering, Massachusetts Institute of Technology,
RL   15 Vassar St, Cambridge, MA 02139, USA
DR   MD5; 9aec4026741c4a7d5178aaa5617524c3.
DR   BioSample; SAMN00622972.
DR   EnsemblGenomes-Gn; EBG00001460232.
DR   EnsemblGenomes-Gn; EBG00001460233.
DR   EnsemblGenomes-Gn; EBG00001460234.
DR   EnsemblGenomes-Gn; EBG00001460235.
DR   EnsemblGenomes-Gn; EBG00001460236.
DR   EnsemblGenomes-Gn; EBG00001460237.
DR   EnsemblGenomes-Gn; EBG00001460238.
DR   EnsemblGenomes-Gn; EBG00001460239.
DR   EnsemblGenomes-Gn; EBG00001460240.
DR   EnsemblGenomes-Gn; EBG00001460241.
DR   EnsemblGenomes-Gn; EBG00001460242.
DR   EnsemblGenomes-Gn; EBG00001460243.
DR   EnsemblGenomes-Gn; EBG00001460244.
DR   EnsemblGenomes-Gn; EBG00001460245.
DR   EnsemblGenomes-Gn; EBG00001460246.
DR   EnsemblGenomes-Gn; EBG00001460247.
DR   EnsemblGenomes-Gn; EBG00001460248.
DR   EnsemblGenomes-Gn; EBG00001460249.
DR   EnsemblGenomes-Gn; EBG00001460250.
DR   EnsemblGenomes-Gn; EBG00001460251.
DR   EnsemblGenomes-Gn; EBG00001460252.
DR   EnsemblGenomes-Gn; EBG00001460253.
DR   EnsemblGenomes-Gn; EBG00001460254.
DR   EnsemblGenomes-Gn; EBG00001460255.
DR   EnsemblGenomes-Gn; EBG00001460256.
DR   EnsemblGenomes-Gn; EBG00001460257.
DR   EnsemblGenomes-Gn; EBG00001460258.
DR   EnsemblGenomes-Gn; EBG00001460259.
DR   EnsemblGenomes-Gn; EBG00001460260.
DR   EnsemblGenomes-Gn; EBG00001460261.
DR   EnsemblGenomes-Gn; EBG00001460262.
DR   EnsemblGenomes-Gn; EBG00001460263.
DR   EnsemblGenomes-Gn; EBG00001460264.
DR   EnsemblGenomes-Gn; EBG00001460265.
DR   EnsemblGenomes-Gn; EBG00001460266.
DR   EnsemblGenomes-Gn; EBG00001460267.
DR   EnsemblGenomes-Gn; EBG00001460268.
DR   EnsemblGenomes-Gn; EBG00001460269.
DR   EnsemblGenomes-Gn; EBG00001460270.
DR   EnsemblGenomes-Gn; EBG00001460271.
DR   EnsemblGenomes-Gn; EBG00001460272.
DR   EnsemblGenomes-Gn; EBG00001460273.
DR   EnsemblGenomes-Gn; EBG00001460274.
DR   EnsemblGenomes-Gn; EBG00001460275.
DR   EnsemblGenomes-Gn; EBG00001460276.
DR   EnsemblGenomes-Gn; EBG00001460277.
DR   EnsemblGenomes-Gn; EBG00001460278.
DR   EnsemblGenomes-Gn; EBG00001460279.
DR   EnsemblGenomes-Gn; EBG00001460280.
DR   EnsemblGenomes-Gn; EBG00001460281.
DR   EnsemblGenomes-Gn; EBG00001460282.
DR   EnsemblGenomes-Gn; P9211_ffsVIMSS1309441.
DR   EnsemblGenomes-Gn; P9211_rnpBVIMSS1309440.
DR   EnsemblGenomes-Gn; P9211_rrfVIMSS1309439.
DR   EnsemblGenomes-Gn; P9211_rrlVIMSS1365801.
DR   EnsemblGenomes-Gn; P9211_rrsVIMSS1309438.
DR   EnsemblGenomes-Gn; P9211_tRNAAlaVIMSS1309346.
DR   EnsemblGenomes-Gn; P9211_tRNAAlaVIMSS1309372.
DR   EnsemblGenomes-Gn; P9211_tRNAArgVIMSS1309359.
DR   EnsemblGenomes-Gn; P9211_tRNAArgVIMSS1309364.
DR   EnsemblGenomes-Gn; P9211_tRNAArgVIMSS1309368.
DR   EnsemblGenomes-Gn; P9211_tRNAArgVIMSS1309379.
DR   EnsemblGenomes-Gn; P9211_tRNAAsnVIMSS1309370.
DR   EnsemblGenomes-Gn; P9211_tRNAAspVIMSS1309352.
DR   EnsemblGenomes-Gn; P9211_tRNACysVIMSS1309369.
DR   EnsemblGenomes-Gn; P9211_tRNAGlnVIMSS1309367.
DR   EnsemblGenomes-Gn; P9211_tRNAGluVIMSS1309378.
DR   EnsemblGenomes-Gn; P9211_tRNAGlyVIMSS1309344.
DR   EnsemblGenomes-Gn; P9211_tRNAGlyVIMSS1309363.
DR   EnsemblGenomes-Gn; P9211_tRNAGlyVIMSS1309383.
DR   EnsemblGenomes-Gn; P9211_tRNAHisVIMSS1309381.
DR   EnsemblGenomes-Gn; P9211_tRNAIleVIMSS1309371.
DR   EnsemblGenomes-Gn; P9211_tRNALeuVIMSS1309345.
DR   EnsemblGenomes-Gn; P9211_tRNALeuVIMSS1309350.
DR   EnsemblGenomes-Gn; P9211_tRNALeuVIMSS1309360.
DR   EnsemblGenomes-Gn; P9211_tRNALeuVIMSS1309361.
DR   EnsemblGenomes-Gn; P9211_tRNALeuVIMSS1309380.
DR   EnsemblGenomes-Gn; P9211_tRNALysVIMSS1309373.
DR   EnsemblGenomes-Gn; P9211_tRNAMetVIMSS1309358.
DR   EnsemblGenomes-Gn; P9211_tRNAMetVIMSS1309376.
DR   EnsemblGenomes-Gn; P9211_tRNAMetVIMSS1309377.
DR   EnsemblGenomes-Gn; P9211_tRNAPheVIMSS1309357.
DR   EnsemblGenomes-Gn; P9211_tRNAProVIMSS1309349.
DR   EnsemblGenomes-Gn; P9211_tRNAProVIMSS1309374.
DR   EnsemblGenomes-Gn; P9211_tRNASerVIMSS1309347.
DR   EnsemblGenomes-Gn; P9211_tRNASerVIMSS1309348.
DR   EnsemblGenomes-Gn; P9211_tRNASerVIMSS1309365.
DR   EnsemblGenomes-Gn; P9211_tRNASerVIMSS1309375.
DR   EnsemblGenomes-Gn; P9211_tRNAThrVIMSS1309354.
DR   EnsemblGenomes-Gn; P9211_tRNAThrVIMSS1309355.
DR   EnsemblGenomes-Gn; P9211_tRNAThrVIMSS1309356.
DR   EnsemblGenomes-Gn; P9211_tRNAThrVIMSS1309366.
DR   EnsemblGenomes-Gn; P9211_tRNATrpVIMSS1309351.
DR   EnsemblGenomes-Gn; P9211_tRNATyrVIMSS1309353.
DR   EnsemblGenomes-Gn; P9211_tRNAValVIMSS1309362.
DR   EnsemblGenomes-Gn; P9211_tRNAValVIMSS1309382.
DR   EnsemblGenomes-Tr; EBT00001614029.
DR   EnsemblGenomes-Tr; EBT00001614030.
DR   EnsemblGenomes-Tr; EBT00001614031.
DR   EnsemblGenomes-Tr; EBT00001614032.
DR   EnsemblGenomes-Tr; EBT00001614033.
DR   EnsemblGenomes-Tr; EBT00001614034.
DR   EnsemblGenomes-Tr; EBT00001614035.
DR   EnsemblGenomes-Tr; EBT00001614036.
DR   EnsemblGenomes-Tr; EBT00001614037.
DR   EnsemblGenomes-Tr; EBT00001614038.
DR   EnsemblGenomes-Tr; EBT00001614039.
DR   EnsemblGenomes-Tr; EBT00001614040.
DR   EnsemblGenomes-Tr; EBT00001614041.
DR   EnsemblGenomes-Tr; EBT00001614042.
DR   EnsemblGenomes-Tr; EBT00001614043.
DR   EnsemblGenomes-Tr; EBT00001614044.
DR   EnsemblGenomes-Tr; EBT00001614045.
DR   EnsemblGenomes-Tr; EBT00001614046.
DR   EnsemblGenomes-Tr; EBT00001614047.
DR   EnsemblGenomes-Tr; EBT00001614048.
DR   EnsemblGenomes-Tr; EBT00001614049.
DR   EnsemblGenomes-Tr; EBT00001614050.
DR   EnsemblGenomes-Tr; EBT00001614051.
DR   EnsemblGenomes-Tr; EBT00001614052.
DR   EnsemblGenomes-Tr; EBT00001614053.
DR   EnsemblGenomes-Tr; EBT00001614054.
DR   EnsemblGenomes-Tr; EBT00001614055.
DR   EnsemblGenomes-Tr; EBT00001614056.
DR   EnsemblGenomes-Tr; EBT00001614057.
DR   EnsemblGenomes-Tr; EBT00001614058.
DR   EnsemblGenomes-Tr; EBT00001614059.
DR   EnsemblGenomes-Tr; EBT00001614060.
DR   EnsemblGenomes-Tr; EBT00001614061.
DR   EnsemblGenomes-Tr; EBT00001614062.
DR   EnsemblGenomes-Tr; EBT00001614063.
DR   EnsemblGenomes-Tr; EBT00001614064.
DR   EnsemblGenomes-Tr; EBT00001614065.
DR   EnsemblGenomes-Tr; EBT00001614066.
DR   EnsemblGenomes-Tr; EBT00001614067.
DR   EnsemblGenomes-Tr; EBT00001614068.
DR   EnsemblGenomes-Tr; EBT00001614069.
DR   EnsemblGenomes-Tr; EBT00001614070.
DR   EnsemblGenomes-Tr; EBT00001614071.
DR   EnsemblGenomes-Tr; EBT00001614072.
DR   EnsemblGenomes-Tr; EBT00001614073.
DR   EnsemblGenomes-Tr; EBT00001614074.
DR   EnsemblGenomes-Tr; EBT00001614075.
DR   EnsemblGenomes-Tr; EBT00001614076.
DR   EnsemblGenomes-Tr; EBT00001614077.
DR   EnsemblGenomes-Tr; EBT00001614078.
DR   EnsemblGenomes-Tr; EBT00001614079.
DR   EnsemblGenomes-Tr; P9211_ffsVIMSS1309441-1.
DR   EnsemblGenomes-Tr; P9211_rnpBVIMSS1309440-1.
DR   EnsemblGenomes-Tr; P9211_rrfVIMSS1309439-1.
DR   EnsemblGenomes-Tr; P9211_rrlVIMSS1365801-1.
DR   EnsemblGenomes-Tr; P9211_rrsVIMSS1309438-1.
DR   EnsemblGenomes-Tr; P9211_tRNAAlaVIMSS1309346-1.
DR   EnsemblGenomes-Tr; P9211_tRNAAlaVIMSS1309372-1.
DR   EnsemblGenomes-Tr; P9211_tRNAArgVIMSS1309359-1.
DR   EnsemblGenomes-Tr; P9211_tRNAArgVIMSS1309364-1.
DR   EnsemblGenomes-Tr; P9211_tRNAArgVIMSS1309368-1.
DR   EnsemblGenomes-Tr; P9211_tRNAArgVIMSS1309379-1.
DR   EnsemblGenomes-Tr; P9211_tRNAAsnVIMSS1309370-1.
DR   EnsemblGenomes-Tr; P9211_tRNAAspVIMSS1309352-1.
DR   EnsemblGenomes-Tr; P9211_tRNACysVIMSS1309369-1.
DR   EnsemblGenomes-Tr; P9211_tRNAGlnVIMSS1309367-1.
DR   EnsemblGenomes-Tr; P9211_tRNAGluVIMSS1309378-1.
DR   EnsemblGenomes-Tr; P9211_tRNAGlyVIMSS1309344-1.
DR   EnsemblGenomes-Tr; P9211_tRNAGlyVIMSS1309363-1.
DR   EnsemblGenomes-Tr; P9211_tRNAGlyVIMSS1309383-1.
DR   EnsemblGenomes-Tr; P9211_tRNAHisVIMSS1309381-1.
DR   EnsemblGenomes-Tr; P9211_tRNAIleVIMSS1309371-1.
DR   EnsemblGenomes-Tr; P9211_tRNALeuVIMSS1309345-1.
DR   EnsemblGenomes-Tr; P9211_tRNALeuVIMSS1309350-1.
DR   EnsemblGenomes-Tr; P9211_tRNALeuVIMSS1309360-1.
DR   EnsemblGenomes-Tr; P9211_tRNALeuVIMSS1309361-1.
DR   EnsemblGenomes-Tr; P9211_tRNALeuVIMSS1309380-1.
DR   EnsemblGenomes-Tr; P9211_tRNALysVIMSS1309373-1.
DR   EnsemblGenomes-Tr; P9211_tRNAMetVIMSS1309358-1.
DR   EnsemblGenomes-Tr; P9211_tRNAMetVIMSS1309376-1.
DR   EnsemblGenomes-Tr; P9211_tRNAMetVIMSS1309377-1.
DR   EnsemblGenomes-Tr; P9211_tRNAPheVIMSS1309357-1.
DR   EnsemblGenomes-Tr; P9211_tRNAProVIMSS1309349-1.
DR   EnsemblGenomes-Tr; P9211_tRNAProVIMSS1309374-1.
DR   EnsemblGenomes-Tr; P9211_tRNASerVIMSS1309347-1.
DR   EnsemblGenomes-Tr; P9211_tRNASerVIMSS1309348-1.
DR   EnsemblGenomes-Tr; P9211_tRNASerVIMSS1309365-1.
DR   EnsemblGenomes-Tr; P9211_tRNASerVIMSS1309375-1.
DR   EnsemblGenomes-Tr; P9211_tRNAThrVIMSS1309354-1.
DR   EnsemblGenomes-Tr; P9211_tRNAThrVIMSS1309355-1.
DR   EnsemblGenomes-Tr; P9211_tRNAThrVIMSS1309356-1.
DR   EnsemblGenomes-Tr; P9211_tRNAThrVIMSS1309366-1.
DR   EnsemblGenomes-Tr; P9211_tRNATrpVIMSS1309351-1.
DR   EnsemblGenomes-Tr; P9211_tRNATyrVIMSS1309353-1.
DR   EnsemblGenomes-Tr; P9211_tRNAValVIMSS1309362-1.
DR   EnsemblGenomes-Tr; P9211_tRNAValVIMSS1309382-1.
DR   EuropePMC; PMC3390001; 22768379.
DR   EuropePMC; PMC6102989; 29915114.
DR   GOA; P0C8E5.
DR   InterPro; IPR019654; NADH-quinone_OxRdatse_su_L.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01067; ATPC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01704; Downstream-peptide.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000878.
DR   SILVA-SSU; CP000878.
DR   UniProtKB/Swiss-Prot; P0C8E5; NDHL_PROM4.
CC   Bacteria available from the Chisholm lab, Department of Civil and
CC   Environmental Engineering, MIT.  chisholm@mit.edu.
FH   Key             Location/Qualifiers
FT   source          1..1688963
FT                   /organism="Prochlorococcus marinus str. MIT 9211"
FT                   /strain="MIT9211"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:93059"
FT   gene            162..1355
FT                   /gene="dnaN"
FT                   /locus_tag="P9211_00001"
FT   CDS_pept        162..1355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="P9211_00001"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number=""
FT                   /note="COG592 DNA polymerase sliding clamp subunit (PCNA
FT                   homolog) [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07931"
FT                   /db_xref="GOA:A9B9J7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9J7"
FT                   /protein_id="ABX07931.1"
FT   gene            1357..2124
FT                   /locus_tag="P9211_00011"
FT   CDS_pept        1357..2124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07932"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9J9"
FT                   /protein_id="ABX07932.1"
FT   gene            2130..4544
FT                   /locus_tag="P9211_00021"
FT   CDS_pept        2130..4544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00021"
FT                   /product="phosphoribosylformylglycinamidine synthetase II"
FT                   /EC_number=""
FT                   /note="COG46 Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, synthetase domain [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07933"
FT                   /db_xref="GOA:A9B9K0"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9K0"
FT                   /protein_id="ABX07933.1"
FT   gene            4620..6077
FT                   /gene="purF"
FT                   /locus_tag="P9211_00031"
FT   CDS_pept        4620..6077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="P9211_00031"
FT                   /product="Glutamine amidotransferase
FT                   class-II:Phosphoribosyl transferase"
FT                   /EC_number=""
FT                   /note="COG34 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07934"
FT                   /db_xref="GOA:A9B9K1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9K1"
FT                   /protein_id="ABX07934.1"
FT   gene            complement(6074..8560)
FT                   /locus_tag="P9211_00041"
FT   CDS_pept        complement(6074..8560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00041"
FT                   /product="DNA gyrase/topoisomerase IV, subunit A"
FT                   /EC_number=""
FT                   /note="COG188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07935"
FT                   /db_xref="GOA:A9B9K2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9K2"
FT                   /protein_id="ABX07935.1"
FT                   DEVIPLIDPNSHSFIN"
FT   gene            complement(8638..9531)
FT                   /locus_tag="P9211_00051"
FT   CDS_pept        complement(8638..9531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00051"
FT                   /product="Flp pilus assembly protein TadD"
FT                   /note="contains TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07936"
FT                   /db_xref="GOA:A9B9K3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019568"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9K3"
FT                   /protein_id="ABX07936.1"
FT                   ATSIAKALANSNFQNK"
FT   gene            complement(9543..10508)
FT                   /locus_tag="P9211_00061"
FT   CDS_pept        complement(9543..10508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00061"
FT                   /product="Uncharacterized Fe-S protein"
FT                   /note="COG1600 Uncharacterized Fe-S protein [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07937"
FT                   /db_xref="GOA:A9B9K4"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9K4"
FT                   /protein_id="ABX07937.1"
FT   gene            10637..11380
FT                   /locus_tag="P9211_00071"
FT   CDS_pept        10637..11380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00071"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG2928 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07938"
FT                   /db_xref="GOA:A9B9K5"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9K5"
FT                   /protein_id="ABX07938.1"
FT   gene            11415..12050
FT                   /gene="nusB"
FT                   /locus_tag="P9211_00081"
FT   CDS_pept        11415..12050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="P9211_00081"
FT                   /product="Antitermination protein NusB"
FT                   /note="COG781 Transcription termination factor
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07939"
FT                   /db_xref="GOA:A9B9K6"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9K6"
FT                   /protein_id="ABX07939.1"
FT   gene            12050..13384
FT                   /gene="ftsY"
FT                   /locus_tag="P9211_00091"
FT   CDS_pept        12050..13384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="P9211_00091"
FT                   /product="signal recognition particle docking protein FtsY"
FT                   /note="COG552 Signal recognition particle GTPase
FT                   [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07940"
FT                   /db_xref="GOA:A9B9K7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9K7"
FT                   /protein_id="ABX07940.1"
FT   gene            13442..14299
FT                   /locus_tag="P9211_00101"
FT   CDS_pept        13442..14299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00101"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07941"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9K8"
FT                   /protein_id="ABX07941.1"
FT                   DDDA"
FT   gene            14250..14852
FT                   /locus_tag="P9211_00111"
FT   CDS_pept        14250..14852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00111"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07942"
FT                   /db_xref="GOA:A9B9K9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9K9"
FT                   /protein_id="ABX07942.1"
FT   gene            14906..16294
FT                   /gene="argH"
FT                   /locus_tag="P9211_00121"
FT   CDS_pept        14906..16294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="P9211_00121"
FT                   /product="Fumarate lyase:Delta crystallin"
FT                   /EC_number=""
FT                   /note="COG165 Argininosuccinate lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07943"
FT                   /db_xref="GOA:A9B9L0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B9L0"
FT                   /protein_id="ABX07943.1"
FT                   SLKE"
FT   gene            16417..17154
FT                   /locus_tag="P9211_00131"
FT   CDS_pept        16417..17154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00131"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07944"
FT                   /db_xref="GOA:A9B9L1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9L1"
FT                   /protein_id="ABX07944.1"
FT   gene            complement(17159..18160)
FT                   /locus_tag="P9211_00141"
FT   CDS_pept        complement(17159..18160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00141"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /note="COG42 tRNA-dihydrouridine synthase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07945"
FT                   /db_xref="GOA:A9B9L2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9L2"
FT                   /protein_id="ABX07945.1"
FT   gene            18235..18741
FT                   /locus_tag="P9211_00151"
FT   CDS_pept        18235..18741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00151"
FT                   /product="protein containing methionine sulfoxide reductase
FT                   conserved domain"
FT                   /EC_number=""
FT                   /note="COG229 Conserved domain frequently associated with
FT                   peptide methionine sulfoxide reductase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07946"
FT                   /db_xref="GOA:A9B9L3"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9L3"
FT                   /protein_id="ABX07946.1"
FT                   FRPSK"
FT   gene            18859..19602
FT                   /gene="grpE"
FT                   /locus_tag="P9211_00161"
FT   CDS_pept        18859..19602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="P9211_00161"
FT                   /product="Heat shock protein GrpE"
FT                   /note="COG576 Molecular chaperone GrpE (heat shock protein)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07947"
FT                   /db_xref="GOA:A9B9L4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B9L4"
FT                   /protein_id="ABX07947.1"
FT   gene            19645..20778
FT                   /gene="dnaJ"
FT                   /locus_tag="P9211_00171"
FT   CDS_pept        19645..20778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="P9211_00171"
FT                   /product="DnaJ protein"
FT                   /note="COG484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07948"
FT                   /db_xref="GOA:A9B9L5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9L5"
FT                   /protein_id="ABX07948.1"
FT   gene            20771..21019
FT                   /locus_tag="P9211_00181"
FT   CDS_pept        20771..21019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00181"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07949"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9L6"
FT                   /protein_id="ABX07949.1"
FT   gene            21009..21950
FT                   /locus_tag="P9211_00191"
FT   CDS_pept        21009..21950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00191"
FT                   /product="Predicted GTPase"
FT                   /EC_number=""
FT                   /note="COG1162 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07950"
FT                   /db_xref="GOA:A9B9L7"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9L7"
FT                   /protein_id="ABX07950.1"
FT   gene            complement(21919..22266)
FT                   /locus_tag="P9211_00201"
FT   CDS_pept        complement(21919..22266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00201"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG718 Uncharacterized protein conserved in bacteria
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07951"
FT                   /db_xref="GOA:A9B9L9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B9L9"
FT                   /protein_id="ABX07951.1"
FT                   NLNLPGIDDGD"
FT   gene            complement(22303..23184)
FT                   /gene="murB"
FT                   /locus_tag="P9211_00211"
FT   CDS_pept        complement(22303..23184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="P9211_00211"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number=""
FT                   /note="COG812 UDP-N-acetylmuramate dehydrogenase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07952"
FT                   /db_xref="GOA:A9B9J8"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9J8"
FT                   /protein_id="ABX07952.1"
FT                   FILQPEVKKIGF"
FT   gene            complement(23188..24618)
FT                   /gene="murC"
FT                   /locus_tag="P9211_00221"
FT   CDS_pept        complement(23188..24618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="P9211_00221"
FT                   /product="Probable UDP-N-acetylmuramate-alanine ligase"
FT                   /EC_number=""
FT                   /note="COG773 UDP-N-acetylmuramate-alanine ligase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07953"
FT                   /db_xref="GOA:A9B9L8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9L8"
FT                   /protein_id="ABX07953.1"
FT                   KLLEKSKTNKNQSKHLVA"
FT   gene            24834..25856
FT                   /gene="gap2"
FT                   /locus_tag="P9211_00231"
FT   CDS_pept        24834..25856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap2"
FT                   /locus_tag="P9211_00231"
FT                   /product="Glyceraldehyde 3-phosphate
FT                   dehydrogenase(NADP+)(phosphorylating)"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG57 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07954"
FT                   /db_xref="GOA:A9B9H9"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9H9"
FT                   /protein_id="ABX07954.1"
FT                   "
FT   gene            complement(25876..26886)
FT                   /gene="thiL"
FT                   /locus_tag="P9211_00241"
FT   CDS_pept        complement(25876..26886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="P9211_00241"
FT                   /product="putative thiamine-monophosphate kinase"
FT                   /EC_number=""
FT                   /note="COG611 Thiamine monophosphate kinase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07955"
FT                   /db_xref="GOA:A9B9I0"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9I0"
FT                   /protein_id="ABX07955.1"
FT   gene            complement(26879..27955)
FT                   /locus_tag="P9211_00251"
FT   CDS_pept        complement(26879..27955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00251"
FT                   /product="Cyclophilin-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /EC_number=""
FT                   /note="COG652 Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07956"
FT                   /db_xref="GOA:A9B9I1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9I1"
FT                   /protein_id="ABX07956.1"
FT                   QIISIKVLNGSEKLKSHA"
FT   gene            28019..28579
FT                   /gene="efp"
FT                   /locus_tag="P9211_00261"
FT   CDS_pept        28019..28579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="P9211_00261"
FT                   /product="Elongation factor P (EF-P)"
FT                   /EC_number=""
FT                   /note="COG231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07957"
FT                   /db_xref="GOA:A9B9I2"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B9I2"
FT                   /protein_id="ABX07957.1"
FT   gene            28579..29088
FT                   /gene="accB"
FT                   /locus_tag="P9211_00271"
FT   CDS_pept        28579..29088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="P9211_00271"
FT                   /product="Biotin / Lipoyl attachment:Acetyl-CoA biotin
FT                   carboxyl carrier subunit"
FT                   /EC_number=""
FT                   /note="COG511 Biotin carboxyl carrier protein [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07958"
FT                   /db_xref="GOA:A9B9I3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9I3"
FT                   /protein_id="ABX07958.1"
FT                   MRVKPL"
FT   gene            complement(29075..30121)
FT                   /gene="pdxA"
FT                   /locus_tag="P9211_00281"
FT   CDS_pept        complement(29075..30121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="P9211_00281"
FT                   /product="putative pyridoxal phosphate biosynthetic protein
FT                   PdxA"
FT                   /EC_number=""
FT                   /note="COG1995 Pyridoxal phosphate biosynthesis protein
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07959"
FT                   /db_xref="GOA:A9B9I4"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9I4"
FT                   /protein_id="ABX07959.1"
FT                   SQKKLKEV"
FT   gene            30126..30308
FT                   /locus_tag="P9211_00291"
FT   CDS_pept        30126..30308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00291"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07960"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9I5"
FT                   /protein_id="ABX07960.1"
FT                   NWSEFIRQRFEKNDS"
FT   gene            complement(30317..31225)
FT                   /locus_tag="P9211_00301"
FT   CDS_pept        complement(30317..31225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00301"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07961"
FT                   /db_xref="GOA:A9B9I6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9I6"
FT                   /protein_id="ABX07961.1"
FT   gene            31256..31474
FT                   /locus_tag="P9211_00311"
FT   CDS_pept        31256..31474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00311"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07962"
FT                   /db_xref="GOA:A9B9I7"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9I7"
FT                   /protein_id="ABX07962.1"
FT   gene            complement(31481..31888)
FT                   /locus_tag="P9211_00321"
FT   CDS_pept        complement(31481..31888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00321"
FT                   /product="HNH endonuclease:HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07963"
FT                   /db_xref="GOA:A9B9I8"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9I8"
FT                   /protein_id="ABX07963.1"
FT   gene            complement(32083..32487)
FT                   /locus_tag="P9211_00331"
FT   CDS_pept        complement(32083..32487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00331"
FT                   /product="type II secretion system protein-like prrotein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07964"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9I9"
FT                   /protein_id="ABX07964.1"
FT   gene            32853..33140
FT                   /locus_tag="P9211_00341"
FT   CDS_pept        32853..33140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07965"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9J0"
FT                   /protein_id="ABX07965.1"
FT   gene            complement(33241..34398)
FT                   /gene="dhsS"
FT                   /locus_tag="P9211_00351"
FT   CDS_pept        complement(33241..34398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhsS"
FT                   /locus_tag="P9211_00351"
FT                   /product="soluble hydrogenase small subunit"
FT                   /EC_number=""
FT                   /note="COG75 Serine-pyruvate aminotransferase/archaeal
FT                   aspartate aminotransferase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07966"
FT                   /db_xref="GOA:A9B9J1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9J1"
FT                   /protein_id="ABX07966.1"
FT   gene            34536..35621
FT                   /gene="cbiD"
FT                   /locus_tag="P9211_00361"
FT   CDS_pept        34536..35621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiD"
FT                   /locus_tag="P9211_00361"
FT                   /product="CbiD protein"
FT                   /note="COG1903 Cobalamin biosynthesis protein CbiD
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07967"
FT                   /db_xref="GOA:A9B9J2"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9J2"
FT                   /protein_id="ABX07967.1"
FT   gene            35605..37251
FT                   /locus_tag="P9211_00371"
FT   CDS_pept        35605..37251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00371"
FT                   /product="Glutamine amidotransferase class-I:GMP synthase"
FT                   /EC_number=""
FT                   /note="COG519 GMP synthase, PP-ATPase domain/subunit
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07968"
FT                   /db_xref="GOA:A9B9J3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9J3"
FT                   /protein_id="ABX07968.1"
FT   gene            37473..37961
FT                   /locus_tag="P9211_00381"
FT   CDS_pept        37473..37961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00381"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07969"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9J4"
FT                   /protein_id="ABX07969.1"
FT   gene            38058..38945
FT                   /locus_tag="P9211_00391"
FT   CDS_pept        38058..38945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00391"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07970"
FT                   /db_xref="GOA:A9B9J5"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9J5"
FT                   /protein_id="ABX07970.1"
FT                   QKSRKFGLSLSRLK"
FT   gene            complement(39230..41320)
FT                   /locus_tag="P9211_00401"
FT   CDS_pept        complement(39230..41320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00401"
FT                   /product="Predicted acyltransferase"
FT                   /note="COG1835 Predicted acyltransferases [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07971"
FT                   /db_xref="GOA:A9B9J6"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9J6"
FT                   /protein_id="ABX07971.1"
FT                   NQ"
FT   gene            41379..41990
FT                   /locus_tag="P9211_00411"
FT   CDS_pept        41379..41990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07972"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9D5"
FT                   /protein_id="ABX07972.1"
FT   gene            42005..42352
FT                   /locus_tag="P9211_00421"
FT   CDS_pept        42005..42352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00421"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07973"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9D6"
FT                   /protein_id="ABX07973.1"
FT                   LDLLKLYLSDE"
FT   gene            42389..44197
FT                   /locus_tag="P9211_00431"
FT   CDS_pept        42389..44197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00431"
FT                   /product="Putative penicillin-binding protein"
FT                   /EC_number=""
FT                   /note="COG768 Cell division protein FtsI/penicillin-binding
FT                   protein 2 [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07974"
FT                   /db_xref="GOA:A9B9D7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9D7"
FT                   /protein_id="ABX07974.1"
FT   gene            complement(44220..44426)
FT                   /locus_tag="P9211_00441"
FT   CDS_pept        complement(44220..44426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00441"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07975"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9D8"
FT                   /protein_id="ABX07975.1"
FT   gene            44534..44698
FT                   /locus_tag="P9211_00451"
FT   CDS_pept        44534..44698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00451"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07976"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9D9"
FT                   /protein_id="ABX07976.1"
FT                   QWFHLHESF"
FT   gene            complement(44660..45184)
FT                   /locus_tag="P9211_00461"
FT   CDS_pept        complement(44660..45184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00461"
FT                   /product="possible reductase"
FT                   /note="COG431 Predicted flavoprotein [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07977"
FT                   /db_xref="GOA:A9B9E0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9E0"
FT                   /protein_id="ABX07977.1"
FT                   KRLMQMEPLRL"
FT   gene            complement(45233..47074)
FT                   /locus_tag="P9211_00471"
FT   CDS_pept        complement(45233..47074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00471"
FT                   /product="flavoprotein"
FT                   /note="COG426 Uncharacterized flavoproteins [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07978"
FT                   /db_xref="GOA:A9B9E1"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9E1"
FT                   /protein_id="ABX07978.1"
FT   gene            complement(47074..48843)
FT                   /locus_tag="P9211_00481"
FT   CDS_pept        complement(47074..48843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00481"
FT                   /product="flavoprotein"
FT                   /note="COG426 Uncharacterized flavoproteins [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07979"
FT                   /db_xref="GOA:A9B9E2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9E2"
FT                   /protein_id="ABX07979.1"
FT                   KTAVHHRKVGTSY"
FT   gene            complement(48971..49864)
FT                   /locus_tag="P9211_00491"
FT   CDS_pept        complement(48971..49864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00491"
FT                   /product="Hypothetical protein"
FT                   /note="COG4279 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07980"
FT                   /db_xref="GOA:A9B9E3"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9E3"
FT                   /protein_id="ABX07980.1"
FT                   QKEAQKAMIKAMSENN"
FT   gene            complement(49870..53073)
FT                   /gene="hepA"
FT                   /locus_tag="P9211_00501"
FT   CDS_pept        complement(49870..53073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="P9211_00501"
FT                   /product="Superfamily II DNA/RNA helicase, SNF2 family"
FT                   /note="COG553 Superfamily II DNA/RNA helicases, SNF2 family
FT                   [Transcription / DNA replication, recombination, and
FT                   repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07981"
FT                   /db_xref="GOA:A9B9E4"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9E4"
FT                   /protein_id="ABX07981.1"
FT   gene            53169..55841
FT                   /gene="alaS"
FT                   /locus_tag="P9211_00511"
FT   CDS_pept        53169..55841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="P9211_00511"
FT                   /product="Alanyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG13 Alanyl-tRNA synthetase [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07982"
FT                   /db_xref="GOA:A9B9E5"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B9E5"
FT                   /protein_id="ABX07982.1"
FT   gene            complement(55844..57790)
FT                   /gene="speA"
FT                   /locus_tag="P9211_00521"
FT   CDS_pept        complement(55844..57790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="P9211_00521"
FT                   /product="Orn/DAP/Arg decarboxylase family 2"
FT                   /EC_number=""
FT                   /note="COG1166 Arginine decarboxylase (spermidine
FT                   biosynthesis) [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07983"
FT                   /db_xref="GOA:A9B9E6"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9E6"
FT                   /protein_id="ABX07983.1"
FT                   VETSLRQSTYLQE"
FT   gene            57941..58396
FT                   /gene="ndk"
FT                   /locus_tag="P9211_00531"
FT   CDS_pept        57941..58396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="P9211_00531"
FT                   /product="Nucleoside diphosphate kinase"
FT                   /EC_number=""
FT                   /note="COG105 Nucleoside diphosphate kinase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07984"
FT                   /db_xref="GOA:A9B9E7"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B9E7"
FT                   /protein_id="ABX07984.1"
FT   gene            complement(58353..59513)
FT                   /gene="dadA"
FT                   /locus_tag="P9211_00541"
FT   CDS_pept        complement(58353..59513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /locus_tag="P9211_00541"
FT                   /product="putative thiamine biosynthesis oxidoreductase"
FT                   /EC_number=""
FT                   /note="COG665 Glycine/D-amino acid oxidases (deaminating)
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07985"
FT                   /db_xref="GOA:A9B9E8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9E8"
FT                   /protein_id="ABX07985.1"
FT   gene            59618..61093
FT                   /gene="gatB"
FT                   /locus_tag="P9211_00551"
FT   CDS_pept        59618..61093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="P9211_00551"
FT                   /product="Glutamyl-tRNA (Gln) amidotransferase subunit B"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG64 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog) [Translation, ribosomal structure
FT                   and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07986"
FT                   /db_xref="GOA:A9B9E9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9E9"
FT                   /protein_id="ABX07986.1"
FT   gene            complement(61100..61705)
FT                   /gene="coaE"
FT                   /locus_tag="P9211_00561"
FT   CDS_pept        complement(61100..61705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="P9211_00561"
FT                   /product="putative dephospho-CoA kinase"
FT                   /EC_number=""
FT                   /note="COG237 Dephospho-CoA kinase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07987"
FT                   /db_xref="GOA:A9B9F0"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9F0"
FT                   /protein_id="ABX07987.1"
FT   gene            61776..63014
FT                   /gene="argJ"
FT                   /locus_tag="P9211_00571"
FT   CDS_pept        61776..63014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="P9211_00571"
FT                   /product="ArgJ family"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1364 N-acetylglutamate synthase
FT                   (N-acetylornithine aminotransferase) [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07988"
FT                   /db_xref="GOA:A9B9F1"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9F1"
FT                   /protein_id="ABX07988.1"
FT                   SEEYIKINSEYTT"
FT   gene            complement(63047..64879)
FT                   /locus_tag="P9211_00581"
FT   CDS_pept        complement(63047..64879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00581"
FT                   /product="ABC-type bacteriocin/lantibiotic exporter,
FT                   contain an N-terminal double-glycine peptidase domain"
FT                   /note="COG2274 ABC-type bacteriocin/lantibiotic exporters,
FT                   contain an N-terminal double-glycine peptidase domain
FT                   [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07989"
FT                   /db_xref="GOA:A9B9F2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9F2"
FT                   /protein_id="ABX07989.1"
FT   gene            65307..66431
FT                   /locus_tag="P9211_00591"
FT   CDS_pept        65307..66431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00591"
FT                   /product="Putative RNA methylase family UPF0020"
FT                   /note="COG116 Predicted N6-adenine-specific DNA methylase
FT                   [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07990"
FT                   /db_xref="GOA:A9B9F3"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9F3"
FT                   /protein_id="ABX07990.1"
FT   gene            complement(66432..66824)
FT                   /locus_tag="P9211_00601"
FT   CDS_pept        complement(66432..66824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07991"
FT                   /db_xref="GOA:A9B9F4"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9F4"
FT                   /protein_id="ABX07991.1"
FT   gene            complement(66824..67291)
FT                   /locus_tag="P9211_00611"
FT   CDS_pept        complement(66824..67291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07992"
FT                   /db_xref="GOA:A9B9F5"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9F5"
FT                   /protein_id="ABX07992.1"
FT   gene            67506..67637
FT                   /locus_tag="P9211_00621"
FT   CDS_pept        67506..67637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00621"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07993"
FT                   /db_xref="GOA:A9B9F6"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9F6"
FT                   /protein_id="ABX07993.1"
FT   gene            67807..68028
FT                   /locus_tag="P9211_00631"
FT   CDS_pept        67807..68028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00631"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07994"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9B7"
FT                   /protein_id="ABX07994.1"
FT   gene            68071..68454
FT                   /locus_tag="P9211_00641"
FT   CDS_pept        68071..68454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07995"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9B8"
FT                   /protein_id="ABX07995.1"
FT   gene            68494..72117
FT                   /gene="smc"
FT                   /locus_tag="P9211_00651"
FT   CDS_pept        68494..72117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="P9211_00651"
FT                   /product="putative chromosome segregation protein, SMC
FT                   ATPase superfamily"
FT                   /note="COG1196 Chromosome segregation ATPases [Cell
FT                   division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00651"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07996"
FT                   /db_xref="GOA:A9B9B9"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9B9"
FT                   /protein_id="ABX07996.1"
FT   gene            72185..73249
FT                   /locus_tag="P9211_00661"
FT   CDS_pept        72185..73249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00661"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00661"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07997"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9C0"
FT                   /protein_id="ABX07997.1"
FT                   EDNKSTNNIIEDPW"
FT   gene            complement(73267..74487)
FT                   /locus_tag="P9211_00671"
FT   CDS_pept        complement(73267..74487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00671"
FT                   /product="cyanobacteria-specific protein lipid A
FT                   disaccharide synthetase-like protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00671"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07998"
FT                   /db_xref="GOA:A9B9C1"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9C1"
FT                   /protein_id="ABX07998.1"
FT                   FLSSSDE"
FT   gene            complement(74602..74683)
FT                   /locus_tag="P9211_tRNALeuVIMSS1309361"
FT                   /note="tRNA-Leu"
FT   tRNA            complement(74602..74683)
FT                   /locus_tag="P9211_tRNALeuVIMSS1309361"
FT                   /product="tRNA-Leu"
FT   gene            74801..76147
FT                   /gene="accC"
FT                   /locus_tag="P9211_00681"
FT   CDS_pept        74801..76147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="P9211_00681"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG4770 Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00681"
FT                   /db_xref="EnsemblGenomes-Tr:ABX07999"
FT                   /db_xref="GOA:A9B9C2"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9C2"
FT                   /protein_id="ABX07999.1"
FT   gene            complement(76174..76482)
FT                   /locus_tag="P9211_00691"
FT   CDS_pept        complement(76174..76482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00691"
FT                   /product="YGGT family, conserved hypothetical integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00691"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08000"
FT                   /db_xref="GOA:A9B9C3"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9C3"
FT                   /protein_id="ABX08000.1"
FT   gene            76580..76756
FT                   /locus_tag="P9211_00701"
FT   CDS_pept        76580..76756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00701"
FT                   /product="Photosystem II protein X PsbX"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00701"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08001"
FT                   /db_xref="GOA:A9B9C4"
FT                   /db_xref="InterPro:IPR009518"
FT                   /db_xref="InterPro:IPR023428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B9C4"
FT                   /protein_id="ABX08001.1"
FT                   IWVSQKDALERKR"
FT   gene            76845..77831
FT                   /locus_tag="P9211_00711"
FT   CDS_pept        76845..77831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00711"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00711"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08002"
FT                   /db_xref="GOA:A9B9C5"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9C5"
FT                   /protein_id="ABX08002.1"
FT   gene            complement(77864..78112)
FT                   /gene="hli2"
FT                   /locus_tag="P9211_00721"
FT   CDS_pept        complement(77864..78112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hli2"
FT                   /locus_tag="P9211_00721"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00721"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08003"
FT                   /db_xref="GOA:A9B9C6"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9C6"
FT                   /protein_id="ABX08003.1"
FT   gene            complement(78125..80113)
FT                   /locus_tag="P9211_00731"
FT   CDS_pept        complement(78125..80113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00731"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /EC_number=""
FT                   /note="COG4178 ABC-type uncharacterized transport system,
FT                   permease and ATPase components [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00731"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08004"
FT                   /db_xref="GOA:A9B9C7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9C7"
FT                   /protein_id="ABX08004.1"
FT   gene            complement(80380..80721)
FT                   /gene="hit"
FT                   /locus_tag="P9211_00741"
FT   CDS_pept        complement(80380..80721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hit"
FT                   /locus_tag="P9211_00741"
FT                   /product="HIT (Histidine triad) family protein"
FT                   /EC_number=""
FT                   /note="COG537 Diadenosine tetraphosphate (Ap4A) hydrolase
FT                   and other HIT family hydrolases [Nucleotide transport and
FT                   metabolism / Carbohydrate transport and metabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00741"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08005"
FT                   /db_xref="GOA:A9B9C8"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9C8"
FT                   /protein_id="ABX08005.1"
FT                   GRTLTWPPG"
FT   gene            complement(81036..81206)
FT                   /locus_tag="P9211_00751"
FT   CDS_pept        complement(81036..81206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00751"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00751"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08006"
FT                   /db_xref="GOA:A9B9C9"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9C9"
FT                   /protein_id="ABX08006.1"
FT                   KRKQIQRKRSR"
FT   gene            complement(81287..81892)
FT                   /gene="def"
FT                   /locus_tag="P9211_00761"
FT   CDS_pept        complement(81287..81892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="P9211_00761"
FT                   /product="putative formylmethionine deformylase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG242 N-formylmethionyl-tRNA deformylase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00761"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08007"
FT                   /db_xref="GOA:A9B9D0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9D0"
FT                   /protein_id="ABX08007.1"
FT   gene            81970..83907
FT                   /gene="dap2"
FT                   /locus_tag="P9211_00771"
FT   CDS_pept        81970..83907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dap2"
FT                   /locus_tag="P9211_00771"
FT                   /product="Esterase/lipase/thioesterase family active site"
FT                   /note="COG1506 Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00771"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08008"
FT                   /db_xref="GOA:A9B9D1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9D1"
FT                   /protein_id="ABX08008.1"
FT                   ESFFREHLGI"
FT   gene            complement(83904..85163)
FT                   /locus_tag="P9211_00781"
FT   CDS_pept        complement(83904..85163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00781"
FT                   /product="putative cysteine desulfurase or selenocysteine
FT                   lyase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG520 Selenocysteine lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00781"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08009"
FT                   /db_xref="GOA:A9B9D2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9D2"
FT                   /protein_id="ABX08009.1"
FT   gene            complement(85165..86391)
FT                   /locus_tag="P9211_00791"
FT   CDS_pept        complement(85165..86391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00791"
FT                   /product="ABC transporter, membrane component"
FT                   /note="COG719 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00791"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08010"
FT                   /db_xref="GOA:A9B9D3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9D3"
FT                   /protein_id="ABX08010.1"
FT                   SFLNEFLSE"
FT   gene            complement(86400..87173)
FT                   /gene="sufC"
FT                   /locus_tag="P9211_00801"
FT   CDS_pept        complement(86400..87173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="P9211_00801"
FT                   /product="ABC transporter, ATP binding component"
FT                   /EC_number=""
FT                   /note="COG396 ABC-type transport system involved in Fe-S
FT                   cluster assembly, ATPase component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00801"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08011"
FT                   /db_xref="GOA:A9B9D4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9D4"
FT                   /protein_id="ABX08011.1"
FT   gene            complement(87245..88693)
FT                   /locus_tag="P9211_00811"
FT   CDS_pept        complement(87245..88693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00811"
FT                   /product="ABC transporter, membrane component"
FT                   /note="COG719 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00811"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08012"
FT                   /db_xref="GOA:A9B9F7"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9F7"
FT                   /protein_id="ABX08012.1"
FT   gene            88793..89158
FT                   /locus_tag="P9211_00821"
FT   CDS_pept        88793..89158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00821"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00821"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08013"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9F8"
FT                   /protein_id="ABX08013.1"
FT                   EITLDQLIAFTISESNH"
FT   gene            89217..89384
FT                   /locus_tag="P9211_00831"
FT   CDS_pept        89217..89384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00831"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00831"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08014"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9F9"
FT                   /protein_id="ABX08014.1"
FT                   HWFIFGNWHL"
FT   gene            89476..90573
FT                   /locus_tag="P9211_00841"
FT   CDS_pept        89476..90573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00841"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG3330 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00841"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08015"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9G0"
FT                   /protein_id="ABX08015.1"
FT   gene            90585..90755
FT                   /locus_tag="P9211_00851"
FT   CDS_pept        90585..90755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00851"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00851"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08016"
FT                   /db_xref="GOA:A9B9G1"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9G1"
FT                   /protein_id="ABX08016.1"
FT                   VAMLRTSEMPH"
FT   gene            90801..92462
FT                   /gene="pgm"
FT                   /locus_tag="P9211_00861"
FT   CDS_pept        90801..92462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="P9211_00861"
FT                   /product="Phosphoglucomutase"
FT                   /EC_number=""
FT                   /note="COG33 Phosphoglucomutase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00861"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08017"
FT                   /db_xref="GOA:A9B9G2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9G2"
FT                   /protein_id="ABX08017.1"
FT   gene            92565..93932
FT                   /gene="mgs1"
FT                   /locus_tag="P9211_00871"
FT   CDS_pept        92565..93932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgs1"
FT                   /locus_tag="P9211_00871"
FT                   /product="putative ATPase, AAA family"
FT                   /EC_number=""
FT                   /note="COG2256 ATPase related to the helicase subunit of
FT                   the Holliday junction resolvase [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00871"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08018"
FT                   /db_xref="GOA:A9B9G3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9G3"
FT                   /protein_id="ABX08018.1"
FT   gene            93991..94467
FT                   /locus_tag="P9211_00881"
FT   CDS_pept        93991..94467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00881"
FT                   /product="putative bacterioferritin comigratory (BCP)
FT                   protein"
FT                   /EC_number=""
FT                   /note="COG1225 Peroxiredoxin [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00881"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08019"
FT                   /db_xref="GOA:A9B9G4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9G4"
FT                   /protein_id="ABX08019.1"
FT   gene            complement(94470..95156)
FT                   /locus_tag="P9211_00891"
FT   CDS_pept        complement(94470..95156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00891"
FT                   /product="Predicted transcriptional regulator"
FT                   /EC_number=""
FT                   /note="COG1521 Putative transcriptional regulator, homolog
FT                   of Bvg accessory factor [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00891"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08020"
FT                   /db_xref="GOA:A9B9G5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9G5"
FT                   /protein_id="ABX08020.1"
FT                   MINLIN"
FT   gene            complement(95153..95920)
FT                   /gene="cysH"
FT                   /locus_tag="P9211_00901"
FT   CDS_pept        complement(95153..95920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="P9211_00901"
FT                   /product="Phosphoadenosine phosphosulfate reductase"
FT                   /EC_number=""
FT                   /note="COG175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase and
FT                   related enzymes [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00901"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08021"
FT                   /db_xref="GOA:A9B9G6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9G6"
FT                   /protein_id="ABX08021.1"
FT   gene            95979..97157
FT                   /locus_tag="P9211_00911"
FT   CDS_pept        95979..97157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00911"
FT                   /product="putative NADH dehydrogenase, transport
FT                   associated"
FT                   /EC_number=""
FT                   /note="COG1252 NADH dehydrogenase, FAD-containing subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00911"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08022"
FT                   /db_xref="GOA:A9B9G7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9G7"
FT                   /protein_id="ABX08022.1"
FT   gene            97251..99080
FT                   /gene="citT"
FT                   /locus_tag="P9211_00921"
FT   CDS_pept        97251..99080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="P9211_00921"
FT                   /product="putative sodium/sulfate transporter, DASS family"
FT                   /note="COG471 Di- and tricarboxylate transporters
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00921"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08023"
FT                   /db_xref="GOA:A9B9G8"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9G8"
FT                   /protein_id="ABX08023.1"
FT   gene            99123..100526
FT                   /gene="trkG"
FT                   /locus_tag="P9211_00931"
FT   CDS_pept        99123..100526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkG"
FT                   /locus_tag="P9211_00931"
FT                   /product="possible sodium transporter, Trk family"
FT                   /note="COG168 Trk-type K+ transport systems, membrane
FT                   components [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00931"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08024"
FT                   /db_xref="GOA:A9B9G9"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9G9"
FT                   /protein_id="ABX08024.1"
FT                   GYPREDLYV"
FT   gene            100551..101255
FT                   /locus_tag="P9211_00941"
FT   CDS_pept        100551..101255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00941"
FT                   /product="putative potassium channel, VIC family"
FT                   /note="COG569 K+ transport systems, NAD-binding component
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00941"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08025"
FT                   /db_xref="GOA:A9B9H0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9H0"
FT                   /protein_id="ABX08025.1"
FT                   GLMEDLQKLPQV"
FT   gene            101266..102405
FT                   /locus_tag="P9211_00951"
FT   CDS_pept        101266..102405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00951"
FT                   /product="Predicted molecular chaperonemetalloprotease"
FT                   /note="distantly related to HSP70-fold; COG2377 Predicted
FT                   molecular chaperone distantly related to HSP70-fold
FT                   metalloproteases [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00951"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08026"
FT                   /db_xref="GOA:A9B9H1"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B9H1"
FT                   /protein_id="ABX08026.1"
FT   gene            complement(102410..102709)
FT                   /locus_tag="P9211_00961"
FT   CDS_pept        complement(102410..102709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00961"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00961"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08027"
FT                   /db_xref="GOA:A9B9H2"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9H2"
FT                   /protein_id="ABX08027.1"
FT   gene            102907..103275
FT                   /locus_tag="P9211_00971"
FT   CDS_pept        102907..103275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00971"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00971"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08028"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9H3"
FT                   /protein_id="ABX08028.1"
FT                   VDGDCKKFSDSNFGSKVA"
FT   gene            103308..103538
FT                   /locus_tag="P9211_00981"
FT   CDS_pept        103308..103538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00981"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00981"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08029"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9H4"
FT                   /protein_id="ABX08029.1"
FT   gene            complement(103541..103705)
FT                   /locus_tag="P9211_00991"
FT   CDS_pept        complement(103541..103705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_00991"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_00991"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08030"
FT                   /db_xref="GOA:A9B9H5"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9H5"
FT                   /protein_id="ABX08030.1"
FT                   EKSSTKNSH"
FT   gene            103790..105517
FT                   /locus_tag="P9211_01001"
FT   CDS_pept        103790..105517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01001"
FT                   /product="ABC transporter, ATP binding component"
FT                   /note="COG488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08031"
FT                   /db_xref="GOA:A9B9H6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9H6"
FT                   /protein_id="ABX08031.1"
FT   gene            complement(105523..106665)
FT                   /locus_tag="P9211_01011"
FT   CDS_pept        complement(105523..106665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01011"
FT                   /product="possible serine protease"
FT                   /note="COG265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08032"
FT                   /db_xref="GOA:A9B9H7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9H7"
FT                   /protein_id="ABX08032.1"
FT   gene            106805..107071
FT                   /locus_tag="P9211_01021"
FT   CDS_pept        106805..107071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08033"
FT                   /db_xref="InterPro:IPR021355"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9H8"
FT                   /protein_id="ABX08033.1"
FT   gene            107131..107514
FT                   /locus_tag="P9211_01031"
FT   CDS_pept        107131..107514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08034"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCU6"
FT                   /protein_id="ABX08034.1"
FT   gene            107601..107747
FT                   /locus_tag="P9211_01041"
FT   CDS_pept        107601..107747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01041"
FT                   /product="possible high light inducible protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08035"
FT                   /db_xref="GOA:A9BCU7"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCU7"
FT                   /protein_id="ABX08035.1"
FT                   GFG"
FT   gene            107786..108934
FT                   /gene="xseA"
FT                   /locus_tag="P9211_01051"
FT   CDS_pept        107786..108934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="P9211_01051"
FT                   /product="Exodeoxyribonuclease VII"
FT                   /EC_number=""
FT                   /note="COG1570 Exonuclease VII, large subunit [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08036"
FT                   /db_xref="GOA:A9BCU8"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCU8"
FT                   /protein_id="ABX08036.1"
FT   gene            108940..109251
FT                   /locus_tag="P9211_01061"
FT   CDS_pept        108940..109251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01061"
FT                   /product="Exodeoxyribonuclease VII"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08037"
FT                   /db_xref="GOA:A9BCU9"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCU9"
FT                   /protein_id="ABX08037.1"
FT   gene            complement(109265..109603)
FT                   /locus_tag="P9211_01071"
FT   CDS_pept        complement(109265..109603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08038"
FT                   /db_xref="GOA:A9BCV0"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCV0"
FT                   /protein_id="ABX08038.1"
FT                   DVSAEEAD"
FT   gene            complement(109605..110546)
FT                   /gene="rbn"
FT                   /locus_tag="P9211_01081"
FT   CDS_pept        complement(109605..110546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="P9211_01081"
FT                   /product="serum resistance locus BrkB-like protein"
FT                   /note="COG1295 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08039"
FT                   /db_xref="GOA:A9BCV1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCV1"
FT                   /protein_id="ABX08039.1"
FT   gene            complement(110641..111483)
FT                   /locus_tag="P9211_01091"
FT   CDS_pept        complement(110641..111483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01091"
FT                   /product="inositol monophosphate family protein"
FT                   /EC_number=""
FT                   /note="COG483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase family
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08040"
FT                   /db_xref="GOA:A9BCV2"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCV2"
FT                   /protein_id="ABX08040.1"
FT   gene            complement(111494..113011)
FT                   /locus_tag="P9211_01101"
FT   CDS_pept        complement(111494..113011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01101"
FT                   /product="possible RND family outer membrane efflux
FT                   protein"
FT                   /note="COG1538 Outer membrane protein [Cell envelope
FT                   biogenesis, outer membrane / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08041"
FT                   /db_xref="GOA:A9BCV3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCV3"
FT                   /protein_id="ABX08041.1"
FT   gene            complement(113034..114428)
FT                   /locus_tag="P9211_01111"
FT   CDS_pept        complement(113034..114428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01111"
FT                   /product="possible Fe-S oxidoreductase"
FT                   /note="COG1625 Fe-S oxidoreductase, related to NifB/MoaA
FT                   family [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08042"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR017673"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCV4"
FT                   /protein_id="ABX08042.1"
FT                   KGKNVT"
FT   gene            114691..115377
FT                   /locus_tag="P9211_01121"
FT   CDS_pept        114691..115377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08043"
FT                   /db_xref="GOA:A9BCV5"
FT                   /db_xref="InterPro:IPR021468"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCV5"
FT                   /protein_id="ABX08043.1"
FT                   KLSGLI"
FT   gene            115396..117084
FT                   /gene="nadB"
FT                   /locus_tag="P9211_01131"
FT   CDS_pept        115396..117084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="P9211_01131"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number=""
FT                   /note="COG29 Aspartate oxidase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08044"
FT                   /db_xref="GOA:A9BCV6"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCV6"
FT                   /protein_id="ABX08044.1"
FT   gene            complement(117071..118021)
FT                   /locus_tag="P9211_01141"
FT   CDS_pept        complement(117071..118021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01141"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4243 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08045"
FT                   /db_xref="GOA:A9BCV7"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCV7"
FT                   /protein_id="ABX08045.1"
FT   gene            117948..118109
FT                   /locus_tag="P9211_01151"
FT   CDS_pept        117948..118109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01151"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08046"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCV8"
FT                   /protein_id="ABX08046.1"
FT                   ILFCLELS"
FT   gene            118109..119497
FT                   /locus_tag="P9211_01161"
FT   CDS_pept        118109..119497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01161"
FT                   /product="possible Fe-S oxidoreductase"
FT                   /note="COG621 2-methylthioadenine synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08047"
FT                   /db_xref="GOA:A9BCV9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BCV9"
FT                   /protein_id="ABX08047.1"
FT                   NHLN"
FT   gene            complement(119660..120064)
FT                   /locus_tag="P9211_01171"
FT   CDS_pept        complement(119660..120064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08048"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCW0"
FT                   /protein_id="ABX08048.1"
FT   gene            120276..120482
FT                   /locus_tag="P9211_01181"
FT   CDS_pept        120276..120482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01181"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08049"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCW1"
FT                   /protein_id="ABX08049.1"
FT   gene            complement(120631..120849)
FT                   /locus_tag="P9211_01191"
FT   CDS_pept        complement(120631..120849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01191"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08050"
FT                   /db_xref="GOA:A9BCW2"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCW2"
FT                   /protein_id="ABX08050.1"
FT   gene            complement(120876..122048)
FT                   /locus_tag="P9211_01201"
FT   CDS_pept        complement(120876..122048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01201"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG3146 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08051"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCW3"
FT                   /protein_id="ABX08051.1"
FT   gene            complement(122061..122714)
FT                   /locus_tag="P9211_01211"
FT   CDS_pept        complement(122061..122714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01211"
FT                   /product="RibD/ribG C-terminal domain"
FT                   /EC_number=""
FT                   /note="COG1985 Pyrimidine reductase, riboflavin
FT                   biosynthesis [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08052"
FT                   /db_xref="GOA:A9BCW4"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCW4"
FT                   /protein_id="ABX08052.1"
FT   gene            complement(122764..123654)
FT                   /locus_tag="P9211_01221"
FT   CDS_pept        complement(122764..123654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01221"
FT                   /product="6-pyruvoyl tetrahydropterin synthase"
FT                   /EC_number=""
FT                   /note="COG720 6-pyruvoyl-tetrahydropterin synthase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08053"
FT                   /db_xref="GOA:A9BCW5"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCW5"
FT                   /protein_id="ABX08053.1"
FT                   NAAEIYPNDSSCQNI"
FT   gene            123707..124300
FT                   /gene="aroK"
FT                   /locus_tag="P9211_01231"
FT   CDS_pept        123707..124300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="P9211_01231"
FT                   /product="Shikimate kinase"
FT                   /EC_number=""
FT                   /note="COG703 Shikimate kinase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08054"
FT                   /db_xref="GOA:A9BCW6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BCW6"
FT                   /protein_id="ABX08054.1"
FT   gene            complement(124257..124517)
FT                   /locus_tag="P9211_01241"
FT   CDS_pept        complement(124257..124517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08055"
FT                   /db_xref="InterPro:IPR021954"
FT                   /db_xref="InterPro:IPR038150"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCW7"
FT                   /protein_id="ABX08055.1"
FT   gene            complement(124556..125281)
FT                   /locus_tag="P9211_01251"
FT   CDS_pept        complement(124556..125281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01251"
FT                   /product="putative glutathione S-transferase"
FT                   /EC_number=""
FT                   /note="COG625 Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08056"
FT                   /db_xref="GOA:A9BCW8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCW8"
FT                   /protein_id="ABX08056.1"
FT   gene            125341..125547
FT                   /locus_tag="P9211_01261"
FT   CDS_pept        125341..125547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08057"
FT                   /db_xref="GOA:A9BCW9"
FT                   /db_xref="InterPro:IPR008470"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCW9"
FT                   /protein_id="ABX08057.1"
FT   gene            125550..125942
FT                   /gene="rbfA"
FT                   /locus_tag="P9211_01271"
FT   CDS_pept        125550..125942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="P9211_01271"
FT                   /product="Ribosome-binding factor A"
FT                   /note="COG858 Ribosome-binding factor A [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08058"
FT                   /db_xref="GOA:A9BCX0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BCX0"
FT                   /protein_id="ABX08058.1"
FT   gene            125945..127576
FT                   /locus_tag="P9211_01281"
FT   CDS_pept        125945..127576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01281"
FT                   /product="Beta-glucosidase-related glycosidase"
FT                   /EC_number=""
FT                   /note="COG1472 Beta-glucosidase-related glycosidases
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08059"
FT                   /db_xref="GOA:A9BCX1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR041518"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCX1"
FT                   /protein_id="ABX08059.1"
FT   gene            127558..128406
FT                   /gene="hemD"
FT                   /locus_tag="P9211_01291"
FT   CDS_pept        127558..128406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="P9211_01291"
FT                   /product="putative uroporphyrinogen III synthase"
FT                   /EC_number=""
FT                   /note="COG1587 Uroporphyrinogen-III synthase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08060"
FT                   /db_xref="GOA:A9BCX2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCX2"
FT                   /protein_id="ABX08060.1"
FT                   N"
FT   gene            complement(128403..128876)
FT                   /locus_tag="P9211_01301"
FT   CDS_pept        complement(128403..128876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01301"
FT                   /product="Predicted integral membrane protein"
FT                   /note="COG5637 Predicted integral membrane protein
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08061"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCX3"
FT                   /protein_id="ABX08061.1"
FT   gene            complement(128901..130337)
FT                   /gene="crtQ"
FT                   /locus_tag="P9211_01311"
FT   CDS_pept        complement(128901..130337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtQ"
FT                   /locus_tag="P9211_01311"
FT                   /product="zeta-carotene desaturase"
FT                   /EC_number=""
FT                   /note="COG3349 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08062"
FT                   /db_xref="GOA:A9BCX4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014103"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCX4"
FT                   /protein_id="ABX08062.1"
FT   gene            130447..130839
FT                   /locus_tag="P9211_01321"
FT   CDS_pept        130447..130839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01321"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG316 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08063"
FT                   /db_xref="GOA:A9BCX5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCX5"
FT                   /protein_id="ABX08063.1"
FT   gene            130880..131299
FT                   /locus_tag="P9211_01331"
FT   CDS_pept        130880..131299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08064"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCX6"
FT                   /protein_id="ABX08064.1"
FT   gene            131301..132524
FT                   /locus_tag="P9211_01341"
FT   CDS_pept        131301..132524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01341"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG4370 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08065"
FT                   /db_xref="InterPro:IPR019994"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCX7"
FT                   /protein_id="ABX08065.1"
FT                   CLLINNYV"
FT   gene            complement(132544..133476)
FT                   /locus_tag="P9211_01351"
FT   CDS_pept        complement(132544..133476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01351"
FT                   /product="putative cell division inhibitor"
FT                   /EC_number=""
FT                   /note="COG1090 Predicted nucleoside-diphosphate sugar
FT                   epimerase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08066"
FT                   /db_xref="GOA:A9BCX8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCX8"
FT                   /protein_id="ABX08066.1"
FT   gene            133558..133806
FT                   /locus_tag="P9211_01361"
FT   CDS_pept        133558..133806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08067"
FT                   /db_xref="GOA:A9BCX9"
FT                   /db_xref="InterPro:IPR020905"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BCX9"
FT                   /protein_id="ABX08067.1"
FT   gene            complement(133823..134521)
FT                   /locus_tag="P9211_01371"
FT   CDS_pept        complement(133823..134521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01371"
FT                   /product="possible heat shock protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08068"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCY0"
FT                   /protein_id="ABX08068.1"
FT                   RKEKQHLTIA"
FT   gene            complement(134548..135516)
FT                   /locus_tag="P9211_01381"
FT   CDS_pept        complement(134548..135516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01381"
FT                   /product="O-acetylserine (thiol)-lyase A"
FT                   /EC_number=""
FT                   /note="COG31 Cysteine synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08069"
FT                   /db_xref="GOA:A9BCY1"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCY1"
FT                   /protein_id="ABX08069.1"
FT   gene            135624..135887
FT                   /locus_tag="P9211_01391"
FT   CDS_pept        135624..135887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01391"
FT                   /product="conserved hypothetical protein in cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08070"
FT                   /db_xref="InterPro:IPR020885"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BCY2"
FT                   /protein_id="ABX08070.1"
FT   gene            135880..136587
FT                   /locus_tag="P9211_01401"
FT   CDS_pept        135880..136587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01401"
FT                   /product="possible ABC transporter, ATP-binding component"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08071"
FT                   /db_xref="GOA:A9BCY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCY3"
FT                   /protein_id="ABX08071.1"
FT                   NWQPGHELMNNLK"
FT   gene            136631..136702
FT                   /locus_tag="P9211_tRNAAsnVIMSS1309370"
FT                   /note="tRNA-Asn"
FT   tRNA            136631..136702
FT                   /locus_tag="P9211_tRNAAsnVIMSS1309370"
FT                   /product="tRNA-Asn"
FT   gene            137064..137744
FT                   /locus_tag="P9211_01411"
FT   CDS_pept        137064..137744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01411"
FT                   /product="Carbonic anhydrase/acetyltransferase, isoleucine
FT                   patch superfamily"
FT                   /note="COG663 Carbonic anhydrases/acetyltransferases,
FT                   isoleucine patch superfamily [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08072"
FT                   /db_xref="GOA:A9BCY4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCY4"
FT                   /protein_id="ABX08072.1"
FT                   EQYL"
FT   gene            138136..138912
FT                   /gene="rpaA"
FT                   /locus_tag="P9211_01421"
FT   CDS_pept        138136..138912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpaA"
FT                   /locus_tag="P9211_01421"
FT                   /product="two-component response regulator"
FT                   /EC_number=""
FT                   /note="COG745 Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08073"
FT                   /db_xref="GOA:A9BCY5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCY5"
FT                   /protein_id="ABX08073.1"
FT   gene            complement(138930..139907)
FT                   /gene="holB"
FT                   /locus_tag="P9211_01431"
FT   CDS_pept        complement(138930..139907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="P9211_01431"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08074"
FT                   /db_xref="GOA:A9BCY6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCY6"
FT                   /protein_id="ABX08074.1"
FT   gene            complement(139907..140554)
FT                   /gene="tmk"
FT                   /locus_tag="P9211_01441"
FT   CDS_pept        complement(139907..140554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="P9211_01441"
FT                   /product="Thymidylate kinase"
FT                   /EC_number=""
FT                   /note="COG125 Thymidylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08075"
FT                   /db_xref="GOA:A9BCY7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BCY7"
FT                   /protein_id="ABX08075.1"
FT   gene            complement(140551..142875)
FT                   /gene="zntA"
FT                   /locus_tag="P9211_01451"
FT   CDS_pept        complement(140551..142875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntA"
FT                   /locus_tag="P9211_01451"
FT                   /product="putative P-type ATPase transporter for copper"
FT                   /EC_number=""
FT                   /note="COG2217 Cation transport ATPase [Inorganic ion
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08076"
FT                   /db_xref="GOA:A9BCY8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCY8"
FT                   /protein_id="ABX08076.1"
FT   gene            143012..143533
FT                   /locus_tag="P9211_01461"
FT   CDS_pept        143012..143533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01461"
FT                   /product="cyanobacterial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08077"
FT                   /db_xref="GOA:A9BCY9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022818"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BCY9"
FT                   /protein_id="ABX08077.1"
FT                   TGRSKIDVYL"
FT   gene            complement(143554..144939)
FT                   /gene="sms"
FT                   /locus_tag="P9211_01471"
FT   CDS_pept        complement(143554..144939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sms"
FT                   /locus_tag="P9211_01471"
FT                   /product="putative DNA repair protein RadA"
FT                   /note="COG1066 Predicted ATP-dependent serine protease
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08078"
FT                   /db_xref="GOA:A9BCZ0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCZ0"
FT                   /protein_id="ABX08078.1"
FT                   KSQ"
FT   gene            145051..145797
FT                   /locus_tag="P9211_01481"
FT   CDS_pept        145051..145797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01481"
FT                   /product="two-component response regulator"
FT                   /EC_number=""
FT                   /note="COG745 Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08079"
FT                   /db_xref="GOA:A9BCZ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCZ1"
FT                   /protein_id="ABX08079.1"
FT   gene            145805..147127
FT                   /gene="plsX"
FT                   /locus_tag="P9211_01491"
FT   CDS_pept        145805..147127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="P9211_01491"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /EC_number=""
FT                   /note="COG416 Fatty acid/phospholipid biosynthesis enzyme
FT                   [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08080"
FT                   /db_xref="GOA:A9BCZ2"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCZ2"
FT                   /protein_id="ABX08080.1"
FT   gene            147270..148202
FT                   /gene="fabH"
FT                   /locus_tag="P9211_01501"
FT   CDS_pept        147270..148202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="P9211_01501"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG332 3-oxoacyl-[acyl-carrier-protein]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08081"
FT                   /db_xref="GOA:A9BCZ3"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCZ3"
FT                   /protein_id="ABX08081.1"
FT   gene            148230..149132
FT                   /gene="fabD"
FT                   /locus_tag="P9211_01511"
FT   CDS_pept        148230..149132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="P9211_01511"
FT                   /product="Malonyl coenzyme A-acyl carrier protein
FT                   transacylase"
FT                   /EC_number=""
FT                   /note="COG331 (acyl-carrier-protein) S-malonyltransferase
FT                   [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08082"
FT                   /db_xref="GOA:A9BCZ4"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCZ4"
FT                   /protein_id="ABX08082.1"
FT   gene            149129..149806
FT                   /locus_tag="P9211_01521"
FT   CDS_pept        149129..149806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01521"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /EC_number=""
FT                   /note="COG204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08083"
FT                   /db_xref="GOA:A9BCZ5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCZ5"
FT                   /protein_id="ABX08083.1"
FT                   PKS"
FT   gene            complement(149817..150401)
FT                   /locus_tag="P9211_01531"
FT   CDS_pept        complement(149817..150401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01531"
FT                   /product="Hypothetical protein"
FT                   /note="COG1434 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08084"
FT                   /db_xref="GOA:A9BCZ6"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCZ6"
FT                   /protein_id="ABX08084.1"
FT   gene            complement(150404..151045)
FT                   /locus_tag="P9211_01541"
FT   CDS_pept        complement(150404..151045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01541"
FT                   /product="Inactive metal-dependent protease-like protein,
FT                   putative molecular chaperone"
FT                   /note="COG1214 Inactive homolog of metal-dependent
FT                   proteases, putative molecular chaperone [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08085"
FT                   /db_xref="GOA:A9BCZ7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCZ7"
FT                   /protein_id="ABX08085.1"
FT   gene            complement(151053..151304)
FT                   /gene="ycf34"
FT                   /locus_tag="P9211_01551"
FT   CDS_pept        complement(151053..151304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf34"
FT                   /locus_tag="P9211_01551"
FT                   /product="putative Ycf34"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08086"
FT                   /db_xref="InterPro:IPR019656"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCZ8"
FT                   /protein_id="ABX08086.1"
FT   gene            151351..152544
FT                   /locus_tag="P9211_01561"
FT   CDS_pept        151351..152544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01561"
FT                   /product="Poly A polymerase family"
FT                   /EC_number=""
FT                   /note="COG617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08087"
FT                   /db_xref="GOA:A9BCZ9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A9BCZ9"
FT                   /protein_id="ABX08087.1"
FT   gene            152606..153040
FT                   /locus_tag="P9211_01571"
FT   CDS_pept        152606..153040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01571"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08088"
FT                   /db_xref="GOA:A9BD00"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD00"
FT                   /protein_id="ABX08088.1"
FT   gene            complement(153081..154022)
FT                   /gene="crtB/pys"
FT                   /locus_tag="P9211_01581"
FT   CDS_pept        complement(153081..154022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtB/pys"
FT                   /locus_tag="P9211_01581"
FT                   /product="Squalene and phytoene synthase"
FT                   /EC_number=""
FT                   /note="COG1562 Phytoene/squalene synthetase [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08089"
FT                   /db_xref="GOA:A9BD01"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD01"
FT                   /protein_id="ABX08089.1"
FT   gene            complement(154022..155440)
FT                   /gene="pds"
FT                   /locus_tag="P9211_01591"
FT   CDS_pept        complement(154022..155440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pds"
FT                   /locus_tag="P9211_01591"
FT                   /product="phytoene desaturase"
FT                   /EC_number=""
FT                   /note="COG3349 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08090"
FT                   /db_xref="GOA:A9BD02"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014102"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD02"
FT                   /protein_id="ABX08090.1"
FT                   SLKINDNEISLGSS"
FT   gene            155546..155893
FT                   /locus_tag="P9211_01601"
FT   CDS_pept        155546..155893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01601"
FT                   /product="NADH dehydrogenase I subunit M"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01601"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08091"
FT                   /db_xref="GOA:A9BD03"
FT                   /db_xref="InterPro:IPR018922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BD03"
FT                   /protein_id="ABX08091.1"
FT                   SMGLPRTKDLL"
FT   gene            155890..156531
FT                   /locus_tag="P9211_01611"
FT   CDS_pept        155890..156531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01611"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08092"
FT                   /db_xref="InterPro:IPR021511"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD04"
FT                   /protein_id="ABX08092.1"
FT   gene            complement(156536..157504)
FT                   /gene="rbcR"
FT                   /locus_tag="P9211_01621"
FT   CDS_pept        complement(156536..157504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcR"
FT                   /locus_tag="P9211_01621"
FT                   /product="putative Rubisco transcriptional regulator"
FT                   /note="COG583 Transcriptional regulator [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01621"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08093"
FT                   /db_xref="GOA:A9BD05"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD05"
FT                   /protein_id="ABX08093.1"
FT   gene            157598..158335
FT                   /locus_tag="P9211_01631"
FT   CDS_pept        157598..158335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01631"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4094 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01631"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08094"
FT                   /db_xref="GOA:A9BD06"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD06"
FT                   /protein_id="ABX08094.1"
FT   gene            158370..160373
FT                   /gene="ndhF"
FT                   /locus_tag="P9211_01641"
FT   CDS_pept        158370..160373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /locus_tag="P9211_01641"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 5)"
FT                   /EC_number=""
FT                   /note="COG1009 NADH:ubiquinone oxidoreductase subunit 5
FT                   (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit
FT                   [Energy production and conversion / Inorganic ion transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01641"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08095"
FT                   /db_xref="GOA:A9BD07"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD07"
FT                   /protein_id="ABX08095.1"
FT   gene            160472..162148
FT                   /locus_tag="P9211_01651"
FT   CDS_pept        160472..162148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01651"
FT                   /product="putative NADH dehydrogenase subunit (chain 4)"
FT                   /EC_number=""
FT                   /note="COG1008 NADH:ubiquinone oxidoreductase subunit 4
FT                   (chain M) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01651"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08096"
FT                   /db_xref="GOA:A9BD08"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BD08"
FT                   /protein_id="ABX08096.1"
FT   gene            162233..162601
FT                   /locus_tag="P9211_01661"
FT   CDS_pept        162233..162601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01661"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01661"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08097"
FT                   /db_xref="GOA:A9BD09"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD09"
FT                   /protein_id="ABX08097.1"
FT                   PFMSFSGEKELEIDKDAA"
FT   gene            162676..163566
FT                   /locus_tag="P9211_01671"
FT   CDS_pept        162676..163566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01671"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG1354 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01671"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08098"
FT                   /db_xref="GOA:A9BD10"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD10"
FT                   /protein_id="ABX08098.1"
FT                   PLKTFDVTAVAPAAA"
FT   gene            163624..164802
FT                   /locus_tag="P9211_01681"
FT   CDS_pept        163624..164802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01681"
FT                   /product="Putative sugar-phosphate nucleotidyl transferase"
FT                   /EC_number=""
FT                   /note="COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B,
FT                   gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell
FT                   envelope biogenesis, outer membrane / Translation,
FT                   ribosomal structure an"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01681"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08099"
FT                   /db_xref="GOA:A9BD11"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037538"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD11"
FT                   /protein_id="ABX08099.1"
FT   gene            complement(164783..165712)
FT                   /gene="metF"
FT                   /locus_tag="P9211_01691"
FT   CDS_pept        complement(164783..165712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="P9211_01691"
FT                   /product="Methylenetetrahydrofolate reductase"
FT                   /EC_number=""
FT                   /note="COG685 5,10-methylenetetrahydrofolate reductase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01691"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08100"
FT                   /db_xref="GOA:A9BD12"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD12"
FT                   /protein_id="ABX08100.1"
FT   gene            165760..166032
FT                   /gene="csgD"
FT                   /locus_tag="P9211_01701"
FT   CDS_pept        165760..166032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgD"
FT                   /locus_tag="P9211_01701"
FT                   /product="Bacterial regulatory protein, LuxR family"
FT                   /note="COG2771 DNA-binding HTH domain-containing proteins
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01701"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08101"
FT                   /db_xref="GOA:A9BD13"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD13"
FT                   /protein_id="ABX08101.1"
FT   gene            complement(165995..166192)
FT                   /locus_tag="P9211_01711"
FT   CDS_pept        complement(165995..166192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01711"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01711"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08102"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD14"
FT                   /protein_id="ABX08102.1"
FT   gene            complement(166281..166781)
FT                   /locus_tag="P9211_01721"
FT   CDS_pept        complement(166281..166781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01721"
FT                   /product="adenylate cyclase"
FT                   /EC_number=""
FT                   /note="COG2954 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01721"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08103"
FT                   /db_xref="GOA:A9BD15"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD15"
FT                   /protein_id="ABX08103.1"
FT                   ADL"
FT   gene            complement(166793..167704)
FT                   /locus_tag="P9211_01731"
FT   CDS_pept        complement(166793..167704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01731"
FT                   /product="predicted inorganic polyphosphate / ATP-NAD+
FT                   kinase"
FT                   /EC_number=""
FT                   /note="COG61 Predicted sugar kinase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01731"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08104"
FT                   /db_xref="GOA:A9BD16"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD16"
FT                   /protein_id="ABX08104.1"
FT   gene            complement(167717..168040)
FT                   /gene="ndhE"
FT                   /locus_tag="P9211_01741"
FT   CDS_pept        complement(167717..168040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhE"
FT                   /locus_tag="P9211_01741"
FT                   /product="putative NADH Dehydrogenase subunit"
FT                   /EC_number=""
FT                   /note="COG713 NADH:ubiquinone oxidoreductase subunit 11 or
FT                   4L (chain K) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01741"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08105"
FT                   /db_xref="GOA:A9BD17"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD17"
FT                   /protein_id="ABX08105.1"
FT                   LKW"
FT   gene            complement(168041..168643)
FT                   /gene="ndhG"
FT                   /locus_tag="P9211_01751"
FT   CDS_pept        complement(168041..168643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhG"
FT                   /locus_tag="P9211_01751"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 6)"
FT                   /EC_number=""
FT                   /note="COG839 NADH:ubiquinone oxidoreductase subunit 6
FT                   (chain J) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01751"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08106"
FT                   /db_xref="GOA:A9BD18"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD18"
FT                   /protein_id="ABX08106.1"
FT   gene            complement(168643..169290)
FT                   /gene="ndhI"
FT                   /locus_tag="P9211_01761"
FT   CDS_pept        complement(168643..169290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhI"
FT                   /locus_tag="P9211_01761"
FT                   /product="putative NADH Dehydrogenase subunit"
FT                   /EC_number=""
FT                   /note="COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01761"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08107"
FT                   /db_xref="GOA:A9BD19"
FT                   /db_xref="InterPro:IPR004497"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BD19"
FT                   /protein_id="ABX08107.1"
FT   gene            complement(169385..170539)
FT                   /gene="ndhA"
FT                   /locus_tag="P9211_01771"
FT   CDS_pept        complement(169385..170539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhA"
FT                   /locus_tag="P9211_01771"
FT                   /product="putative respiratory-chain NADH dehydrogenase
FT                   subunit"
FT                   /EC_number=""
FT                   /note="COG1005 NADH:ubiquinone oxidoreductase subunit 1
FT                   (chain H) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01771"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08108"
FT                   /db_xref="GOA:A9BD20"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD20"
FT                   /protein_id="ABX08108.1"
FT   gene            complement(170573..171709)
FT                   /gene="gltA"
FT                   /locus_tag="P9211_01781"
FT   CDS_pept        complement(170573..171709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="P9211_01781"
FT                   /product="Citrate synthase"
FT                   /EC_number=""
FT                   /note="COG372 Citrate synthase [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01781"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08109"
FT                   /db_xref="GOA:A9BD21"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD21"
FT                   /protein_id="ABX08109.1"
FT   gene            complement(172009..173613)
FT                   /locus_tag="P9211_01791"
FT   CDS_pept        complement(172009..173613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01791"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01791"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08110"
FT                   /db_xref="InterPro:IPR021787"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD22"
FT                   /protein_id="ABX08110.1"
FT                   KDDIEQTINFHAKLLLG"
FT   gene            173688..174041
FT                   /gene="pspE"
FT                   /locus_tag="P9211_01801"
FT   CDS_pept        173688..174041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspE"
FT                   /locus_tag="P9211_01801"
FT                   /product="Rhodanese-like protein"
FT                   /EC_number=""
FT                   /note="COG607 Rhodanese-related sulfurtransferase
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01801"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08111"
FT                   /db_xref="GOA:A9BD23"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD23"
FT                   /protein_id="ABX08111.1"
FT                   SWSLDVDPSVPRY"
FT   gene            complement(174061..175311)
FT                   /gene="trpB"
FT                   /locus_tag="P9211_01811"
FT   CDS_pept        complement(174061..175311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="P9211_01811"
FT                   /product="Tryptophan synthase subunit beta"
FT                   /EC_number=""
FT                   /note="COG133 Tryptophan synthase beta chain [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01811"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08112"
FT                   /db_xref="GOA:A9BD24"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BD24"
FT                   /protein_id="ABX08112.1"
FT                   RGDKDVNTVAKKMGFEI"
FT   gene            175356..175682
FT                   /gene="sui1"
FT                   /locus_tag="P9211_01821"
FT   CDS_pept        175356..175682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sui1"
FT                   /locus_tag="P9211_01821"
FT                   /product="Translation initiation factor SUI1"
FT                   /note="COG23 Translation initiation factor 1 (eIF-1/SUI1)
FT                   and related proteins [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01821"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08113"
FT                   /db_xref="GOA:A9BD25"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD25"
FT                   /protein_id="ABX08113.1"
FT                   KSGS"
FT   gene            175719..176372
FT                   /gene="cysC"
FT                   /locus_tag="P9211_01831"
FT   CDS_pept        175719..176372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="P9211_01831"
FT                   /product="Adenylylsulfate kinase"
FT                   /EC_number=""
FT                   /note="COG529 Adenylylsulfate kinase and related kinases
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01831"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08114"
FT                   /db_xref="GOA:A9BD26"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD26"
FT                   /protein_id="ABX08114.1"
FT   gene            complement(176396..176953)
FT                   /gene="purE"
FT                   /locus_tag="P9211_01841"
FT   CDS_pept        complement(176396..176953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="P9211_01841"
FT                   /product="Phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number=""
FT                   /note="COG41 Phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01841"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08115"
FT                   /db_xref="GOA:A9BD27"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD27"
FT                   /protein_id="ABX08115.1"
FT   gene            177014..178165
FT                   /gene="nagA"
FT                   /locus_tag="P9211_01851"
FT   CDS_pept        177014..178165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="P9211_01851"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number=""
FT                   /note="COG1820 N-acetylglucosamine-6-phosphate deacetylase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01851"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08116"
FT                   /db_xref="GOA:A9BD28"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD28"
FT                   /protein_id="ABX08116.1"
FT   gene            178193..178906
FT                   /gene="chlM"
FT                   /locus_tag="P9211_01861"
FT   CDS_pept        178193..178906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlM"
FT                   /locus_tag="P9211_01861"
FT                   /product="Mg-protoporphyrin IX methyltransferase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG2227
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol
FT                   methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01861"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08117"
FT                   /db_xref="GOA:A9BD29"
FT                   /db_xref="InterPro:IPR010251"
FT                   /db_xref="InterPro:IPR010940"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD29"
FT                   /protein_id="ABX08117.1"
FT                   QAPFYFSQLIEFRKN"
FT   gene            complement(178969..179697)
FT                   /locus_tag="P9211_01871"
FT   CDS_pept        complement(178969..179697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01871"
FT                   /product="two-component response regulator"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain [Signal
FT                   transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01871"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08118"
FT                   /db_xref="GOA:A9BD30"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD30"
FT                   /protein_id="ABX08118.1"
FT   gene            179772..180944
FT                   /locus_tag="P9211_01881"
FT   CDS_pept        179772..180944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01881"
FT                   /product="NifS-like aminotransferase class-V"
FT                   /EC_number=""
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01881"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08119"
FT                   /db_xref="GOA:A9BD31"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD31"
FT                   /protein_id="ABX08119.1"
FT   gene            complement(180948..181865)
FT                   /locus_tag="P9211_01891"
FT   CDS_pept        complement(180948..181865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01891"
FT                   /product="Predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="COG275 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis
FT                   [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01891"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08120"
FT                   /db_xref="GOA:A9BD32"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BD32"
FT                   /protein_id="ABX08120.1"
FT   gene            181911..183095
FT                   /gene="ndhH"
FT                   /locus_tag="P9211_01901"
FT   CDS_pept        181911..183095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhH"
FT                   /locus_tag="P9211_01901"
FT                   /product="putative NADH dehydrogenase subunit"
FT                   /EC_number=""
FT                   /note="COG649 NADH:ubiquinone oxidoreductase 49 kD subunit
FT                   7 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01901"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08121"
FT                   /db_xref="GOA:A9BD33"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BD33"
FT                   /protein_id="ABX08121.1"
FT   gene            183097..183552
FT                   /locus_tag="P9211_01911"
FT   CDS_pept        183097..183552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01911"
FT                   /product="Predicted thioesterase"
FT                   /note="COG824 Predicted thioesterase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01911"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08122"
FT                   /db_xref="GOA:A9BD34"
FT                   /db_xref="InterPro:IPR022829"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BD34"
FT                   /protein_id="ABX08122.1"
FT   gene            complement(183589..184833)
FT                   /gene="menE"
FT                   /locus_tag="P9211_01921"
FT   CDS_pept        complement(183589..184833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="P9211_01921"
FT                   /product="probable O-succinylbenzoic acid--CoA ligase
FT                   (OSB-CoA synthetase)"
FT                   /EC_number=""
FT                   /note="COG318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II [Lipid metabolism / Secondary metabolites
FT                   biosynthesis, transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01921"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08123"
FT                   /db_xref="GOA:A9BD35"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD35"
FT                   /protein_id="ABX08123.1"
FT                   FAKWQTWLKGRETGI"
FT   gene            complement(184830..185798)
FT                   /gene="menC"
FT                   /locus_tag="P9211_01931"
FT   CDS_pept        complement(184830..185798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="P9211_01931"
FT                   /product="putative O-succinylbenzoate synthase"
FT                   /EC_number=""
FT                   /note="COG4948 L-alanine-DL-glutamate epimerase and related
FT                   enzymes of enolase superfamily [Cell envelope biogenesis,
FT                   outer membrane / General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01931"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08124"
FT                   /db_xref="GOA:A9BD36"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD36"
FT                   /protein_id="ABX08124.1"
FT   gene            complement(185804..186775)
FT                   /gene="menA"
FT                   /locus_tag="P9211_01941"
FT   CDS_pept        complement(185804..186775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="P9211_01941"
FT                   /product="1,4-dihydroxy-2-naphthoate (DHNA)
FT                   octaprenyltransferase; UbiA prenyltranferase family"
FT                   /note="COG1575 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01941"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08125"
FT                   /db_xref="GOA:A9BD37"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR011937"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD37"
FT                   /protein_id="ABX08125.1"
FT   gene            186855..188252
FT                   /gene="menF"
FT                   /locus_tag="P9211_01951"
FT   CDS_pept        186855..188252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="P9211_01951"
FT                   /product="Isochorismate synthase"
FT                   /EC_number=""
FT                   /note="COG1169 Isochorismate synthase [Coenzyme metabolism
FT                   / Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01951"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08126"
FT                   /db_xref="GOA:A9BD38"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD38"
FT                   /protein_id="ABX08126.1"
FT                   SLTKLVK"
FT   gene            complement(188232..189158)
FT                   /gene="gshB"
FT                   /locus_tag="P9211_01961"
FT   CDS_pept        complement(188232..189158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="P9211_01961"
FT                   /product="putative Glutathione synthetase"
FT                   /EC_number=""
FT                   /note="COG189 Glutathione synthase/Ribosomal protein S6
FT                   modification enzyme (glutaminyl transferase) [Coenzyme
FT                   metabolism / Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01961"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08127"
FT                   /db_xref="GOA:A9BD39"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD39"
FT                   /protein_id="ABX08127.1"
FT   gene            complement(189172..189426)
FT                   /gene="grxC"
FT                   /locus_tag="P9211_01971"
FT   CDS_pept        complement(189172..189426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="P9211_01971"
FT                   /product="Glutaredoxin"
FT                   /EC_number=""
FT                   /note="COG695 Glutaredoxin and related proteins
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01971"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08128"
FT                   /db_xref="GOA:A9BD40"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD40"
FT                   /protein_id="ABX08128.1"
FT   gene            189565..190635
FT                   /gene="prfB"
FT                   /locus_tag="P9211_01981"
FT   CDS_pept        189565..190635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="P9211_01981"
FT                   /product="peptide chain release factor RF-2"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1186 Protein chain release factor B [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01981"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08129"
FT                   /db_xref="GOA:A9BD41"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD41"
FT                   /protein_id="ABX08129.1"
FT                   ALLLKGIDNKQNDHEN"
FT   gene            190639..190830
FT                   /locus_tag="P9211_01991"
FT   CDS_pept        190639..190830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_01991"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_01991"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08130"
FT                   /db_xref="GOA:A9BD42"
FT                   /db_xref="InterPro:IPR021702"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD42"
FT                   /protein_id="ABX08130.1"
FT                   FIGFILVIAALGRPNLPQ"
FT   gene            190839..191408
FT                   /locus_tag="P9211_02001"
FT   CDS_pept        190839..191408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02001"
FT                   /product="Predicted metal-dependent hydrolase"
FT                   /note="COG319 Predicted metal-dependent hydrolase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08131"
FT                   /db_xref="GOA:A9BD43"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BD43"
FT                   /protein_id="ABX08131.1"
FT   gene            191405..191866
FT                   /gene="dgkA"
FT                   /locus_tag="P9211_02011"
FT   CDS_pept        191405..191866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="P9211_02011"
FT                   /product="Prokaryotic diacylglycerol kinase"
FT                   /EC_number=""
FT                   /note="COG818 Diacylglycerol kinase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08132"
FT                   /db_xref="GOA:A9BD44"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A9BD44"
FT                   /protein_id="ABX08132.1"
FT   gene            191877..192482
FT                   /gene="pabA"
FT                   /locus_tag="P9211_02021"
FT   CDS_pept        191877..192482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="P9211_02021"
FT                   /product="para-aminobenzoate synthase component II"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG512 Anthranilate/para-aminobenzoate synthases
FT                   component II [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08133"
FT                   /db_xref="GOA:A9BDE7"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDE7"
FT                   /protein_id="ABX08133.1"
FT   gene            192479..193219
FT                   /locus_tag="P9211_02031"
FT   CDS_pept        192479..193219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02031"
FT                   /product="Predicted Zn-dependent hydrolase of the
FT                   beta-lactamase fold"
FT                   /note="COG2220 Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08134"
FT                   /db_xref="GOA:A9BDE8"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDE8"
FT                   /protein_id="ABX08134.1"
FT   gene            complement(193203..194333)
FT                   /locus_tag="P9211_02041"
FT   CDS_pept        complement(193203..194333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02041"
FT                   /product="Aminotransferase class-I"
FT                   /EC_number=""
FT                   /note="COG79 Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08135"
FT                   /db_xref="GOA:A9BDE9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDE9"
FT                   /protein_id="ABX08135.1"
FT   gene            complement(194333..196144)
FT                   /gene="argS"
FT                   /locus_tag="P9211_02051"
FT   CDS_pept        complement(194333..196144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="P9211_02051"
FT                   /product="Arginyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG18 Arginyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08136"
FT                   /db_xref="GOA:A9BDF0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDF0"
FT                   /protein_id="ABX08136.1"
FT   gene            complement(196144..197025)
FT                   /gene="nadC"
FT                   /locus_tag="P9211_02061"
FT   CDS_pept        complement(196144..197025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="P9211_02061"
FT                   /product="Nicotinate-nucleotide
FT                   pyrophosphorylase:Quinolinate phosphoriobsyl transferase"
FT                   /EC_number=""
FT                   /note="COG157 Nicotinate-nucleotide pyrophosphorylase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08137"
FT                   /db_xref="GOA:A9BDF1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDF1"
FT                   /protein_id="ABX08137.1"
FT                   FSMRFNIDDTCK"
FT   gene            complement(197029..198396)
FT                   /gene="thdF"
FT                   /locus_tag="P9211_02071"
FT   CDS_pept        complement(197029..198396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thdF"
FT                   /locus_tag="P9211_02071"
FT                   /product="putative thiophen / furan oxidation protein"
FT                   /note="COG486 Predicted GTPase [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08138"
FT                   /db_xref="GOA:A9BDF2"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDF2"
FT                   /protein_id="ABX08138.1"
FT   gene            198466..198915
FT                   /locus_tag="P9211_02081"
FT   CDS_pept        198466..198915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02081"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG3216 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08139"
FT                   /db_xref="GOA:A9BDF3"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDF3"
FT                   /protein_id="ABX08139.1"
FT   gene            complement(199157..201487)
FT                   /gene="spoT"
FT                   /locus_tag="P9211_02091"
FT   CDS_pept        complement(199157..201487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="P9211_02091"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-diphosphatase, (ppGpp)ase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases [Signal transduction
FT                   mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08140"
FT                   /db_xref="GOA:A9BDF4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDF4"
FT                   /protein_id="ABX08140.1"
FT   gene            201543..203153
FT                   /locus_tag="P9211_02101"
FT   CDS_pept        201543..203153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02101"
FT                   /product="ABC transporter, ATP binding component"
FT                   /note="ATP binding component, possibly for oligopeptides;
FT                   COG1123 ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08141"
FT                   /db_xref="GOA:A9BDF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDF5"
FT                   /protein_id="ABX08141.1"
FT   gene            complement(203173..204156)
FT                   /gene="rluD"
FT                   /locus_tag="P9211_02111"
FT   CDS_pept        complement(203173..204156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="P9211_02111"
FT                   /product="putative pseudouridylate synthase specific to
FT                   ribosomal large subunit"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG564 Pseudouridylate synthases, 23S RNA-specific
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08142"
FT                   /db_xref="GOA:A9BDF6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDF6"
FT                   /protein_id="ABX08142.1"
FT   gene            complement(204156..205019)
FT                   /locus_tag="P9211_02121"
FT   CDS_pept        complement(204156..205019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02121"
FT                   /product="Predicted GTPase"
FT                   /note="COG1161 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08143"
FT                   /db_xref="GOA:A9BDF7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDF7"
FT                   /protein_id="ABX08143.1"
FT                   SLELPK"
FT   gene            205409..206617
FT                   /gene="pgk"
FT                   /locus_tag="P9211_02131"
FT   CDS_pept        205409..206617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="P9211_02131"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number=""
FT                   /note="COG126 3-phosphoglycerate kinase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08144"
FT                   /db_xref="GOA:A9BDF8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDF8"
FT                   /protein_id="ABX08144.1"
FT                   ELD"
FT   gene            complement(206663..207250)
FT                   /locus_tag="P9211_02141"
FT   CDS_pept        complement(206663..207250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02141"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08145"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDF9"
FT                   /protein_id="ABX08145.1"
FT   gene            207466..208533
FT                   /gene="murG"
FT                   /locus_tag="P9211_02151"
FT   CDS_pept        207466..208533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="P9211_02151"
FT                   /product="Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc
FT                   GlcNAc transferase"
FT                   /EC_number=""
FT                   /note="COG707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase [Cell envelope biogenesis,
FT                   outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08146"
FT                   /db_xref="GOA:A9BDG0"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDG0"
FT                   /protein_id="ABX08146.1"
FT                   RDAHIHLMSLLKEAS"
FT   gene            complement(208526..209641)
FT                   /locus_tag="P9211_02161"
FT   CDS_pept        complement(208526..209641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02161"
FT                   /product="Aminotransferase class-I"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG79 Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08147"
FT                   /db_xref="GOA:A9BDG1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDG1"
FT                   /protein_id="ABX08147.1"
FT   gene            complement(209632..210810)
FT                   /gene="pyrD"
FT                   /locus_tag="P9211_02171"
FT   CDS_pept        complement(209632..210810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="P9211_02171"
FT                   /product="Dihydroorotate dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG167 Dihydroorotate dehydrogenase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08148"
FT                   /db_xref="GOA:A9BDG2"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDG2"
FT                   /protein_id="ABX08148.1"
FT   gene            complement(210825..211316)
FT                   /gene="rnhA"
FT                   /locus_tag="P9211_02181"
FT   CDS_pept        complement(210825..211316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="P9211_02181"
FT                   /product="Ribonuclease HI"
FT                   /EC_number=""
FT                   /note="COG328 Ribonuclease HI [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08149"
FT                   /db_xref="GOA:A9BDG3"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDG3"
FT                   /protein_id="ABX08149.1"
FT                   "
FT   gene            complement(211365..211763)
FT                   /gene="rplL"
FT                   /locus_tag="P9211_02191"
FT   CDS_pept        complement(211365..211763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="P9211_02191"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="COG222 Ribosomal protein L7/L12 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08150"
FT                   /db_xref="GOA:A9BDG4"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDG4"
FT                   /protein_id="ABX08150.1"
FT   gene            complement(211817..212344)
FT                   /gene="rplJ"
FT                   /locus_tag="P9211_02201"
FT   CDS_pept        complement(211817..212344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="P9211_02201"
FT                   /product="50S ribosomal protein L10"
FT                   /note="COG244 Ribosomal protein L10 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08151"
FT                   /db_xref="GOA:A9BDG5"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDG5"
FT                   /protein_id="ABX08151.1"
FT                   RSLKQHADSGEN"
FT   gene            complement(212574..213278)
FT                   /gene="rplA"
FT                   /locus_tag="P9211_02211"
FT   CDS_pept        complement(212574..213278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="P9211_02211"
FT                   /product="50S ribosomal protein L1"
FT                   /note="COG81 Ribosomal protein L1 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08152"
FT                   /db_xref="GOA:A9BDG6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDG6"
FT                   /protein_id="ABX08152.1"
FT                   VDIAALQDISQE"
FT   gene            complement(213359..213784)
FT                   /gene="rplK"
FT                   /locus_tag="P9211_02221"
FT   CDS_pept        complement(213359..213784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="P9211_02221"
FT                   /product="50S ribosomal protein L11"
FT                   /EC_number=""
FT                   /note="COG80 Ribosomal protein L11 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08153"
FT                   /db_xref="GOA:A9BDG7"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDG7"
FT                   /protein_id="ABX08153.1"
FT   gene            complement(213885..214544)
FT                   /gene="nusG"
FT                   /locus_tag="P9211_02231"
FT   CDS_pept        complement(213885..214544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="P9211_02231"
FT                   /product="transcription antitermination protein, NusG"
FT                   /note="COG250 Transcription antiterminator [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08154"
FT                   /db_xref="GOA:A9BDG8"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDG8"
FT                   /protein_id="ABX08154.1"
FT   gene            complement(214598..214840)
FT                   /gene="secE"
FT                   /locus_tag="P9211_02241"
FT   CDS_pept        complement(214598..214840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="P9211_02241"
FT                   /product="putative preprotein translocase, SecE subunit"
FT                   /note="COG690 Preprotein translocase subunit SecE
FT                   [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08155"
FT                   /db_xref="GOA:A9BDG9"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDG9"
FT                   /protein_id="ABX08155.1"
FT   gene            complement(214924..217686)
FT                   /gene="clpB2"
FT                   /locus_tag="P9211_02251"
FT   CDS_pept        complement(214924..217686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB2"
FT                   /locus_tag="P9211_02251"
FT                   /product="putative ATP-dependent Clp protease, Hsp 100,
FT                   ATP-binding subunit ClpB"
FT                   /EC_number=""
FT                   /note="COG542 ATPases with chaperone activity, ATP-binding
FT                   subunit [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08156"
FT                   /db_xref="GOA:A9BDH0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDH0"
FT                   /protein_id="ABX08156.1"
FT   gene            complement(217724..218122)
FT                   /gene="gloA"
FT                   /locus_tag="P9211_02261"
FT   CDS_pept        complement(217724..218122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="P9211_02261"
FT                   /product="Putative lactoylglutathione lyase"
FT                   /EC_number=""
FT                   /note="COG346 Lactoylglutathione lyase and related lyases
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08157"
FT                   /db_xref="GOA:A9BDH1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDH1"
FT                   /protein_id="ABX08157.1"
FT   gene            218269..219567
FT                   /gene="eno"
FT                   /locus_tag="P9211_02271"
FT   CDS_pept        218269..219567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="P9211_02271"
FT                   /product="Enolase"
FT                   /EC_number=""
FT                   /note="COG148 Enolase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08158"
FT                   /db_xref="GOA:A9BDH2"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDH2"
FT                   /protein_id="ABX08158.1"
FT   gene            complement(219591..221273)
FT                   /locus_tag="P9211_02281"
FT   CDS_pept        complement(219591..221273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02281"
FT                   /product="possible kinase"
FT                   /note="COG661 Predicted unusual protein kinase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08159"
FT                   /db_xref="GOA:A9BDH3"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDH3"
FT                   /protein_id="ABX08159.1"
FT   gene            complement(221270..221584)
FT                   /locus_tag="P9211_02291"
FT   CDS_pept        complement(221270..221584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02291"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08160"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDH4"
FT                   /protein_id="ABX08160.1"
FT                   "
FT   gene            complement(221626..222126)
FT                   /locus_tag="P9211_02301"
FT   CDS_pept        complement(221626..222126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02301"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08161"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDH5"
FT                   /protein_id="ABX08161.1"
FT                   PDP"
FT   gene            222370..223326
FT                   /locus_tag="P9211_02311"
FT   CDS_pept        222370..223326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02311"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /EC_number=""
FT                   /note="COG492 Thioredoxin reductase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08162"
FT                   /db_xref="GOA:A9BDH6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDH6"
FT                   /protein_id="ABX08162.1"
FT   gene            complement(223355..223636)
FT                   /locus_tag="P9211_02321"
FT   CDS_pept        complement(223355..223636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08163"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDH7"
FT                   /protein_id="ABX08163.1"
FT   gene            complement(223641..224636)
FT                   /locus_tag="P9211_02331"
FT   CDS_pept        complement(223641..224636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02331"
FT                   /product="putative sodium-dependent bicarbonate
FT                   transporter"
FT                   /note="COG3329 Predicted permease [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08164"
FT                   /db_xref="GOA:A9BDH8"
FT                   /db_xref="InterPro:IPR010293"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDH8"
FT                   /protein_id="ABX08164.1"
FT   gene            complement(224706..226439)
FT                   /locus_tag="P9211_02341"
FT   CDS_pept        complement(224706..226439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02341"
FT                   /product="putative sulfate transporter"
FT                   /note="COG659 Sulfate permease and related transporters
FT                   (MFS superfamily) [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08165"
FT                   /db_xref="GOA:A9BDH9"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDH9"
FT                   /protein_id="ABX08165.1"
FT                   N"
FT   gene            226517..227455
FT                   /gene="dnaJ3"
FT                   /locus_tag="P9211_02351"
FT   CDS_pept        226517..227455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ3"
FT                   /locus_tag="P9211_02351"
FT                   /product="DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain"
FT                   /note="COG484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08166"
FT                   /db_xref="GOA:A9BDI0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDI0"
FT                   /protein_id="ABX08166.1"
FT   gene            227496..228506
FT                   /gene="hemB"
FT                   /locus_tag="P9211_02361"
FT   CDS_pept        227496..228506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="P9211_02361"
FT                   /product="Delta-aminolevulinic acid dehydratase"
FT                   /EC_number=""
FT                   /note="COG113 Delta-aminolevulinic acid dehydratase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08167"
FT                   /db_xref="GOA:A9BDI1"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDI1"
FT                   /protein_id="ABX08167.1"
FT   gene            228565..228954
FT                   /locus_tag="P9211_02371"
FT   CDS_pept        228565..228954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02371"
FT                   /product="Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /note="COG346 Lactoylglutathione lyase and related lyases
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08168"
FT                   /db_xref="GOA:A9BDI2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDI2"
FT                   /protein_id="ABX08168.1"
FT   gene            228963..231380
FT                   /locus_tag="P9211_02381"
FT   CDS_pept        228963..231380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02381"
FT                   /product="putative DNA mismatch repair protein MutS family"
FT                   /EC_number=""
FT                   /note="COG1193 Mismatch repair ATPase (MutS family) [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08169"
FT                   /db_xref="GOA:A9BDI3"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDI3"
FT                   /protein_id="ABX08169.1"
FT   gene            231464..232453
FT                   /gene="obg"
FT                   /locus_tag="P9211_02391"
FT   CDS_pept        231464..232453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obg"
FT                   /locus_tag="P9211_02391"
FT                   /product="GTP1/OBG family"
FT                   /note="COG536 Predicted GTPase [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08170"
FT                   /db_xref="GOA:A9BDI4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDI4"
FT                   /protein_id="ABX08170.1"
FT   gene            232536..232718
FT                   /locus_tag="P9211_02401"
FT   CDS_pept        232536..232718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08171"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDI5"
FT                   /protein_id="ABX08171.1"
FT                   VCSLTGSPSDFNMDY"
FT   gene            complement(232791..233033)
FT                   /locus_tag="P9211_02411"
FT   CDS_pept        complement(232791..233033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02411"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08172"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDI6"
FT                   /protein_id="ABX08172.1"
FT   gene            complement(233124..233801)
FT                   /locus_tag="P9211_02421"
FT   CDS_pept        complement(233124..233801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02421"
FT                   /product="Hypothetical protein"
FT                   /note="COG5413 Uncharacterized integral membrane protein
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08173"
FT                   /db_xref="GOA:A9BDI7"
FT                   /db_xref="InterPro:IPR019275"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDI7"
FT                   /protein_id="ABX08173.1"
FT                   SGI"
FT   gene            complement(233798..234790)
FT                   /gene="ecm4"
FT                   /locus_tag="P9211_02431"
FT   CDS_pept        complement(233798..234790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecm4"
FT                   /locus_tag="P9211_02431"
FT                   /product="Glutathione S-transferase C terminus"
FT                   /EC_number=""
FT                   /note="COG435 Predicted glutathione S-transferase
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08174"
FT                   /db_xref="GOA:A9BDI8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDI8"
FT                   /protein_id="ABX08174.1"
FT   gene            234762..235769
FT                   /gene="aspA"
FT                   /locus_tag="P9211_02441"
FT   CDS_pept        234762..235769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="P9211_02441"
FT                   /product="putative aspartoacylase"
FT                   /EC_number=""
FT                   /note="COG2988 Succinylglutamate desuccinylase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08175"
FT                   /db_xref="GOA:A9BDI9"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016708"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDI9"
FT                   /protein_id="ABX08175.1"
FT   gene            complement(235770..236129)
FT                   /locus_tag="P9211_02451"
FT   CDS_pept        complement(235770..236129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02451"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08176"
FT                   /db_xref="GOA:A9BDJ0"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDJ0"
FT                   /protein_id="ABX08176.1"
FT                   TDLPCTEDENIWACG"
FT   gene            236424..237506
FT                   /gene="psbA"
FT                   /locus_tag="P9211_02461"
FT   CDS_pept        236424..237506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbA"
FT                   /locus_tag="P9211_02461"
FT                   /product="Photosystem II PsbA protein (D1)"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08177"
FT                   /db_xref="GOA:A9BDJ1"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDJ1"
FT                   /protein_id="ABX08177.1"
FT   gene            237674..238765
FT                   /gene="aroC"
FT                   /locus_tag="P9211_02471"
FT   CDS_pept        237674..238765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="P9211_02471"
FT                   /product="Chorismate synthase"
FT                   /EC_number=""
FT                   /note="COG82 Chorismate synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08178"
FT                   /db_xref="GOA:A9BDJ2"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDJ2"
FT                   /protein_id="ABX08178.1"
FT   gene            complement(238806..240614)
FT                   /locus_tag="P9211_02481"
FT   CDS_pept        complement(238806..240614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02481"
FT                   /product="cell division protein FtsH2"
FT                   /note="COG465 ATP-dependent Zn proteases [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08179"
FT                   /db_xref="GOA:A9BDJ3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDJ3"
FT                   /protein_id="ABX08179.1"
FT   gene            complement(240698..241870)
FT                   /gene="met3"
FT                   /locus_tag="P9211_02491"
FT   CDS_pept        complement(240698..241870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="met3"
FT                   /locus_tag="P9211_02491"
FT                   /product="ATP-sulfurylase"
FT                   /EC_number=""
FT                   /note="COG2046 ATP sulfurylase (sulfate
FT                   adenylyltransferase) [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08180"
FT                   /db_xref="GOA:A9BDJ4"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDJ4"
FT                   /protein_id="ABX08180.1"
FT   gene            complement(242024..242812)
FT                   /gene="psbO"
FT                   /locus_tag="P9211_02501"
FT   CDS_pept        complement(242024..242812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbO"
FT                   /locus_tag="P9211_02501"
FT                   /product="Photosystem II manganese-stabilizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08181"
FT                   /db_xref="GOA:A9BDJ5"
FT                   /db_xref="InterPro:IPR002628"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDJ5"
FT                   /protein_id="ABX08181.1"
FT   gene            complement(243038..244327)
FT                   /gene="dfp"
FT                   /locus_tag="P9211_02511"
FT   CDS_pept        complement(243038..244327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="P9211_02511"
FT                   /product="putative p-pantothenate cysteine ligase and
FT                   p-pantothenenoylcysteine decarboxylase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08182"
FT                   /db_xref="GOA:A9BDJ6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDJ6"
FT                   /protein_id="ABX08182.1"
FT   gene            complement(244317..244661)
FT                   /locus_tag="P9211_02521"
FT   CDS_pept        complement(244317..244661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02521"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08183"
FT                   /db_xref="InterPro:IPR019678"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDJ7"
FT                   /protein_id="ABX08183.1"
FT                   LIDQEPFDED"
FT   gene            244791..244991
FT                   /locus_tag="P9211_02531"
FT   CDS_pept        244791..244991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08184"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDJ8"
FT                   /protein_id="ABX08184.1"
FT   gene            245141..245482
FT                   /locus_tag="P9211_02541"
FT   CDS_pept        245141..245482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08185"
FT                   /db_xref="GOA:A9BDJ9"
FT                   /db_xref="InterPro:IPR007572"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDJ9"
FT                   /protein_id="ABX08185.1"
FT                   LFMEGFKLL"
FT   gene            complement(245524..246537)
FT                   /gene="pyrB"
FT                   /locus_tag="P9211_02551"
FT   CDS_pept        complement(245524..246537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="P9211_02551"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number=""
FT                   /note="COG540 Aspartate carbamoyltransferase, catalytic
FT                   chain [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08186"
FT                   /db_xref="GOA:A9BDK0"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDK0"
FT                   /protein_id="ABX08186.1"
FT   gene            complement(246537..247100)
FT                   /gene="mpg"
FT                   /locus_tag="P9211_02561"
FT   CDS_pept        complement(246537..247100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpg"
FT                   /locus_tag="P9211_02561"
FT                   /product="possible Methylpurine-DNA glycosylase (MPG)"
FT                   /note="COG2094 3-methyladenine DNA glycosylase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08187"
FT                   /db_xref="GOA:A9BDK1"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDK1"
FT                   /protein_id="ABX08187.1"
FT   gene            247271..248068
FT                   /locus_tag="P9211_02571"
FT   CDS_pept        247271..248068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02571"
FT                   /product="Uncharacterized protein, putative amidase"
FT                   /EC_number=""
FT                   /note="COG1402 Uncharacterized protein, putative amidase
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08188"
FT                   /db_xref="GOA:A9BDK2"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDK2"
FT                   /protein_id="ABX08188.1"
FT   gene            248065..248358
FT                   /gene="gatC"
FT                   /locus_tag="P9211_02581"
FT   CDS_pept        248065..248358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="P9211_02581"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit C"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG721 Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08189"
FT                   /db_xref="GOA:A9BDK3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDK3"
FT                   /protein_id="ABX08189.1"
FT   gene            complement(248372..249397)
FT                   /gene="crtR"
FT                   /locus_tag="P9211_02591"
FT   CDS_pept        complement(248372..249397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtR"
FT                   /locus_tag="P9211_02591"
FT                   /product="Beta-carotene hydroxylase"
FT                   /note="COG3239 Fatty acid desaturase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08190"
FT                   /db_xref="GOA:A9BDK4"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDK4"
FT                   /protein_id="ABX08190.1"
FT                   K"
FT   gene            complement(249530..249614)
FT                   /locus_tag="P9211_tRNALeuVIMSS1309360"
FT                   /note="tRNA-Leu"
FT   tRNA            complement(249530..249614)
FT                   /locus_tag="P9211_tRNALeuVIMSS1309360"
FT                   /product="tRNA-Leu"
FT   gene            249668..250216
FT                   /locus_tag="P9211_02601"
FT   CDS_pept        249668..250216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02601"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08191"
FT                   /db_xref="GOA:A9BDK5"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDK5"
FT                   /protein_id="ABX08191.1"
FT   gene            250239..253148
FT                   /gene="ileS"
FT                   /locus_tag="P9211_02611"
FT   CDS_pept        250239..253148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="P9211_02611"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG60 Isoleucyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02611"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08192"
FT                   /db_xref="GOA:A9BDK6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDK6"
FT                   /protein_id="ABX08192.1"
FT   gene            complement(253174..253494)
FT                   /locus_tag="P9211_02621"
FT   CDS_pept        complement(253174..253494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02621"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02621"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08193"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDK7"
FT                   /protein_id="ABX08193.1"
FT                   WL"
FT   gene            complement(253498..254109)
FT                   /locus_tag="P9211_02631"
FT   CDS_pept        complement(253498..254109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02631"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08194"
FT                   /db_xref="GOA:A9BDK8"
FT                   /db_xref="InterPro:IPR021515"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDK8"
FT                   /protein_id="ABX08194.1"
FT   gene            254193..254849
FT                   /locus_tag="P9211_02641"
FT   CDS_pept        254193..254849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02641"
FT                   /product="Predicted SAM-dependent methyltransferase"
FT                   /EC_number=""
FT                   /note="COG220 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02641"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08195"
FT                   /db_xref="GOA:A9BDK9"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDK9"
FT                   /protein_id="ABX08195.1"
FT   gene            complement(254891..256261)
FT                   /locus_tag="P9211_02651"
FT   CDS_pept        complement(254891..256261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02651"
FT                   /product="Phosphotransferase superclass"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1109 Phosphomannomutase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02651"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08196"
FT                   /db_xref="GOA:A9BDL0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDL0"
FT                   /protein_id="ABX08196.1"
FT   gene            complement(256310..256477)
FT                   /locus_tag="P9211_02661"
FT   CDS_pept        complement(256310..256477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02661"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02661"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08197"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDL1"
FT                   /protein_id="ABX08197.1"
FT                   DLLGKGFYLS"
FT   gene            256383..256949
FT                   /locus_tag="P9211_02671"
FT   CDS_pept        256383..256949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02671"
FT                   /product="thioredoxin-like protein TxlA"
FT                   /note="COG526 Thiol-disulfide isomerase and thioredoxins
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones / Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02671"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08198"
FT                   /db_xref="GOA:A9BDL2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDL2"
FT                   /protein_id="ABX08198.1"
FT   gene            complement(256953..257585)
FT                   /gene="thy1"
FT                   /locus_tag="P9211_02681"
FT   CDS_pept        complement(256953..257585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thy1"
FT                   /locus_tag="P9211_02681"
FT                   /product="possible Thy1-like protein"
FT                   /EC_number=""
FT                   /note="COG1351 Predicted alternative thymidylate synthase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02681"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08199"
FT                   /db_xref="GOA:A9BDL3"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDL3"
FT                   /protein_id="ABX08199.1"
FT   gene            complement(257588..258181)
FT                   /gene="dcd"
FT                   /locus_tag="P9211_02691"
FT   CDS_pept        complement(257588..258181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="P9211_02691"
FT                   /product="dCTP Deaminase"
FT                   /EC_number=""
FT                   /note="COG717 Deoxycytidine deaminase [Nucleotide transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02691"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08200"
FT                   /db_xref="GOA:A9BDL4"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDL4"
FT                   /protein_id="ABX08200.1"
FT   gene            complement(258181..258819)
FT                   /locus_tag="P9211_02701"
FT   CDS_pept        complement(258181..258819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02701"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number=""
FT                   /note="COG2109 ATP:corrinoid adenosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02701"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08201"
FT                   /db_xref="GOA:A9BDL5"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDL5"
FT                   /protein_id="ABX08201.1"
FT   gene            259024..259758
FT                   /gene="ntcA"
FT                   /locus_tag="P9211_02711"
FT   CDS_pept        259024..259758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntcA"
FT                   /locus_tag="P9211_02711"
FT                   /product="Global nitrogen regulatory protein"
FT                   /note="belongs to the CRP family of transcriptional
FT                   regulators; COG664 cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases [Signal transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02711"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08202"
FT                   /db_xref="GOA:A9BDL6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR022299"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDL6"
FT                   /protein_id="ABX08202.1"
FT   gene            259821..260798
FT                   /locus_tag="P9211_02721"
FT   CDS_pept        259821..260798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02721"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08203"
FT                   /db_xref="GOA:A9BDL7"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDL7"
FT                   /protein_id="ABX08203.1"
FT   gene            260812..261252
FT                   /locus_tag="P9211_02731"
FT   CDS_pept        260812..261252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02731"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02731"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08204"
FT                   /db_xref="GOA:A9BDL8"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDL8"
FT                   /protein_id="ABX08204.1"
FT   gene            complement(261233..261490)
FT                   /locus_tag="P9211_02741"
FT   CDS_pept        complement(261233..261490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02741"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02741"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08205"
FT                   /db_xref="InterPro:IPR021492"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDL9"
FT                   /protein_id="ABX08205.1"
FT   gene            complement(261495..262115)
FT                   /gene="pth"
FT                   /locus_tag="P9211_02751"
FT   CDS_pept        complement(261495..262115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="P9211_02751"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number=""
FT                   /note="COG193 Peptidyl-tRNA hydrolase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02751"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08206"
FT                   /db_xref="GOA:A9BDM0"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDM0"
FT                   /protein_id="ABX08206.1"
FT   gene            complement(262145..262396)
FT                   /locus_tag="P9211_02761"
FT   CDS_pept        complement(262145..262396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02761"
FT                   /product="Sec-independent protein secretion pathway
FT                   component"
FT                   /note="COG1826 Sec-independent protein secretion pathway
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02761"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08207"
FT                   /db_xref="GOA:A9BDM1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDM1"
FT                   /protein_id="ABX08207.1"
FT   gene            complement(262427..262630)
FT                   /gene="psbH"
FT                   /locus_tag="P9211_02771"
FT   CDS_pept        complement(262427..262630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbH"
FT                   /locus_tag="P9211_02771"
FT                   /product="Photosystem II PsbH protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02771"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08208"
FT                   /db_xref="GOA:A9BDM2"
FT                   /db_xref="InterPro:IPR001056"
FT                   /db_xref="InterPro:IPR036863"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDM2"
FT                   /protein_id="ABX08208.1"
FT   gene            262717..262857
FT                   /gene="psbN"
FT                   /locus_tag="P9211_02781"
FT   CDS_pept        262717..262857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbN"
FT                   /locus_tag="P9211_02781"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02781"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08209"
FT                   /db_xref="GOA:A9BDM3"
FT                   /db_xref="InterPro:IPR003398"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDM3"
FT                   /protein_id="ABX08209.1"
FT                   D"
FT   gene            262993..263121
FT                   /gene="psbI"
FT                   /locus_tag="P9211_02791"
FT   CDS_pept        262993..263121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbI"
FT                   /locus_tag="P9211_02791"
FT                   /product="photosystem II reaction center PsbI protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02791"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08210"
FT                   /db_xref="GOA:A9BDM4"
FT                   /db_xref="InterPro:IPR003686"
FT                   /db_xref="InterPro:IPR037271"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDM4"
FT                   /protein_id="ABX08210.1"
FT   gene            263200..265404
FT                   /locus_tag="P9211_02801"
FT   CDS_pept        263200..265404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02801"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08211"
FT                   /db_xref="GOA:A9BDM5"
FT                   /db_xref="InterPro:IPR022244"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDM5"
FT                   /protein_id="ABX08211.1"
FT   gene            complement(265431..266054)
FT                   /gene="leuD"
FT                   /locus_tag="P9211_02811"
FT   CDS_pept        complement(265431..266054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="P9211_02811"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number=""
FT                   /note="COG66 3-isopropylmalate dehydratase small subunit
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02811"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08212"
FT                   /db_xref="GOA:A9BDM6"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDM6"
FT                   /protein_id="ABX08212.1"
FT   gene            complement(266061..267476)
FT                   /gene="leuC"
FT                   /locus_tag="P9211_02821"
FT   CDS_pept        complement(266061..267476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="P9211_02821"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number=""
FT                   /note="COG65 3-isopropylmalate dehydratase large subunit
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02821"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08213"
FT                   /db_xref="GOA:A9BDM7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDM7"
FT                   /protein_id="ABX08213.1"
FT                   SVTDVRNLINQGP"
FT   gene            complement(267501..268796)
FT                   /gene="cinA"
FT                   /locus_tag="P9211_02831"
FT   CDS_pept        complement(267501..268796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="P9211_02831"
FT                   /product="Molybdenum cofactor biosynthesis protein"
FT                   /note="COG1058 Predicted nucleotide-utilizing enzyme
FT                   related to molybdopterin-biosynthesis enzyme MoeA [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02831"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08214"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDM8"
FT                   /protein_id="ABX08214.1"
FT   gene            complement(268789..270039)
FT                   /gene="glyA"
FT                   /locus_tag="P9211_02841"
FT   CDS_pept        complement(268789..270039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="P9211_02841"
FT                   /product="Serine hydroxymethyltransferase (SHMT)"
FT                   /EC_number=""
FT                   /note="COG112 Glycine/serine hydroxymethyltransferase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02841"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08215"
FT                   /db_xref="GOA:A9BDM9"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDM9"
FT                   /protein_id="ABX08215.1"
FT                   KCQQRVLDLCNRFPLYD"
FT   gene            complement(270151..270224)
FT                   /locus_tag="P9211_tRNAArgVIMSS1309359"
FT                   /note="tRNA-Arg"
FT   tRNA            complement(270151..270224)
FT                   /locus_tag="P9211_tRNAArgVIMSS1309359"
FT                   /product="tRNA-Arg"
FT   gene            270315..270575
FT                   /locus_tag="P9211_02851"
FT   CDS_pept        270315..270575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02851"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02851"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08216"
FT                   /db_xref="GOA:A9BDN0"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDN0"
FT                   /protein_id="ABX08216.1"
FT   gene            270605..270895
FT                   /locus_tag="P9211_02861"
FT   CDS_pept        270605..270895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02861"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02861"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08217"
FT                   /db_xref="InterPro:IPR021518"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDN1"
FT                   /protein_id="ABX08217.1"
FT   gene            270920..271183
FT                   /locus_tag="P9211_02871"
FT   CDS_pept        270920..271183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02871"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02871"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08218"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDN2"
FT                   /protein_id="ABX08218.1"
FT   gene            complement(271170..272777)
FT                   /gene="mviN"
FT                   /locus_tag="P9211_02881"
FT   CDS_pept        complement(271170..272777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="P9211_02881"
FT                   /product="Uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /note="COG728 Uncharacterized membrane protein, putative
FT                   virulence factor [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02881"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08219"
FT                   /db_xref="GOA:A9BDN3"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDN3"
FT                   /protein_id="ABX08219.1"
FT                   IKEVNELMILFENKINHP"
FT   gene            272862..273632
FT                   /gene="sfsA"
FT                   /locus_tag="P9211_02891"
FT   CDS_pept        272862..273632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="P9211_02891"
FT                   /product="putative sugar fermentation stimulation protein"
FT                   /note="COG1489 DNA-binding protein, stimulates sugar
FT                   fermentation [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02891"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08220"
FT                   /db_xref="GOA:A9BDN4"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDN4"
FT                   /protein_id="ABX08220.1"
FT   gene            273791..275221
FT                   /gene="amtB"
FT                   /locus_tag="P9211_02901"
FT   CDS_pept        273791..275221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="P9211_02901"
FT                   /product="Ammonium transporter family"
FT                   /note="COG4 Ammonia permease [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02901"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08221"
FT                   /db_xref="GOA:A9BDN5"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDN5"
FT                   /protein_id="ABX08221.1"
FT                   LDIGEHGMEAYPDFASAQ"
FT   gene            275327..276541
FT                   /gene="lytB"
FT                   /locus_tag="P9211_02911"
FT   CDS_pept        275327..276541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="P9211_02911"
FT                   /product="LytB-like protein"
FT                   /EC_number=""
FT                   /note="COG761 Penicillin tolerance protein [Lipid
FT                   metabolism / Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02911"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08222"
FT                   /db_xref="GOA:A9BDN6"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDN6"
FT                   /protein_id="ABX08222.1"
FT                   KAFVD"
FT   gene            276659..277231
FT                   /locus_tag="P9211_02921"
FT   CDS_pept        276659..277231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02921"
FT                   /product="Predicted membrane protein"
FT                   /note="COG2259 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02921"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08223"
FT                   /db_xref="GOA:A9BDN7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDN7"
FT                   /protein_id="ABX08223.1"
FT   gene            complement(277278..278834)
FT                   /gene="purH"
FT                   /locus_tag="P9211_02931"
FT   CDS_pept        complement(277278..278834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="P9211_02931"
FT                   /product="AICARFT/IMPCHase bienzyme:Methylglyoxal
FT                   synthase-like domain"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG138 AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful) [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02931"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08224"
FT                   /db_xref="GOA:A9BDN8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDN8"
FT                   /protein_id="ABX08224.1"
FT                   H"
FT   gene            278895..279500
FT                   /locus_tag="P9211_02941"
FT   CDS_pept        278895..279500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02941"
FT                   /product="probable esterase"
FT                   /note="COG400 Predicted esterase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02941"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08225"
FT                   /db_xref="GOA:A9BDN9"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDN9"
FT                   /protein_id="ABX08225.1"
FT   gene            complement(279513..279881)
FT                   /locus_tag="P9211_02951"
FT   CDS_pept        complement(279513..279881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02951"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02951"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08226"
FT                   /db_xref="InterPro:IPR021498"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDP0"
FT                   /protein_id="ABX08226.1"
FT                   ELTSDDWEEIEEYEYAFV"
FT   gene            280195..281325
FT                   /locus_tag="P9211_02961"
FT   CDS_pept        280195..281325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_02961"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="COG642 Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02961"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08227"
FT                   /db_xref="GOA:A9BDP1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDP1"
FT                   /protein_id="ABX08227.1"
FT   gene            complement(281294..282100)
FT                   /gene="cobS"
FT                   /locus_tag="P9211_02971"
FT   CDS_pept        complement(281294..282100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="P9211_02971"
FT                   /product="Cobalamin-5-phosphate synthase CobS"
FT                   /EC_number=""
FT                   /note="COG368 Cobalamin-5-phosphate synthase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02971"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08228"
FT                   /db_xref="GOA:A9BDP2"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDP2"
FT                   /protein_id="ABX08228.1"
FT   gene            282166..283284
FT                   /gene="tgt"
FT                   /locus_tag="P9211_02981"
FT   CDS_pept        282166..283284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="P9211_02981"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number=""
FT                   /note="COG343 Queuine/archaeosine tRNA-ribosyltransferase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02981"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08229"
FT                   /db_xref="GOA:A9BDP3"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDP3"
FT                   /protein_id="ABX08229.1"
FT   gene            283302..283460
FT                   /gene="psbK"
FT                   /locus_tag="P9211_02991"
FT   CDS_pept        283302..283460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbK"
FT                   /locus_tag="P9211_02991"
FT                   /product="Photosystem II protein PsbK"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_02991"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08230"
FT                   /db_xref="GOA:A9BDP4"
FT                   /db_xref="InterPro:IPR003687"
FT                   /db_xref="InterPro:IPR037270"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDP4"
FT                   /protein_id="ABX08230.1"
FT                   QAAVGFR"
FT   gene            complement(283583..284587)
FT                   /locus_tag="P9211_03001"
FT   CDS_pept        complement(283583..284587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03001"
FT                   /product="probable oxidoreductase"
FT                   /EC_number=""
FT                   /note="COG673 Predicted dehydrogenases and related proteins
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08231"
FT                   /db_xref="GOA:A9BDP5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDP5"
FT                   /protein_id="ABX08231.1"
FT   gene            complement(284625..285908)
FT                   /locus_tag="P9211_03011"
FT   CDS_pept        complement(284625..285908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03011"
FT                   /product="Hemolysin-like protein"
FT                   /note="COG1253 Hemolysins and related proteins containing
FT                   CBS domains [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08232"
FT                   /db_xref="GOA:A9BDP6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDP6"
FT                   /protein_id="ABX08232.1"
FT   gene            complement(285922..285994)
FT                   /locus_tag="P9211_tRNAMetVIMSS1309358"
FT                   /note="tRNA-Met"
FT   tRNA            complement(285922..285994)
FT                   /locus_tag="P9211_tRNAMetVIMSS1309358"
FT                   /product="tRNA-Met"
FT   gene            286106..286690
FT                   /gene="pyrE"
FT                   /locus_tag="P9211_03021"
FT   CDS_pept        286106..286690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="P9211_03021"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="COG461 Orotate phosphoribosyltransferase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08233"
FT                   /db_xref="GOA:A9BDP7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDP7"
FT                   /protein_id="ABX08233.1"
FT   gene            286687..287529
FT                   /locus_tag="P9211_03031"
FT   CDS_pept        286687..287529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03031"
FT                   /product="Predicted GcvT-like aminomethyltransferase"
FT                   /note="COG354 Predicted aminomethyltransferase related to
FT                   GcvT [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08234"
FT                   /db_xref="GOA:A9BDS4"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDS4"
FT                   /protein_id="ABX08234.1"
FT   gene            complement(287531..289003)
FT                   /locus_tag="P9211_03041"
FT   CDS_pept        complement(287531..289003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03041"
FT                   /product="Predicted nuclease (RecB family)"
FT                   /note="COG2251 Predicted nuclease (RecB family) [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08235"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDS5"
FT                   /protein_id="ABX08235.1"
FT   gene            289056..290513
FT                   /locus_tag="P9211_03051"
FT   CDS_pept        289056..290513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03051"
FT                   /product="Phosphotransferase superclass"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1109 Phosphomannomutase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08236"
FT                   /db_xref="GOA:A9BDS6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDS6"
FT                   /protein_id="ABX08236.1"
FT   gene            290483..291118
FT                   /locus_tag="P9211_03061"
FT   CDS_pept        290483..291118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03061"
FT                   /product="Xanthosine triphosphate pyrophosphatase"
FT                   /EC_number=""
FT                   /note="COG127 Xanthosine triphosphate pyrophosphatase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08237"
FT                   /db_xref="GOA:A9BDS7"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDS7"
FT                   /protein_id="ABX08237.1"
FT   gene            complement(291148..292635)
FT                   /locus_tag="P9211_03071"
FT   CDS_pept        complement(291148..292635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03071"
FT                   /product="Retinal pigment epithelial membrane protein"
FT                   /EC_number=""
FT                   /note="COG3670 Lignostilbene-alpha,beta-dioxygenase and
FT                   related enzymes [Secondary metabolites biosynthesis,
FT                   transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08238"
FT                   /db_xref="GOA:A9BDS8"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDS8"
FT                   /protein_id="ABX08238.1"
FT   gene            complement(292711..293337)
FT                   /locus_tag="P9211_03081"
FT   CDS_pept        complement(292711..293337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03081"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number=""
FT                   /note="COG131 Imidazoleglycerol-phosphate dehydratase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08239"
FT                   /db_xref="GOA:A9BDS9"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDS9"
FT                   /protein_id="ABX08239.1"
FT   gene            complement(293374..294156)
FT                   /gene="fabI"
FT                   /locus_tag="P9211_03091"
FT   CDS_pept        complement(293374..294156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="P9211_03091"
FT                   /product="enoyl-[acyl-carrier-protein] reductase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG623 Enoyl-[acyl-carrier-protein]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08240"
FT                   /db_xref="GOA:A9BDT0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDT0"
FT                   /protein_id="ABX08240.1"
FT   gene            294269..294889
FT                   /locus_tag="P9211_03101"
FT   CDS_pept        294269..294889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08241"
FT                   /db_xref="GOA:A9BDT1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDT1"
FT                   /protein_id="ABX08241.1"
FT   gene            294942..296135
FT                   /gene="degT"
FT                   /locus_tag="P9211_03111"
FT   CDS_pept        294942..296135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degT"
FT                   /locus_tag="P9211_03111"
FT                   /product="putative pleiotropic regulatory protein"
FT                   /EC_number=""
FT                   /note="COG399 Predicted pyridoxal phosphate-dependent
FT                   enzyme apparently involved in regulation of cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08242"
FT                   /db_xref="GOA:A9BDT2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDT2"
FT                   /protein_id="ABX08242.1"
FT   gene            complement(296223..296792)
FT                   /locus_tag="P9211_03121"
FT   CDS_pept        complement(296223..296792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03121"
FT                   /product="NUDIX hydrolase"
FT                   /EC_number=""
FT                   /note="COG494 NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes [DNA replication, recombination, and
FT                   repair / General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08243"
FT                   /db_xref="GOA:A9BDT3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDT3"
FT                   /protein_id="ABX08243.1"
FT   gene            complement(296847..297428)
FT                   /gene="folK"
FT                   /locus_tag="P9211_03131"
FT   CDS_pept        complement(296847..297428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="P9211_03131"
FT                   /product="possible
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number=""
FT                   /note="COG801
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08244"
FT                   /db_xref="GOA:A9BDT4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDT4"
FT                   /protein_id="ABX08244.1"
FT   gene            297527..299599
FT                   /gene="chlD"
FT                   /locus_tag="P9211_03141"
FT   CDS_pept        297527..299599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlD"
FT                   /locus_tag="P9211_03141"
FT                   /product="Protoporphyrin IX Magnesium chelatase, ChlD
FT                   subunit"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1239 Mg-chelatase subunit ChlI [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08245"
FT                   /db_xref="GOA:A9BDT5"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011776"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDT5"
FT                   /protein_id="ABX08245.1"
FT   gene            complement(299626..300471)
FT                   /locus_tag="P9211_03151"
FT   CDS_pept        complement(299626..300471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03151"
FT                   /product="possible ABC transporter"
FT                   /note="COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08246"
FT                   /db_xref="GOA:A9BDT6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR039342"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDT6"
FT                   /protein_id="ABX08246.1"
FT                   "
FT   gene            complement(300477..301289)
FT                   /locus_tag="P9211_03161"
FT   CDS_pept        complement(300477..301289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03161"
FT                   /product="possible ABC transporter, ATP binding component"
FT                   /EC_number=""
FT                   /note="COG1127 ABC-type transport system involved in
FT                   resistance to organic solvents, ATPase component [Secondary
FT                   metabolites biosynthesis, transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08247"
FT                   /db_xref="GOA:A9BDT7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDT7"
FT                   /protein_id="ABX08247.1"
FT   gene            301281..302789
FT                   /locus_tag="P9211_03171"
FT   CDS_pept        301281..302789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03171"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG391 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08248"
FT                   /db_xref="GOA:A9BDT8"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDT8"
FT                   /protein_id="ABX08248.1"
FT   gene            complement(302786..303328)
FT                   /gene="ndhJ"
FT                   /locus_tag="P9211_03181"
FT   CDS_pept        complement(302786..303328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhJ"
FT                   /locus_tag="P9211_03181"
FT                   /product="putative respiratory-chain NADH dehydrogenase
FT                   subunit"
FT                   /EC_number=""
FT                   /note="COG852 NADH:ubiquinone oxidoreductase 27 kD subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08249"
FT                   /db_xref="GOA:A9BDT9"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDT9"
FT                   /protein_id="ABX08249.1"
FT                   LRKDYIQPDFYEMQDAY"
FT   gene            complement(303340..304098)
FT                   /gene="ndhK"
FT                   /locus_tag="P9211_03191"
FT   CDS_pept        complement(303340..304098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhK"
FT                   /locus_tag="P9211_03191"
FT                   /product="putative respiratory-chain NADH dehydrogenase
FT                   subunit"
FT                   /EC_number=""
FT                   /note="COG377 NADH:ubiquinone oxidoreductase 20 kD subunit
FT                   and related Fe-S oxidoreductases [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08250"
FT                   /db_xref="GOA:A9BDU0"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDU0"
FT                   /protein_id="ABX08250.1"
FT   gene            complement(304064..304426)
FT                   /gene="ndhC"
FT                   /locus_tag="P9211_03201"
FT   CDS_pept        complement(304064..304426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhC"
FT                   /locus_tag="P9211_03201"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 3)"
FT                   /EC_number=""
FT                   /note="COG838 NADH:ubiquinone oxidoreductase subunit 3
FT                   (chain A) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08251"
FT                   /db_xref="GOA:A9BDU1"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDU1"
FT                   /protein_id="ABX08251.1"
FT                   IVALAYAWRKGALEWS"
FT   gene            304512..304946
FT                   /locus_tag="P9211_03211"
FT   CDS_pept        304512..304946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03211"
FT                   /product="Rubredoxin"
FT                   /note="COG1773 Rubredoxin [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08252"
FT                   /db_xref="GOA:A9BDU2"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDU2"
FT                   /protein_id="ABX08252.1"
FT   gene            304956..305975
FT                   /locus_tag="P9211_03221"
FT   CDS_pept        304956..305975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03221"
FT                   /product="Uncharacterized protein plant photosystem II
FT                   stability/assembly factor-like protein"
FT                   /note="COG4447 Uncharacterized protein related to plant
FT                   photosystem II stability/assembly factor [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08253"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016705"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDU3"
FT                   /protein_id="ABX08253.1"
FT   gene            306074..306322
FT                   /gene="psbE"
FT                   /locus_tag="P9211_03231"
FT   CDS_pept        306074..306322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbE"
FT                   /locus_tag="P9211_03231"
FT                   /product="Cytochrome b559 alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08254"
FT                   /db_xref="GOA:A9BDU4"
FT                   /db_xref="InterPro:IPR006217"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="InterPro:IPR013082"
FT                   /db_xref="InterPro:IPR037025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDU4"
FT                   /protein_id="ABX08254.1"
FT   gene            306326..306472
FT                   /gene="psbF"
FT                   /locus_tag="P9211_03241"
FT   CDS_pept        306326..306472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbF"
FT                   /locus_tag="P9211_03241"
FT                   /product="Cytochrome b559 beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08255"
FT                   /db_xref="GOA:A9BDU5"
FT                   /db_xref="InterPro:IPR006216"
FT                   /db_xref="InterPro:IPR006241"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDU5"
FT                   /protein_id="ABX08255.1"
FT                   IRR"
FT   gene            306494..306613
FT                   /gene="psbL"
FT                   /locus_tag="P9211_03251"
FT   CDS_pept        306494..306613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbL"
FT                   /locus_tag="P9211_03251"
FT                   /product="photosystem II PsbL protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08256"
FT                   /db_xref="GOA:A9BDU6"
FT                   /db_xref="InterPro:IPR003372"
FT                   /db_xref="InterPro:IPR037266"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDU6"
FT                   /protein_id="ABX08256.1"
FT   gene            306628..306822
FT                   /gene="psbJ"
FT                   /locus_tag="P9211_03261"
FT   CDS_pept        306628..306822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbJ"
FT                   /locus_tag="P9211_03261"
FT                   /product="photosytem II PsbJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08257"
FT                   /db_xref="GOA:A9BDU7"
FT                   /db_xref="InterPro:IPR002682"
FT                   /db_xref="InterPro:IPR037267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDU7"
FT                   /protein_id="ABX08257.1"
FT   gene            complement(306838..307788)
FT                   /locus_tag="P9211_03271"
FT   CDS_pept        complement(306838..307788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03271"
FT                   /product="5'-methylthioadenosine phosphorylase"
FT                   /EC_number=""
FT                   /note="COG5 Purine nucleoside phosphorylase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08258"
FT                   /db_xref="GOA:A9BDU8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDU8"
FT                   /protein_id="ABX08258.1"
FT   gene            307774..309957
FT                   /locus_tag="P9211_03281"
FT   CDS_pept        307774..309957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03281"
FT                   /product="Selenide,water dikinase"
FT                   /EC_number=""
FT                   /note="COG1252 NADH dehydrogenase, FAD-containing subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08259"
FT                   /db_xref="GOA:A9BDU9"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR030805"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDU9"
FT                   /protein_id="ABX08259.1"
FT   gene            complement(309975..311240)
FT                   /locus_tag="P9211_03291"
FT   CDS_pept        complement(309975..311240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03291"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /EC_number=""
FT                   /note="COG617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08260"
FT                   /db_xref="GOA:A9BDV0"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDV0"
FT                   /protein_id="ABX08260.1"
FT   gene            complement(311301..313730)
FT                   /gene="uvrD"
FT                   /locus_tag="P9211_03301"
FT   CDS_pept        complement(311301..313730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="P9211_03301"
FT                   /product="UvrD/REP helicase"
FT                   /note="COG210 Superfamily I DNA and RNA helicases [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08261"
FT                   /db_xref="GOA:A9BDV1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDV1"
FT                   /protein_id="ABX08261.1"
FT   gene            complement(313805..314014)
FT                   /locus_tag="P9211_03311"
FT   CDS_pept        complement(313805..314014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03311"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08262"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDV2"
FT                   /protein_id="ABX08262.1"
FT   gene            314269..314817
FT                   /gene="cpeB"
FT                   /locus_tag="P9211_03321"
FT   CDS_pept        314269..314817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeB"
FT                   /locus_tag="P9211_03321"
FT                   /product="Phycobilisome protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08263"
FT                   /db_xref="GOA:A9BDV3"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDV3"
FT                   /protein_id="ABX08263.1"
FT   gene            314861..315328
FT                   /gene="cpeA"
FT                   /locus_tag="P9211_03331"
FT   CDS_pept        314861..315328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeA"
FT                   /locus_tag="P9211_03331"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08264"
FT                   /db_xref="GOA:A9BDV4"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDV4"
FT                   /protein_id="ABX08264.1"
FT   gene            315391..315993
FT                   /gene="cpeZ"
FT                   /locus_tag="P9211_03341"
FT   CDS_pept        315391..315993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeZ"
FT                   /locus_tag="P9211_03341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08265"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDV5"
FT                   /protein_id="ABX08265.1"
FT   gene            complement(316031..316888)
FT                   /locus_tag="P9211_03351"
FT   CDS_pept        complement(316031..316888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03351"
FT                   /product="PBS lyase HEAT-like repeat"
FT                   /note="COG1413 FOG: HEAT repeat [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08266"
FT                   /db_xref="GOA:A9BDV6"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDV6"
FT                   /protein_id="ABX08266.1"
FT                   MLTD"
FT   gene            317092..318417
FT                   /gene="cpeY"
FT                   /locus_tag="P9211_03361"
FT   CDS_pept        317092..318417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeY"
FT                   /locus_tag="P9211_03361"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08267"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDV7"
FT                   /protein_id="ABX08267.1"
FT   gene            complement(318448..319026)
FT                   /gene="cpeT"
FT                   /locus_tag="P9211_03371"
FT   CDS_pept        complement(318448..319026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeT"
FT                   /locus_tag="P9211_03371"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08268"
FT                   /db_xref="GOA:A9BDV8"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDV8"
FT                   /protein_id="ABX08268.1"
FT   gene            complement(319032..319568)
FT                   /gene="cpeS"
FT                   /locus_tag="P9211_03381"
FT   CDS_pept        complement(319032..319568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeS"
FT                   /locus_tag="P9211_03381"
FT                   /product="phycoerythrin linker protein CpeS-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08269"
FT                   /db_xref="GOA:A9BDV9"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDV9"
FT                   /protein_id="ABX08269.1"
FT                   LQTSFSSEVKLRGNP"
FT   gene            complement(319558..319749)
FT                   /locus_tag="P9211_03391"
FT   CDS_pept        complement(319558..319749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08270"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDW0"
FT                   /protein_id="ABX08270.1"
FT                   DKGIDSSSEEPLQTQNEH"
FT   gene            complement(319754..320563)
FT                   /locus_tag="P9211_03401"
FT   CDS_pept        complement(319754..320563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03401"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08271"
FT                   /db_xref="GOA:A9BDW1"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDW1"
FT                   /protein_id="ABX08271.1"
FT   gene            complement(320595..322013)
FT                   /locus_tag="P9211_03411"
FT   CDS_pept        complement(320595..322013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03411"
FT                   /product="Na+/melibiose symporter"
FT                   /note="COG2211 Na+/melibiose symporter and related
FT                   transporters [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08272"
FT                   /db_xref="GOA:A9BDW2"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR026036"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDW2"
FT                   /protein_id="ABX08272.1"
FT                   SAKMEDILMAELDN"
FT   gene            322093..323562
FT                   /gene="ugd"
FT                   /locus_tag="P9211_03421"
FT   CDS_pept        322093..323562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="P9211_03421"
FT                   /product="Predicted UDP-glucose 6-dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG1004 Predicted UDP-glucose 6-dehydrogenase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08273"
FT                   /db_xref="GOA:A9BDW3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028356"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDW3"
FT                   /protein_id="ABX08273.1"
FT   gene            complement(323566..323787)
FT                   /locus_tag="P9211_03431"
FT   CDS_pept        complement(323566..323787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03431"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08274"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDW4"
FT                   /protein_id="ABX08274.1"
FT   gene            complement(323895..323967)
FT                   /locus_tag="P9211_tRNAPheVIMSS1309357"
FT                   /note="tRNA-Phe"
FT   tRNA            complement(323895..323967)
FT                   /locus_tag="P9211_tRNAPheVIMSS1309357"
FT                   /product="tRNA-Phe"
FT   gene            complement(324050..325294)
FT                   /gene="xylB"
FT                   /locus_tag="P9211_03441"
FT   CDS_pept        complement(324050..325294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="P9211_03441"
FT                   /product="Carbohydrate kinase, FGGY family"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1070 Sugar (pentulose and hexulose) kinases
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08275"
FT                   /db_xref="GOA:A9BDW5"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDW5"
FT                   /protein_id="ABX08275.1"
FT                   EGVALLAMQSIHKSL"
FT   gene            complement(325306..326538)
FT                   /gene="metK"
FT                   /locus_tag="P9211_03451"
FT   CDS_pept        complement(325306..326538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="P9211_03451"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number=""
FT                   /note="COG192 S-adenosylmethionine synthetase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08276"
FT                   /db_xref="GOA:A9BDW6"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDW6"
FT                   /protein_id="ABX08276.1"
FT                   EKAKELIALHN"
FT   gene            complement(326580..327356)
FT                   /locus_tag="P9211_03461"
FT   CDS_pept        complement(326580..327356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03461"
FT                   /product="Predicted phosphatase"
FT                   /EC_number=""
FT                   /note="COG546 Predicted phosphatases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08277"
FT                   /db_xref="GOA:A9BDW7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDW7"
FT                   /protein_id="ABX08277.1"
FT   gene            complement(327371..328486)
FT                   /gene="rps1a"
FT                   /gene_synonym="rpsA1"
FT                   /locus_tag="P9211_03471"
FT   CDS_pept        complement(327371..328486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps1a"
FT                   /gene_synonym="rpsA1"
FT                   /locus_tag="P9211_03471"
FT                   /product="30S ribosomal protein S1-like protein A"
FT                   /note="COG1098 Predicted RNA binding protein (contains
FT                   ribosomal protein S1 domain) [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08278"
FT                   /db_xref="GOA:A9BDW8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDW8"
FT                   /protein_id="ABX08278.1"
FT   gene            complement(328590..329063)
FT                   /locus_tag="P9211_03481"
FT   CDS_pept        complement(328590..329063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03481"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="consists of a Zn-ribbon and ATP-cone domains;
FT                   COG1327 Predicted transcriptional regulator, consists of a
FT                   Zn-ribbon and ATP-cone domains [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08279"
FT                   /db_xref="GOA:A9BDW9"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDW9"
FT                   /protein_id="ABX08279.1"
FT   gene            complement(329284..329379)
FT                   /gene="psbT"
FT                   /locus_tag="P9211_03491"
FT   CDS_pept        complement(329284..329379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbT"
FT                   /locus_tag="P9211_03491"
FT                   /product="Photosystem II PsbT protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08280"
FT                   /db_xref="GOA:A9BDX0"
FT                   /db_xref="InterPro:IPR001743"
FT                   /db_xref="InterPro:IPR037268"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDX0"
FT                   /protein_id="ABX08280.1"
FT                   /translation="MEAFSYTLLMALAAVTLFFAVAFRDPPKFDK"
FT   gene            complement(329417..330973)
FT                   /gene="psbB"
FT                   /locus_tag="P9211_03501"
FT   CDS_pept        complement(329417..330973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbB"
FT                   /locus_tag="P9211_03501"
FT                   /product="Photosystem II PsbB protein (CP47)"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08281"
FT                   /db_xref="GOA:A9BDX1"
FT                   /db_xref="InterPro:IPR000932"
FT                   /db_xref="InterPro:IPR017486"
FT                   /db_xref="InterPro:IPR036001"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDX1"
FT                   /protein_id="ABX08281.1"
FT                   A"
FT   gene            331216..331578
FT                   /gene="fdx"
FT                   /locus_tag="P9211_03511"
FT   CDS_pept        331216..331578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="P9211_03511"
FT                   /product="possible ferredoxin"
FT                   /note="COG633 Ferredoxin [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08282"
FT                   /db_xref="GOA:A9BDX2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDX2"
FT                   /protein_id="ABX08282.1"
FT                   NSKALIQAALGKDLPT"
FT   gene            332031..332477
FT                   /locus_tag="P9211_03521"
FT   CDS_pept        332031..332477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03521"
FT                   /product="Predicted thioesterase"
FT                   /note="COG824 Predicted thioesterase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08283"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDX3"
FT                   /protein_id="ABX08283.1"
FT   gene            332481..333362
FT                   /gene="hemK"
FT                   /locus_tag="P9211_03531"
FT   CDS_pept        332481..333362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="P9211_03531"
FT                   /product="putative protein methyltransferase"
FT                   /EC_number=""
FT                   /note="COG2890 Methylase of polypeptide chain release
FT                   factors [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08284"
FT                   /db_xref="GOA:A9BDX4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDX4"
FT                   /protein_id="ABX08284.1"
FT                   EGVRRFAIGRKS"
FT   gene            333383..333973
FT                   /gene="sua5"
FT                   /locus_tag="P9211_03541"
FT   CDS_pept        333383..333973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sua5"
FT                   /locus_tag="P9211_03541"
FT                   /product="Putative translation factor (SUA5)"
FT                   /note="COG9 Putative translation factor (SUA5)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08285"
FT                   /db_xref="GOA:A9BDX5"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDX5"
FT                   /protein_id="ABX08285.1"
FT   gene            333973..334143
FT                   /locus_tag="P9211_03551"
FT   CDS_pept        333973..334143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03551"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08286"
FT                   /db_xref="GOA:A9BDX6"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDX6"
FT                   /protein_id="ABX08286.1"
FT                   LLSGSQQSKNF"
FT   gene            complement(334152..334223)
FT                   /locus_tag="P9211_tRNAThrVIMSS1309356"
FT                   /note="tRNA-Thr"
FT   tRNA            complement(334152..334223)
FT                   /locus_tag="P9211_tRNAThrVIMSS1309356"
FT                   /product="tRNA-Thr"
FT   gene            complement(334356..334667)
FT                   /gene="minE"
FT                   /locus_tag="P9211_03561"
FT   CDS_pept        complement(334356..334667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="P9211_03561"
FT                   /product="possible septum site-determining protein MinE"
FT                   /note="COG851 Septum formation topological specificity
FT                   factor [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08287"
FT                   /db_xref="GOA:A9BDX7"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDX7"
FT                   /protein_id="ABX08287.1"
FT   gene            complement(334672..335487)
FT                   /gene="minD"
FT                   /locus_tag="P9211_03571"
FT   CDS_pept        complement(334672..335487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="P9211_03571"
FT                   /product="putative septum site-determining protein MinD"
FT                   /EC_number=""
FT                   /note="COG2894 Septum formation inhibitor-activating ATPase
FT                   [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08288"
FT                   /db_xref="GOA:A9BDX8"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDX8"
FT                   /protein_id="ABX08288.1"
FT   gene            complement(335628..336269)
FT                   /gene="minC"
FT                   /locus_tag="P9211_03581"
FT   CDS_pept        complement(335628..336269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="P9211_03581"
FT                   /product="possible septum site-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08289"
FT                   /db_xref="GOA:A9BDX9"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDX9"
FT                   /protein_id="ABX08289.1"
FT   gene            complement(336304..337560)
FT                   /locus_tag="P9211_03591"
FT   CDS_pept        complement(336304..337560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03591"
FT                   /product="HD superfamily phosphohydrolase"
FT                   /note="COG1078 HD superfamily phosphohydrolases [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08290"
FT                   /db_xref="GOA:A9BDY0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDY0"
FT                   /protein_id="ABX08290.1"
FT   gene            complement(337571..338881)
FT                   /locus_tag="P9211_03601"
FT   CDS_pept        complement(337571..338881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03601"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number=""
FT                   /note="COG793 Periplasmic protease [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03601"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08291"
FT                   /db_xref="GOA:A9BDY1"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDY1"
FT                   /protein_id="ABX08291.1"
FT   gene            338958..339614
FT                   /gene="petB"
FT                   /locus_tag="P9211_03611"
FT   CDS_pept        338958..339614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="P9211_03611"
FT                   /product="Cytochrome b6"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03611"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08292"
FT                   /db_xref="GOA:A9BDY2"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR023530"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDY2"
FT                   /protein_id="ABX08292.1"
FT   gene            339677..340159
FT                   /gene="petD"
FT                   /locus_tag="P9211_03621"
FT   CDS_pept        339677..340159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petD"
FT                   /locus_tag="P9211_03621"
FT                   /product="PetD protein (subunit IV of the Cytochrome b6f
FT                   complex)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03621"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08293"
FT                   /db_xref="GOA:A9BDY3"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR005870"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDY3"
FT                   /protein_id="ABX08293.1"
FT   gene            complement(340145..341599)
FT                   /locus_tag="P9211_03631"
FT   CDS_pept        complement(340145..341599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03631"
FT                   /product="putative neutral invertase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03631"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08294"
FT                   /db_xref="GOA:A9BDY4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDY4"
FT                   /protein_id="ABX08294.1"
FT   gene            342283..343747
FT                   /locus_tag="P9211_rrsVIMSS1309438"
FT   rRNA            342283..343747
FT                   /locus_tag="P9211_rrsVIMSS1309438"
FT                   /product="16S ribosomal RNA"
FT   gene            343926..343999
FT                   /locus_tag="P9211_tRNAIleVIMSS1309371"
FT                   /note="tRNA-Ile"
FT   tRNA            343926..343999
FT                   /locus_tag="P9211_tRNAIleVIMSS1309371"
FT                   /product="tRNA-Ile"
FT   gene            344009..344081
FT                   /locus_tag="P9211_tRNAAlaVIMSS1309372"
FT                   /note="tRNA-Ala"
FT   tRNA            344009..344081
FT                   /locus_tag="P9211_tRNAAlaVIMSS1309372"
FT                   /product="tRNA-Ala"
FT   gene            344441..347316
FT                   /locus_tag="P9211_rrlVIMSS1365801"
FT   rRNA            344441..347316
FT                   /locus_tag="P9211_rrlVIMSS1365801"
FT                   /product="23S ribosomal RNA"
FT   gene            347397..347512
FT                   /gene="rrf"
FT                   /locus_tag="P9211_rrfVIMSS1309439"
FT   rRNA            347397..347512
FT                   /gene="rrf"
FT                   /locus_tag="P9211_rrfVIMSS1309439"
FT                   /product="rrf 5S ribosomal RNA"
FT   gene            complement(347587..348447)
FT                   /gene="mutM"
FT                   /locus_tag="P9211_03641"
FT   CDS_pept        complement(347587..348447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="P9211_03641"
FT                   /product="Formamidopyrimidine-DNA glycolase (FAPY-DNA
FT                   glycolase)"
FT                   /EC_number=""
FT                   /note="COG266 Formamidopyrimidine-DNA glycosylase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03641"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08295"
FT                   /db_xref="GOA:A9BDY5"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDY5"
FT                   /protein_id="ABX08295.1"
FT                   PNCQN"
FT   gene            complement(348453..348662)
FT                   /gene="psaE"
FT                   /locus_tag="P9211_03651"
FT   CDS_pept        complement(348453..348662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaE"
FT                   /locus_tag="P9211_03651"
FT                   /product="Photosystem I PsaE protein (subunit IV)"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03651"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08296"
FT                   /db_xref="GOA:A9BDY6"
FT                   /db_xref="InterPro:IPR003375"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BDY6"
FT                   /protein_id="ABX08296.1"
FT   gene            348754..349815
FT                   /locus_tag="P9211_03661"
FT   CDS_pept        348754..349815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03661"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03661"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08297"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDY7"
FT                   /protein_id="ABX08297.1"
FT                   EESPDHIEPPIIS"
FT   gene            complement(349855..350718)
FT                   /locus_tag="P9211_03671"
FT   CDS_pept        complement(349855..350718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03671"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03671"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08298"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDY8"
FT                   /protein_id="ABX08298.1"
FT                   LDDLCR"
FT   gene            complement(350808..352157)
FT                   /locus_tag="P9211_03681"
FT   CDS_pept        complement(350808..352157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03681"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03681"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08299"
FT                   /db_xref="GOA:A9BDY9"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDY9"
FT                   /protein_id="ABX08299.1"
FT   gene            352295..353035
FT                   /locus_tag="P9211_03691"
FT   CDS_pept        352295..353035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03691"
FT                   /product="Hypothetical protein"
FT                   /note="COG398 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03691"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08300"
FT                   /db_xref="GOA:A9BDZ0"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDZ0"
FT                   /protein_id="ABX08300.1"
FT   gene            complement(353131..353532)
FT                   /locus_tag="P9211_03701"
FT   CDS_pept        complement(353131..353532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03701"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03701"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08301"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDZ1"
FT                   /protein_id="ABX08301.1"
FT   gene            complement(353630..353851)
FT                   /locus_tag="P9211_03711"
FT   CDS_pept        complement(353630..353851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03711"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03711"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08302"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDZ2"
FT                   /protein_id="ABX08302.1"
FT   gene            353937..354368
FT                   /locus_tag="P9211_03721"
FT   CDS_pept        353937..354368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03721"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03721"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08303"
FT                   /db_xref="GOA:A9BDZ3"
FT                   /db_xref="InterPro:IPR008164"
FT                   /db_xref="InterPro:IPR022196"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDZ3"
FT                   /protein_id="ABX08303.1"
FT   gene            complement(354562..355191)
FT                   /gene="hupE"
FT                   /locus_tag="P9211_03731"
FT   CDS_pept        complement(354562..355191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupE"
FT                   /locus_tag="P9211_03731"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03731"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08304"
FT                   /db_xref="GOA:A9BDZ4"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDZ4"
FT                   /protein_id="ABX08304.1"
FT   gene            355457..355831
FT                   /locus_tag="P9211_03741"
FT   CDS_pept        355457..355831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03741"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03741"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08305"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDZ5"
FT                   /protein_id="ABX08305.1"
FT   gene            355895..356046
FT                   /pseudo
FT                   /locus_tag="P9211_pseudoVIMSS1362684"
FT                   /note="frameshift; Pseudogene derived from NATL1_00671"
FT   gene            complement(356390..356692)
FT                   /locus_tag="P9211_03751"
FT   CDS_pept        complement(356390..356692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03751"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03751"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08306"
FT                   /db_xref="GOA:A9BDZ6"
FT                   /db_xref="InterPro:IPR006241"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDZ6"
FT                   /protein_id="ABX08306.1"
FT   gene            complement(356806..357405)
FT                   /locus_tag="P9211_03761"
FT   CDS_pept        complement(356806..357405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03761"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03761"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08307"
FT                   /db_xref="GOA:A9BDZ7"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDZ7"
FT                   /protein_id="ABX08307.1"
FT   gene            357556..357720
FT                   /locus_tag="P9211_03771"
FT   CDS_pept        357556..357720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03771"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03771"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08308"
FT                   /db_xref="GOA:A9BDZ8"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDZ8"
FT                   /protein_id="ABX08308.1"
FT                   KKDFRKITL"
FT   gene            358218..358373
FT                   /locus_tag="P9211_03781"
FT   CDS_pept        358218..358373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03781"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03781"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08309"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDZ9"
FT                   /protein_id="ABX08309.1"
FT                   HALVGT"
FT   gene            complement(358355..358426)
FT                   /locus_tag="P9211_tRNAThrVIMSS1309355"
FT                   /note="tRNA-Thr"
FT   tRNA            complement(358355..358426)
FT                   /locus_tag="P9211_tRNAThrVIMSS1309355"
FT                   /product="tRNA-Thr"
FT   gene            359041..359274
FT                   /locus_tag="P9211_03791"
FT   CDS_pept        359041..359274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03791"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03791"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08310"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE00"
FT                   /protein_id="ABX08310.1"
FT   gene            359378..360502
FT                   /locus_tag="P9211_03801"
FT   CDS_pept        359378..360502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03801"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03801"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08311"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE01"
FT                   /protein_id="ABX08311.1"
FT   gene            complement(360599..361582)
FT                   /locus_tag="P9211_03811"
FT   CDS_pept        complement(360599..361582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03811"
FT                   /product="Site-specific recombinase XerD"
FT                   /note="COG4974 Site-specific recombinase XerD [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03811"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08312"
FT                   /db_xref="GOA:A9BE02"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE02"
FT                   /protein_id="ABX08312.1"
FT   gene            361586..361741
FT                   /locus_tag="P9211_03821"
FT   CDS_pept        361586..361741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03821"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03821"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08313"
FT                   /db_xref="UniProtKB/TrEMBL:A9BDZ9"
FT                   /protein_id="ABX08313.1"
FT                   HALVGT"
FT   gene            complement(361723..361794)
FT                   /locus_tag="P9211_tRNAThrVIMSS1309354"
FT                   /note="tRNA-Thr"
FT   tRNA            complement(361723..361794)
FT                   /locus_tag="P9211_tRNAThrVIMSS1309354"
FT                   /product="tRNA-Thr"
FT   gene            complement(361801..361885)
FT                   /locus_tag="P9211_tRNATyrVIMSS1309353"
FT                   /note="tRNA-Tyr"
FT   tRNA            complement(361801..361885)
FT                   /locus_tag="P9211_tRNATyrVIMSS1309353"
FT                   /product="tRNA-Tyr"
FT   gene            361993..362439
FT                   /gene="aroQ"
FT                   /locus_tag="P9211_03831"
FT   CDS_pept        361993..362439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="P9211_03831"
FT                   /product="Dehydroquinase class II"
FT                   /EC_number=""
FT                   /note="COG757 3-dehydroquinate dehydratase II [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03831"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08314"
FT                   /db_xref="GOA:A9BE04"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE04"
FT                   /protein_id="ABX08314.1"
FT   gene            362439..363053
FT                   /gene="miaE"
FT                   /locus_tag="P9211_03841"
FT   CDS_pept        362439..363053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaE"
FT                   /locus_tag="P9211_03841"
FT                   /product="putative tRNA-(MS[2]IO[6]A)-hydroxylase-like
FT                   protein"
FT                   /note="COG4445 Hydroxylase for synthesis of
FT                   2-methylthio-cis-ribozeatin in tRNA [Nucleotide transport
FT                   and metabolism / Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03841"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08315"
FT                   /db_xref="GOA:A9BE05"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE05"
FT                   /protein_id="ABX08315.1"
FT   gene            363098..363919
FT                   /gene="cobI/cbiL"
FT                   /locus_tag="P9211_03851"
FT   CDS_pept        363098..363919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobI/cbiL"
FT                   /locus_tag="P9211_03851"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /EC_number=""
FT                   /note="COG2243 Precorrin-2 methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03851"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08316"
FT                   /db_xref="GOA:A9BE06"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE06"
FT                   /protein_id="ABX08316.1"
FT   gene            complement(363929..364138)
FT                   /locus_tag="P9211_03861"
FT   CDS_pept        complement(363929..364138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03861"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03861"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08317"
FT                   /db_xref="GOA:A9BE07"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE07"
FT                   /protein_id="ABX08317.1"
FT   gene            364193..364654
FT                   /locus_tag="P9211_03871"
FT   CDS_pept        364193..364654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03871"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03871"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08318"
FT                   /db_xref="InterPro:IPR014952"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE08"
FT                   /protein_id="ABX08318.1"
FT   gene            364795..366165
FT                   /locus_tag="P9211_03881"
FT   CDS_pept        364795..366165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03881"
FT                   /product="GTP-binding protein (HSR1-related)"
FT                   /EC_number=""
FT                   /note="COG1160 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03881"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08319"
FT                   /db_xref="GOA:A9BE09"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE09"
FT                   /protein_id="ABX08319.1"
FT   gene            366169..367086
FT                   /gene="cbiQ"
FT                   /locus_tag="P9211_03891"
FT   CDS_pept        366169..367086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="P9211_03891"
FT                   /product="possible cobalt transport protein"
FT                   /note="COG619 ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters [Inorganic ion
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03891"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08320"
FT                   /db_xref="GOA:A9BE10"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE10"
FT                   /protein_id="ABX08320.1"
FT   gene            367179..367451
FT                   /locus_tag="P9211_03901"
FT   CDS_pept        367179..367451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03901"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03901"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08321"
FT                   /db_xref="InterPro:IPR021926"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE11"
FT                   /protein_id="ABX08321.1"
FT   gene            367459..368100
FT                   /locus_tag="P9211_03911"
FT   CDS_pept        367459..368100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03911"
FT                   /product="Predicted enzyme with a TIM-barrel fold"
FT                   /note="COG325 Predicted enzyme with a TIM-barrel fold
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03911"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08322"
FT                   /db_xref="GOA:A9BE12"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE12"
FT                   /protein_id="ABX08322.1"
FT   gene            368253..368831
FT                   /locus_tag="P9211_03921"
FT   CDS_pept        368253..368831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03921"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG1799 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03921"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08323"
FT                   /db_xref="GOA:A9BE13"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE13"
FT                   /protein_id="ABX08323.1"
FT   gene            368840..369670
FT                   /gene="proC"
FT                   /locus_tag="P9211_03931"
FT   CDS_pept        368840..369670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="P9211_03931"
FT                   /product="Delta 1-pyrroline-5-carboxylate reductase"
FT                   /EC_number=""
FT                   /note="COG345 Pyrroline-5-carboxylate reductase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03931"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08324"
FT                   /db_xref="GOA:A9BE14"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE14"
FT                   /protein_id="ABX08324.1"
FT   gene            complement(369573..370838)
FT                   /locus_tag="P9211_03941"
FT   CDS_pept        complement(369573..370838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03941"
FT                   /product="possible Glycosyl transferase, group 1"
FT                   /note="COG438 Glycosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03941"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08325"
FT                   /db_xref="GOA:A9BE15"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE15"
FT                   /protein_id="ABX08325.1"
FT   gene            complement(370876..372174)
FT                   /locus_tag="P9211_03951"
FT   CDS_pept        complement(370876..372174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_03951"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03951"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08326"
FT                   /db_xref="GOA:A9BE16"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE16"
FT                   /protein_id="ABX08326.1"
FT   gene            complement(372187..372987)
FT                   /gene="recO"
FT                   /locus_tag="P9211_03961"
FT   CDS_pept        complement(372187..372987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="P9211_03961"
FT                   /product="possible Recombination protein O (RecO)"
FT                   /note="COG1381 Recombinational DNA repair protein (RecF
FT                   pathway) [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03961"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08327"
FT                   /db_xref="GOA:A9BE17"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE17"
FT                   /protein_id="ABX08327.1"
FT   gene            complement(372984..373667)
FT                   /gene="deoC"
FT                   /locus_tag="P9211_03971"
FT   CDS_pept        complement(372984..373667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="P9211_03971"
FT                   /product="Putative deoxyribose-phosphate aldolase"
FT                   /EC_number=""
FT                   /note="COG274 Deoxyribose-phosphate aldolase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03971"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08328"
FT                   /db_xref="GOA:A9BE18"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE18"
FT                   /protein_id="ABX08328.1"
FT                   KNKNR"
FT   gene            complement(373679..374272)
FT                   /gene="lrtA"
FT                   /locus_tag="P9211_03981"
FT   CDS_pept        complement(373679..374272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrtA"
FT                   /locus_tag="P9211_03981"
FT                   /product="light repressed protein A-like protein"
FT                   /note="COG1544 Ribosome-associated protein Y (PSrp-1)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03981"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08329"
FT                   /db_xref="GOA:A9BE19"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE19"
FT                   /protein_id="ABX08329.1"
FT   gene            374255..374962
FT                   /gene="lipB"
FT                   /locus_tag="P9211_03991"
FT   CDS_pept        374255..374962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="P9211_03991"
FT                   /product="putative lipoate-protein ligase B"
FT                   /EC_number=""
FT                   /note="COG321 Lipoate-protein ligase B [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_03991"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08330"
FT                   /db_xref="GOA:A9BE20"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE20"
FT                   /protein_id="ABX08330.1"
FT                   PFIKKSLTERFGL"
FT   gene            375039..377033
FT                   /gene="fadD"
FT                   /locus_tag="P9211_04001"
FT   CDS_pept        375039..377033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="P9211_04001"
FT                   /product="putative long-chain-fatty-acid--CoA ligase"
FT                   /EC_number=""
FT                   /note="COG1022 Long-chain acyl-CoA synthetases
FT                   (AMP-forming) [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08331"
FT                   /db_xref="GOA:A9BE21"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE21"
FT                   /protein_id="ABX08331.1"
FT   gene            377093..377536
FT                   /locus_tag="P9211_04011"
FT   CDS_pept        377093..377536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08332"
FT                   /db_xref="InterPro:IPR021297"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE22"
FT                   /protein_id="ABX08332.1"
FT   gene            complement(377698..378447)
FT                   /locus_tag="P9211_04021"
FT   CDS_pept        complement(377698..378447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04021"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08333"
FT                   /db_xref="GOA:A9BE23"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE23"
FT                   /protein_id="ABX08333.1"
FT   gene            378671..380041
FT                   /gene="odhB"
FT                   /locus_tag="P9211_04031"
FT   CDS_pept        378671..380041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="odhB"
FT                   /locus_tag="P9211_04031"
FT                   /product="Dihydrolipoamide acetyltransferase component (E2)
FT                   of pyruvate dehydrogenase complex"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08334"
FT                   /db_xref="GOA:A9BE24"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE24"
FT                   /protein_id="ABX08334.1"
FT   gene            380097..381224
FT                   /gene="queA"
FT                   /locus_tag="P9211_04041"
FT   CDS_pept        380097..381224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="P9211_04041"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="COG809
FT                   S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
FT                   (queuine synthetase) [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08335"
FT                   /db_xref="GOA:A9BE25"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE25"
FT                   /protein_id="ABX08335.1"
FT   gene            complement(381199..382185)
FT                   /locus_tag="P9211_04051"
FT   CDS_pept        complement(381199..382185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04051"
FT                   /product="O-acetylserine (thiol)-lyase A"
FT                   /EC_number=""
FT                   /note="COG31 Cysteine synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08336"
FT                   /db_xref="GOA:A9BE26"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE26"
FT                   /protein_id="ABX08336.1"
FT   gene            complement(382274..383746)
FT                   /locus_tag="P9211_04061"
FT   CDS_pept        complement(382274..383746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04061"
FT                   /product="possible Cystathionine gamma-synthase"
FT                   /EC_number=""
FT                   /note="COG626 Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08337"
FT                   /db_xref="GOA:A9BE27"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE27"
FT                   /protein_id="ABX08337.1"
FT   gene            complement(383743..384912)
FT                   /gene="metB"
FT                   /locus_tag="P9211_04071"
FT   CDS_pept        complement(383743..384912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="P9211_04071"
FT                   /product="putative Cystathionine gamma-synthase"
FT                   /EC_number=""
FT                   /note="COG626 Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08338"
FT                   /db_xref="GOA:A9BE28"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE28"
FT                   /protein_id="ABX08338.1"
FT   gene            complement(385033..385641)
FT                   /gene="rpsD"
FT                   /locus_tag="P9211_04081"
FT   CDS_pept        complement(385033..385641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="P9211_04081"
FT                   /product="30S ribosomal protein S4"
FT                   /note="COG522 Ribosomal protein S4 and related proteins
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08339"
FT                   /db_xref="GOA:A9BE29"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE29"
FT                   /protein_id="ABX08339.1"
FT   gene            385714..385980
FT                   /locus_tag="P9211_04091"
FT   CDS_pept        385714..385980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04091"
FT                   /product="ribonuclease P"
FT                   /EC_number=""
FT                   /note="COG759 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08340"
FT                   /db_xref="GOA:A9BE30"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE30"
FT                   /protein_id="ABX08340.1"
FT   gene            385980..386291
FT                   /locus_tag="P9211_04101"
FT   CDS_pept        385980..386291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04101"
FT                   /product="Thioredoxin family protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08341"
FT                   /db_xref="GOA:A9BE31"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE31"
FT                   /protein_id="ABX08341.1"
FT   gene            386313..387830
FT                   /gene="murE"
FT                   /locus_tag="P9211_04111"
FT   CDS_pept        386313..387830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="P9211_04111"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /EC_number=""
FT                   /note="COG769 UDP-N-acetylmuramyl tripeptide synthase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08342"
FT                   /db_xref="GOA:A9BE32"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE32"
FT                   /protein_id="ABX08342.1"
FT   gene            complement(387831..389006)
FT                   /locus_tag="P9211_04121"
FT   CDS_pept        complement(387831..389006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04121"
FT                   /product="putative L-cysteine/cystine lyase"
FT                   /note="COG520 Selenocysteine lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08343"
FT                   /db_xref="GOA:A9BE33"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE33"
FT                   /protein_id="ABX08343.1"
FT   gene            complement(389246..389467)
FT                   /locus_tag="P9211_04131"
FT   CDS_pept        complement(389246..389467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04131"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08344"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE34"
FT                   /protein_id="ABX08344.1"
FT   gene            complement(389670..390395)
FT                   /locus_tag="P9211_04141"
FT   CDS_pept        complement(389670..390395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04141"
FT                   /product="putative methyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08345"
FT                   /db_xref="GOA:A9BE35"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE35"
FT                   /protein_id="ABX08345.1"
FT   gene            complement(390599..390766)
FT                   /locus_tag="P9211_04151"
FT   CDS_pept        complement(390599..390766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04151"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08346"
FT                   /db_xref="InterPro:IPR025458"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE36"
FT                   /protein_id="ABX08346.1"
FT                   LKYRGVDYQK"
FT   gene            complement(391571..391816)
FT                   /locus_tag="P9211_04161"
FT   CDS_pept        complement(391571..391816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04161"
FT                   /product="NifU-like protein"
FT                   /note="COG694 Thioredoxin-like proteins and domains
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08347"
FT                   /db_xref="GOA:A9BE37"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE37"
FT                   /protein_id="ABX08347.1"
FT   gene            391892..393394
FT                   /gene="mqo"
FT                   /locus_tag="P9211_04171"
FT   CDS_pept        391892..393394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqo"
FT                   /locus_tag="P9211_04171"
FT                   /product="putative malate/quinone oxidoreductase"
FT                   /EC_number=""
FT                   /note="COG579 Predicted dehydrogenase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08348"
FT                   /db_xref="GOA:A9BE38"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE38"
FT                   /protein_id="ABX08348.1"
FT   gene            393475..395283
FT                   /gene="lepA"
FT                   /locus_tag="P9211_04181"
FT   CDS_pept        393475..395283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="P9211_04181"
FT                   /product="GTP-binding protein LepA"
FT                   /EC_number=""
FT                   /note="COG481 Membrane GTPase LepA [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08349"
FT                   /db_xref="GOA:A9BE39"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027518"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE39"
FT                   /protein_id="ABX08349.1"
FT   gene            complement(395255..395473)
FT                   /locus_tag="P9211_04191"
FT   CDS_pept        complement(395255..395473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04191"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08350"
FT                   /db_xref="GOA:A9BE40"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE40"
FT                   /protein_id="ABX08350.1"
FT   gene            395582..396433
FT                   /gene="dppC"
FT                   /locus_tag="P9211_04201"
FT   CDS_pept        395582..396433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="P9211_04201"
FT                   /product="putative ABC transporter of oligopeptides"
FT                   /note="COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components [Amino acid
FT                   transport and metabolism / Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08351"
FT                   /db_xref="GOA:A9BE41"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE41"
FT                   /protein_id="ABX08351.1"
FT                   GI"
FT   gene            complement(396472..397161)
FT                   /locus_tag="P9211_04211"
FT   CDS_pept        complement(396472..397161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04211"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /EC_number=""
FT                   /note="COG566 rRNA methylases [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08352"
FT                   /db_xref="GOA:A9BE42"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE42"
FT                   /protein_id="ABX08352.1"
FT                   RAIKVRC"
FT   gene            397512..398810
FT                   /gene="sun"
FT                   /locus_tag="P9211_04221"
FT   CDS_pept        397512..398810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="P9211_04221"
FT                   /product="Sun protein (Fmu protein)"
FT                   /note="COG144 tRNA and rRNA cytosine-C5-methylases
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08353"
FT                   /db_xref="GOA:A9BE43"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE43"
FT                   /protein_id="ABX08353.1"
FT   gene            complement(398829..400637)
FT                   /gene="mrcB"
FT                   /locus_tag="P9211_04231"
FT   CDS_pept        complement(398829..400637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="P9211_04231"
FT                   /product="putative penicillin binding protein"
FT                   /EC_number=""
FT                   /note="COG744 Membrane carboxypeptidase (penicillin-binding
FT                   protein) [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08354"
FT                   /db_xref="GOA:A9BE44"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE44"
FT                   /protein_id="ABX08354.1"
FT   gene            complement(400637..401587)
FT                   /gene="chlG"
FT                   /locus_tag="P9211_04241"
FT   CDS_pept        complement(400637..401587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlG"
FT                   /locus_tag="P9211_04241"
FT                   /product="chlorophyll synthase 33 kD subunit"
FT                   /EC_number=""
FT                   /note="COG382 4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08355"
FT                   /db_xref="GOA:A9BE45"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="InterPro:IPR011799"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE45"
FT                   /protein_id="ABX08355.1"
FT   gene            complement(401599..401856)
FT                   /locus_tag="P9211_04251"
FT   CDS_pept        complement(401599..401856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08356"
FT                   /db_xref="InterPro:IPR021291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE46"
FT                   /protein_id="ABX08356.1"
FT   gene            401883..402659
FT                   /gene="hisF"
FT                   /locus_tag="P9211_04261"
FT   CDS_pept        401883..402659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="P9211_04261"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   HisF (cyclase)"
FT                   /note="COG107 Imidazoleglycerol-phosphate synthase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08357"
FT                   /db_xref="GOA:A9BE47"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE47"
FT                   /protein_id="ABX08357.1"
FT   gene            402774..403475
FT                   /gene="ubiE"
FT                   /locus_tag="P9211_04271"
FT   CDS_pept        402774..403475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="P9211_04271"
FT                   /product="Ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="COG2226 Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08358"
FT                   /db_xref="GOA:A9BE48"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032904"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE48"
FT                   /protein_id="ABX08358.1"
FT                   GAQMGALLLQA"
FT   gene            complement(403484..404014)
FT                   /locus_tag="P9211_04281"
FT   CDS_pept        complement(403484..404014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08359"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE49"
FT                   /protein_id="ABX08359.1"
FT                   LCRRKDLFEKKNP"
FT   gene            404036..404884
FT                   /gene="pspA"
FT                   /locus_tag="P9211_04291"
FT   CDS_pept        404036..404884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="P9211_04291"
FT                   /product="Phage shock protein A (IM30), suppresses
FT                   sigma54-dependent transcription"
FT                   /note="COG1842 Phage shock protein A (IM30), suppresses
FT                   sigma54-dependent transcription [Transcription / Signal
FT                   transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08360"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE50"
FT                   /protein_id="ABX08360.1"
FT                   N"
FT   gene            404946..405704
FT                   /gene="birA"
FT                   /locus_tag="P9211_04301"
FT   CDS_pept        404946..405704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="P9211_04301"
FT                   /product="putative Biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number=""
FT                   /note="COG340 Biotin-(acetyl-CoA carboxylase) ligase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08361"
FT                   /db_xref="GOA:A9BE51"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE51"
FT                   /protein_id="ABX08361.1"
FT   gene            complement(405710..406408)
FT                   /gene="salX"
FT                   /locus_tag="P9211_04311"
FT   CDS_pept        complement(405710..406408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="salX"
FT                   /locus_tag="P9211_04311"
FT                   /product="possible ABC transporter, ATP binding protein"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08362"
FT                   /db_xref="GOA:A9BE52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE52"
FT                   /protein_id="ABX08362.1"
FT                   FKDGKIIEIS"
FT   gene            complement(406401..407972)
FT                   /gene="ndhB"
FT                   /locus_tag="P9211_04321"
FT   CDS_pept        complement(406401..407972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhB"
FT                   /locus_tag="P9211_04321"
FT                   /product="putative NADH dehydrogenase (complex I) subunit
FT                   (chain 2)"
FT                   /EC_number=""
FT                   /note="COG1007 NADH:ubiquinone oxidoreductase subunit 2
FT                   (chain N) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08363"
FT                   /db_xref="GOA:A9BE53"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE53"
FT                   /protein_id="ABX08363.1"
FT                   GKGTIG"
FT   gene            408102..410801
FT                   /gene="topA"
FT                   /locus_tag="P9211_04331"
FT   CDS_pept        408102..410801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="P9211_04331"
FT                   /product="Prokaryotic DNA topoisomerase"
FT                   /EC_number=""
FT                   /note="COG550 Topoisomerase IA [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08364"
FT                   /db_xref="GOA:A9BE54"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE54"
FT                   /protein_id="ABX08364.1"
FT   gene            410801..411307
FT                   /locus_tag="P9211_04341"
FT   CDS_pept        410801..411307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08365"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE55"
FT                   /protein_id="ABX08365.1"
FT                   RSDKR"
FT   gene            411313..411990
FT                   /locus_tag="P9211_04351"
FT   CDS_pept        411313..411990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04351"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4241 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08366"
FT                   /db_xref="GOA:A9BE56"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE56"
FT                   /protein_id="ABX08366.1"
FT                   EPT"
FT   gene            411975..413177
FT                   /gene="cobT"
FT                   /locus_tag="P9211_04361"
FT   CDS_pept        411975..413177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="P9211_04361"
FT                   /product="NaMN:DMB phosphoribosyltransferase"
FT                   /note="COG2038 NaMN:DMB phosphoribosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08367"
FT                   /db_xref="GOA:A9BE57"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE57"
FT                   /protein_id="ABX08367.1"
FT                   G"
FT   gene            413207..414208
FT                   /locus_tag="P9211_04371"
FT   CDS_pept        413207..414208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08368"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE58"
FT                   /protein_id="ABX08368.1"
FT   gene            complement(414197..415333)
FT                   /locus_tag="P9211_04381"
FT   CDS_pept        complement(414197..415333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04381"
FT                   /product="Aldo/keto reductase family"
FT                   /EC_number=""
FT                   /note="COG1453 Predicted oxidoreductases of the aldo/keto
FT                   reductase family [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08369"
FT                   /db_xref="GOA:A9BE59"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE59"
FT                   /protein_id="ABX08369.1"
FT   gene            415730..416395
FT                   /gene="ribE"
FT                   /locus_tag="P9211_04391"
FT   CDS_pept        415730..416395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="P9211_04391"
FT                   /product="Putative Riboflavin synthase alpha chain"
FT                   /EC_number=""
FT                   /note="COG307 Riboflavin synthase alpha chain [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08370"
FT                   /db_xref="GOA:A9BE60"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE60"
FT                   /protein_id="ABX08370.1"
FT   gene            complement(416453..416815)
FT                   /locus_tag="P9211_04401"
FT   CDS_pept        complement(416453..416815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08371"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE61"
FT                   /protein_id="ABX08371.1"
FT                   KKDSGAISLLPMEKKS"
FT   gene            complement(416909..417529)
FT                   /gene="ctaE"
FT                   /locus_tag="P9211_04411"
FT   CDS_pept        complement(416909..417529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaE"
FT                   /locus_tag="P9211_04411"
FT                   /product="Cytochrome c oxidase, subunit III"
FT                   /EC_number=""
FT                   /note="COG1845 Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 3 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08372"
FT                   /db_xref="GOA:A9BE62"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE62"
FT                   /protein_id="ABX08372.1"
FT   gene            complement(417533..419191)
FT                   /gene="cyoB"
FT                   /locus_tag="P9211_04421"
FT   CDS_pept        complement(417533..419191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="P9211_04421"
FT                   /product="Cytochrome c oxidase, subunit I"
FT                   /EC_number=""
FT                   /note="COG843 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 1 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08373"
FT                   /db_xref="GOA:A9BE63"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE63"
FT                   /protein_id="ABX08373.1"
FT   gene            complement(419188..420063)
FT                   /gene="cyoA"
FT                   /locus_tag="P9211_04431"
FT   CDS_pept        complement(419188..420063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="P9211_04431"
FT                   /product="putative cytochrome c oxidase, subunit 2"
FT                   /EC_number=""
FT                   /note="COG1622 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 2 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08374"
FT                   /db_xref="GOA:A9BE64"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE64"
FT                   /protein_id="ABX08374.1"
FT                   KNAKKPDLEV"
FT   gene            complement(420033..420284)
FT                   /locus_tag="P9211_04441"
FT   CDS_pept        complement(420033..420284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04441"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08375"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE65"
FT                   /protein_id="ABX08375.1"
FT   gene            420326..421192
FT                   /gene="ctaA"
FT                   /locus_tag="P9211_04451"
FT   CDS_pept        420326..421192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="P9211_04451"
FT                   /product="Uncharacterized protein required for cytochrome
FT                   oxidase assembly"
FT                   /note="COG1612 Uncharacterized protein required for
FT                   cytochrome oxidase assembly [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08376"
FT                   /db_xref="GOA:A9BE66"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE66"
FT                   /protein_id="ABX08376.1"
FT                   AFEACHG"
FT   gene            421185..422186
FT                   /gene="cyoE"
FT                   /locus_tag="P9211_04461"
FT   CDS_pept        421185..422186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="P9211_04461"
FT                   /product="putative protoheme IX farnesyltransferase"
FT                   /note="COG109 Polyprenyltransferase (cytochrome oxidase
FT                   assembly factor) [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08377"
FT                   /db_xref="GOA:A9BE67"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE67"
FT                   /protein_id="ABX08377.1"
FT   gene            422267..423280
FT                   /gene="ccmA"
FT                   /locus_tag="P9211_04471"
FT   CDS_pept        422267..423280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="P9211_04471"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /EC_number=""
FT                   /note="COG1131 ABC-type multidrug transport system, ATPase
FT                   component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08378"
FT                   /db_xref="GOA:A9BE68"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE68"
FT                   /protein_id="ABX08378.1"
FT   gene            423346..424200
FT                   /locus_tag="P9211_04481"
FT   CDS_pept        423346..424200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04481"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /note="COG1682 ABC-type polysaccharide/polyol phosphate
FT                   export systems, permease component [Carbohydrate transport
FT                   and metabolism / Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08379"
FT                   /db_xref="GOA:A9BE69"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE69"
FT                   /protein_id="ABX08379.1"
FT                   KLV"
FT   gene            424205..424741
FT                   /locus_tag="P9211_04491"
FT   CDS_pept        424205..424741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04491"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08380"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE70"
FT                   /protein_id="ABX08380.1"
FT                   RRWLPSFEDNSIKAS"
FT   gene            complement(424806..426503)
FT                   /gene="groL"
FT                   /locus_tag="P9211_04501"
FT   CDS_pept        complement(424806..426503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="P9211_04501"
FT                   /product="GroEL2 protein (Chaperonin cpn60 2)"
FT                   /EC_number=""
FT                   /note="COG459 Chaperonin GroEL (HSP60 family)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08381"
FT                   /db_xref="GOA:A9BE71"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE71"
FT                   /protein_id="ABX08381.1"
FT   gene            426578..426808
FT                   /locus_tag="P9211_04511"
FT   CDS_pept        426578..426808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04511"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08382"
FT                   /db_xref="GOA:A9BE72"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE72"
FT                   /protein_id="ABX08382.1"
FT   gene            complement(426914..427075)
FT                   /locus_tag="P9211_04521"
FT   CDS_pept        complement(426914..427075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04521"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08383"
FT                   /db_xref="GOA:A9BE73"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE73"
FT                   /protein_id="ABX08383.1"
FT                   SILPQSLP"
FT   gene            427277..427579
FT                   /locus_tag="P9211_04531"
FT   CDS_pept        427277..427579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04531"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08384"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE74"
FT                   /protein_id="ABX08384.1"
FT   gene            complement(427659..428411)
FT                   /locus_tag="P9211_04541"
FT   CDS_pept        complement(427659..428411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04541"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number=""
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08385"
FT                   /db_xref="GOA:A9BE75"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE75"
FT                   /protein_id="ABX08385.1"
FT   gene            428534..429214
FT                   /gene="ispD"
FT                   /locus_tag="P9211_04551"
FT   CDS_pept        428534..429214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="P9211_04551"
FT                   /product="putative 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number=""
FT                   /note="COG1211 4-diphosphocytidyl-2-methyl-D-erithritol
FT                   synthase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08386"
FT                   /db_xref="GOA:A9BE76"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE76"
FT                   /protein_id="ABX08386.1"
FT                   KRQS"
FT   gene            complement(429195..430097)
FT                   /locus_tag="P9211_04561"
FT   CDS_pept        complement(429195..430097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04561"
FT                   /product="Putative carboxypeptidase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1619 Uncharacterized proteins, homologs of
FT                   microcin C7 resistance protein MccF [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08387"
FT                   /db_xref="GOA:A9BE77"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE77"
FT                   /protein_id="ABX08387.1"
FT   gene            complement(430100..430993)
FT                   /gene="ubiA"
FT                   /locus_tag="P9211_04571"
FT   CDS_pept        complement(430100..430993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="P9211_04571"
FT                   /product="probable 4-hydroxybenzoate-octaprenyltransferase"
FT                   /note="COG382 4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08388"
FT                   /db_xref="GOA:A9BE78"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE78"
FT                   /protein_id="ABX08388.1"
FT                   LLGSLFLLGLILSKVN"
FT   gene            431083..432702
FT                   /gene="ppx"
FT                   /locus_tag="P9211_04581"
FT   CDS_pept        431083..432702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="P9211_04581"
FT                   /product="putative exopolyphosphatase"
FT                   /EC_number=""
FT                   /note="COG248 Exopolyphosphatase [Nucleotide transport and
FT                   metabolism / Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08389"
FT                   /db_xref="GOA:A9BE79"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE79"
FT                   /protein_id="ABX08389.1"
FT   gene            complement(432699..433202)
FT                   /locus_tag="P9211_04591"
FT   CDS_pept        complement(432699..433202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08390"
FT                   /db_xref="GOA:A9BE80"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE80"
FT                   /protein_id="ABX08390.1"
FT                   TSKN"
FT   gene            complement(433241..433993)
FT                   /gene="cobM"
FT                   /locus_tag="P9211_04601"
FT   CDS_pept        complement(433241..433993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="P9211_04601"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number=""
FT                   /note="COG2875 Precorrin-4 methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04601"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08391"
FT                   /db_xref="GOA:A9BE81"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE81"
FT                   /protein_id="ABX08391.1"
FT   gene            complement(433990..434901)
FT                   /gene="lgt"
FT                   /locus_tag="P9211_04611"
FT   CDS_pept        complement(433990..434901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="P9211_04611"
FT                   /product="putative prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /note="COG682 Prolipoprotein diacylglyceryltransferase
FT                   [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04611"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08392"
FT                   /db_xref="GOA:A9BE82"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE82"
FT                   /protein_id="ABX08392.1"
FT   gene            complement(434931..435977)
FT                   /gene="petA"
FT                   /locus_tag="P9211_04621"
FT   CDS_pept        complement(434931..435977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="P9211_04621"
FT                   /product="Cytochrome f"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04621"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08393"
FT                   /db_xref="GOA:A9BE83"
FT                   /db_xref="InterPro:IPR002325"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR024058"
FT                   /db_xref="InterPro:IPR024094"
FT                   /db_xref="InterPro:IPR036826"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE83"
FT                   /protein_id="ABX08393.1"
FT                   KVQAAEGI"
FT   gene            complement(435907..436443)
FT                   /gene="petC"
FT                   /locus_tag="P9211_04631"
FT   CDS_pept        complement(435907..436443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="P9211_04631"
FT                   /product="Rieske iron-sulfur protein"
FT                   /EC_number=""
FT                   /note="COG723 Rieske Fe-S protein [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04631"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08394"
FT                   /db_xref="GOA:A9BE84"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023960"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE84"
FT                   /protein_id="ABX08394.1"
FT                   WAETDFRTGEKPWWT"
FT   gene            complement(436837..437631)
FT                   /gene="tatC"
FT                   /locus_tag="P9211_04641"
FT   CDS_pept        complement(436837..437631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="P9211_04641"
FT                   /product="protein secretion component, Tat family"
FT                   /note="COG805 Sec-independent protein secretion pathway
FT                   component TatC [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04641"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08395"
FT                   /db_xref="GOA:A9BE85"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE85"
FT                   /protein_id="ABX08395.1"
FT   gene            complement(437845..438150)
FT                   /locus_tag="P9211_04651"
FT   CDS_pept        complement(437845..438150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04651"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08396"
FT                   /db_xref="GOA:A9BE86"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE86"
FT                   /protein_id="ABX08396.1"
FT   gene            complement(438125..439864)
FT                   /locus_tag="P9211_04661"
FT   CDS_pept        complement(438125..439864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04661"
FT                   /product="possible secreted protein MPB70 precursor"
FT                   /note="COG1293 Predicted RNA-binding protein homologous to
FT                   eukaryotic snRNP [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04661"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08397"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE87"
FT                   /protein_id="ABX08397.1"
FT                   APS"
FT   gene            439929..440486
FT                   /gene="gmk"
FT                   /locus_tag="P9211_04671"
FT   CDS_pept        439929..440486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="P9211_04671"
FT                   /product="Guanylate kinase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG194 Guanylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04671"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08398"
FT                   /db_xref="GOA:A9BE88"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE88"
FT                   /protein_id="ABX08398.1"
FT   gene            complement(440501..440635)
FT                   /gene="psaJ"
FT                   /locus_tag="P9211_04681"
FT   CDS_pept        complement(440501..440635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaJ"
FT                   /locus_tag="P9211_04681"
FT                   /product="Photosystem I PsaJ protein (subunit IX)"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04681"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08399"
FT                   /db_xref="GOA:A9BE89"
FT                   /db_xref="InterPro:IPR002615"
FT                   /db_xref="InterPro:IPR036062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE89"
FT                   /protein_id="ABX08399.1"
FT   gene            complement(440691..441242)
FT                   /gene="psaF"
FT                   /locus_tag="P9211_04691"
FT   CDS_pept        complement(440691..441242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaF"
FT                   /locus_tag="P9211_04691"
FT                   /product="Photosystem I PsaF protein (subunit III)"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04691"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08400"
FT                   /db_xref="GOA:A9BE90"
FT                   /db_xref="InterPro:IPR003666"
FT                   /db_xref="InterPro:IPR036577"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE90"
FT                   /protein_id="ABX08400.1"
FT   gene            441304..442392
FT                   /gene="qri7"
FT                   /locus_tag="P9211_04701"
FT   CDS_pept        441304..442392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qri7"
FT                   /locus_tag="P9211_04701"
FT                   /product="probable o-sialoglycoprotein endopeptidase"
FT                   /EC_number=""
FT                   /note="COG533 Metal-dependent proteases with possible
FT                   chaperone activity [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04701"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08401"
FT                   /db_xref="GOA:A9BE91"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE91"
FT                   /protein_id="ABX08401.1"
FT   gene            442433..442609
FT                   /locus_tag="P9211_04711"
FT   CDS_pept        442433..442609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04711"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04711"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08402"
FT                   /db_xref="GOA:A9BE92"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE92"
FT                   /protein_id="ABX08402.1"
FT                   LGVGTLVLVNFFF"
FT   gene            442611..443180
FT                   /locus_tag="P9211_04721"
FT   CDS_pept        442611..443180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04721"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG4333 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04721"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08403"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE93"
FT                   /protein_id="ABX08403.1"
FT   gene            443387..444595
FT                   /gene="nhaP"
FT                   /locus_tag="P9211_04731"
FT   CDS_pept        443387..444595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaP"
FT                   /locus_tag="P9211_04731"
FT                   /product="putative Na+/H+ antiporter, CPA1 family"
FT                   /note="COG25 NhaP-type Na+/H+ and K+/H+ antiporters
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04731"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08404"
FT                   /db_xref="GOA:A9BE94"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE94"
FT                   /protein_id="ABX08404.1"
FT                   QTP"
FT   gene            complement(444602..446080)
FT                   /gene="gltX"
FT                   /locus_tag="P9211_04741"
FT   CDS_pept        complement(444602..446080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="P9211_04741"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG8 Glutamyl- and glutaminyl-tRNA synthetases
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04741"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08405"
FT                   /db_xref="GOA:A9BE95"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BE95"
FT                   /protein_id="ABX08405.1"
FT   gene            complement(446054..446127)
FT                   /locus_tag="P9211_tRNAAspVIMSS1309352"
FT                   /note="tRNA-Asp"
FT   tRNA            complement(446054..446127)
FT                   /locus_tag="P9211_tRNAAspVIMSS1309352"
FT                   /product="tRNA-Asp"
FT   gene            complement(446287..446541)
FT                   /locus_tag="P9211_04751"
FT   CDS_pept        complement(446287..446541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04751"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04751"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08406"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE96"
FT                   /protein_id="ABX08406.1"
FT   gene            complement(446512..446584)
FT                   /locus_tag="P9211_tRNATrpVIMSS1309351"
FT                   /note="tRNA-Trp"
FT   tRNA            complement(446512..446584)
FT                   /locus_tag="P9211_tRNATrpVIMSS1309351"
FT                   /product="tRNA-Trp"
FT   gene            complement(446647..447138)
FT                   /gene="rplS"
FT                   /locus_tag="P9211_04761"
FT   CDS_pept        complement(446647..447138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="P9211_04761"
FT                   /product="Ribosomal protein L19"
FT                   /note="COG335 Ribosomal protein L19 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04761"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08407"
FT                   /db_xref="GOA:A9BE97"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE97"
FT                   /protein_id="ABX08407.1"
FT                   "
FT   gene            447435..448277
FT                   /gene="map"
FT                   /locus_tag="P9211_04771"
FT   CDS_pept        447435..448277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="P9211_04771"
FT                   /product="putative methionine aminopeptidase"
FT                   /EC_number=""
FT                   /note="COG24 Methionine aminopeptidase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04771"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08408"
FT                   /db_xref="GOA:A9BE98"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE98"
FT                   /protein_id="ABX08408.1"
FT   gene            complement(448300..449073)
FT                   /locus_tag="P9211_04781"
FT   CDS_pept        complement(448300..449073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04781"
FT                   /product="Dehydrogenase with different specificities"
FT                   /note="related to short-chain alcohol dehydrogenases;
FT                   COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04781"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08409"
FT                   /db_xref="GOA:A9BE99"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BE99"
FT                   /protein_id="ABX08409.1"
FT   gene            449262..450353
FT                   /gene="pta"
FT                   /locus_tag="P9211_04791"
FT   CDS_pept        449262..450353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="P9211_04791"
FT                   /product="BioD-like N-terminal domain of
FT                   phosphotransacetylase"
FT                   /EC_number=""
FT                   /note="COG857 BioD-like N-terminal domain of
FT                   phosphotransacetylase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04791"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08410"
FT                   /db_xref="GOA:A9BEA0"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEA0"
FT                   /protein_id="ABX08410.1"
FT   gene            450393..450911
FT                   /locus_tag="P9211_04801"
FT   CDS_pept        450393..450911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04801"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08411"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEA1"
FT                   /protein_id="ABX08411.1"
FT                   KIVSLLFFD"
FT   gene            451026..451523
FT                   /locus_tag="P9211_04811"
FT   CDS_pept        451026..451523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04811"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG1666 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04811"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08412"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEA2"
FT                   /protein_id="ABX08412.1"
FT                   YR"
FT   gene            451715..451819
FT                   /locus_tag="P9211_04821"
FT   CDS_pept        451715..451819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04821"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04821"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08413"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEA3"
FT                   /protein_id="ABX08413.1"
FT   gene            451908..452711
FT                   /gene="hflC"
FT                   /locus_tag="P9211_04831"
FT   CDS_pept        451908..452711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="P9211_04831"
FT                   /product="Band 7 protein"
FT                   /note="COG330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04831"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08414"
FT                   /db_xref="GOA:A9BEA4"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEA4"
FT                   /protein_id="ABX08414.1"
FT   gene            complement(452725..454023)
FT                   /gene="hemL"
FT                   /locus_tag="P9211_04841"
FT   CDS_pept        complement(452725..454023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="P9211_04841"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number=""
FT                   /note="COG1 Glutamate-1-semialdehyde aminotransferase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04841"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08415"
FT                   /db_xref="GOA:A9BEA5"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEA5"
FT                   /protein_id="ABX08415.1"
FT   gene            complement(454353..455186)
FT                   /gene="xthA"
FT                   /locus_tag="P9211_04851"
FT   CDS_pept        complement(454353..455186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="P9211_04851"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number=""
FT                   /note="COG708 Exonuclease III [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04851"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08416"
FT                   /db_xref="GOA:A9BEA6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEA6"
FT                   /protein_id="ABX08416.1"
FT   gene            455240..455578
FT                   /locus_tag="P9211_04861"
FT   CDS_pept        455240..455578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04861"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04861"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08417"
FT                   /db_xref="GOA:A9BEA7"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEA7"
FT                   /protein_id="ABX08417.1"
FT                   EDTALPLN"
FT   gene            455640..456293
FT                   /locus_tag="P9211_04871"
FT   CDS_pept        455640..456293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04871"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04871"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08418"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEA8"
FT                   /protein_id="ABX08418.1"
FT   gene            456446..457678
FT                   /locus_tag="P9211_04881"
FT   CDS_pept        456446..457678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04881"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG1641 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04881"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08419"
FT                   /db_xref="GOA:A9BEA9"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEA9"
FT                   /protein_id="ABX08419.1"
FT                   SSFSPTEEWSE"
FT   gene            457675..458649
FT                   /locus_tag="P9211_04891"
FT   CDS_pept        457675..458649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04891"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04891"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08420"
FT                   /db_xref="GOA:A9BEB0"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEB0"
FT                   /protein_id="ABX08420.1"
FT   gene            complement(458661..460217)
FT                   /gene="thiP"
FT                   /locus_tag="P9211_04901"
FT   CDS_pept        complement(458661..460217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="P9211_04901"
FT                   /product="putative iron ABC transporter"
FT                   /note="COG1178 ABC-type Fe3+ transport system, permease
FT                   component [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04901"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08421"
FT                   /db_xref="GOA:A9BEB1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEB1"
FT                   /protein_id="ABX08421.1"
FT                   N"
FT   gene            complement(460223..460513)
FT                   /locus_tag="P9211_04911"
FT   CDS_pept        complement(460223..460513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04911"
FT                   /product="4a-hydroxytetrahydrobiopterin dehydratase (PCD)"
FT                   /EC_number=""
FT                   /note="COG2154 Pterin-4a-carbinolamine dehydratase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04911"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08422"
FT                   /db_xref="GOA:A9BEB2"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEB2"
FT                   /protein_id="ABX08422.1"
FT   gene            complement(460530..461168)
FT                   /locus_tag="P9211_04921"
FT   CDS_pept        complement(460530..461168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04921"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG432 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04921"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08423"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEB3"
FT                   /protein_id="ABX08423.1"
FT   gene            461541..463091
FT                   /locus_tag="P9211_04931"
FT   CDS_pept        461541..463091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04931"
FT                   /product="Carboxypeptidase Taq (M32) metallopeptidase"
FT                   /EC_number=""
FT                   /note="COG2317 Zn-dependent carboxypeptidase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04931"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08424"
FT                   /db_xref="GOA:A9BEB4"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEB4"
FT                   /protein_id="ABX08424.1"
FT   gene            463118..463705
FT                   /locus_tag="P9211_04941"
FT   CDS_pept        463118..463705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04941"
FT                   /product="putative inorganic pyrophosphatase"
FT                   /EC_number=""
FT                   /note="COG221 Inorganic pyrophosphatase [Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04941"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08425"
FT                   /db_xref="GOA:A9BEB5"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEB5"
FT                   /protein_id="ABX08425.1"
FT   gene            complement(463714..464664)
FT                   /gene="hemC"
FT                   /locus_tag="P9211_04951"
FT   CDS_pept        complement(463714..464664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="P9211_04951"
FT                   /product="Porphobilinogen deaminase"
FT                   /EC_number=""
FT                   /note="COG181 Porphobilinogen deaminase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04951"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08426"
FT                   /db_xref="GOA:A9BEB6"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEB6"
FT                   /protein_id="ABX08426.1"
FT   gene            complement(464840..466117)
FT                   /locus_tag="P9211_04961"
FT   CDS_pept        complement(464840..466117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04961"
FT                   /product="Putative principal RNA polymerase sigma factor"
FT                   /note="COG568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32) [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04961"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08427"
FT                   /db_xref="GOA:A9BEB7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEB7"
FT                   /protein_id="ABX08427.1"
FT   gene            466507..468768
FT                   /gene="priA"
FT                   /locus_tag="P9211_04971"
FT   CDS_pept        466507..468768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="P9211_04971"
FT                   /product="primosomal protein N' (replication factor Y)"
FT                   /note="COG1198 Primosomal protein N' (replication factor Y)
FT                   - superfamily II helicase [DNA replication, recombination,
FT                   and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04971"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08428"
FT                   /db_xref="GOA:A9BEB8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEB8"
FT                   /protein_id="ABX08428.1"
FT                   "
FT   gene            complement(468776..469870)
FT                   /locus_tag="P9211_04981"
FT   CDS_pept        complement(468776..469870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_04981"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04981"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08429"
FT                   /db_xref="GOA:A9BEB9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR021499"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEB9"
FT                   /protein_id="ABX08429.1"
FT   gene            complement(469872..470774)
FT                   /gene="argB"
FT                   /locus_tag="P9211_04991"
FT   CDS_pept        complement(469872..470774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="P9211_04991"
FT                   /product="Aspartokinase superfamily:Acetylglutamate kinase"
FT                   /EC_number=""
FT                   /note="COG548 Acetylglutamate kinase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_04991"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08430"
FT                   /db_xref="GOA:A9BEC0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEC0"
FT                   /protein_id="ABX08430.1"
FT   gene            complement(470787..471359)
FT                   /locus_tag="P9211_05001"
FT   CDS_pept        complement(470787..471359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08431"
FT                   /db_xref="GOA:A9BEC1"
FT                   /db_xref="InterPro:IPR021275"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEC1"
FT                   /protein_id="ABX08431.1"
FT   gene            471412..471603
FT                   /locus_tag="P9211_05011"
FT   CDS_pept        471412..471603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05011"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08432"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEC2"
FT                   /protein_id="ABX08432.1"
FT                   RDLSRLLSLAAERLQSDA"
FT   gene            complement(471609..472070)
FT                   /locus_tag="P9211_05021"
FT   CDS_pept        complement(471609..472070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05021"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /note="COG629 Single-stranded DNA-binding protein [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08433"
FT                   /db_xref="GOA:A9BEC3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEC3"
FT                   /protein_id="ABX08433.1"
FT   gene            472100..472462
FT                   /locus_tag="P9211_05031"
FT   CDS_pept        472100..472462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05031"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08434"
FT                   /db_xref="GOA:A9BEC4"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEC4"
FT                   /protein_id="ABX08434.1"
FT                   HGLRLIRYERFCWKFV"
FT   gene            472525..472902
FT                   /locus_tag="P9211_05041"
FT   CDS_pept        472525..472902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05041"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08435"
FT                   /db_xref="GOA:A9BEC5"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEC5"
FT                   /protein_id="ABX08435.1"
FT   gene            472887..473273
FT                   /gene="cutA"
FT                   /locus_tag="P9211_05051"
FT   CDS_pept        472887..473273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="P9211_05051"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="COG1324 Uncharacterized protein involved in
FT                   tolerance to divalent cations [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08436"
FT                   /db_xref="GOA:A9BEC6"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEC6"
FT                   /protein_id="ABX08436.1"
FT   gene            complement(473248..474294)
FT                   /locus_tag="P9211_05061"
FT   CDS_pept        complement(473248..474294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05061"
FT                   /product="Possible carbohydrate kinase"
FT                   /EC_number=""
FT                   /note="COG524 Sugar kinases, ribokinase family
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08437"
FT                   /db_xref="GOA:A9BEC7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEC7"
FT                   /protein_id="ABX08437.1"
FT                   VNNPKEID"
FT   gene            complement(474314..475627)
FT                   /gene="purA"
FT                   /locus_tag="P9211_05071"
FT   CDS_pept        complement(474314..475627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="P9211_05071"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number=""
FT                   /note="COG104 Adenylosuccinate synthase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08438"
FT                   /db_xref="GOA:A9BEC8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEC8"
FT                   /protein_id="ABX08438.1"
FT   gene            complement(475718..476152)
FT                   /gene="psb27"
FT                   /locus_tag="P9211_05081"
FT   CDS_pept        complement(475718..476152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psb27"
FT                   /locus_tag="P9211_05081"
FT                   /product="possible Photosystem II reaction center Psb27
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08439"
FT                   /db_xref="GOA:A9BEC9"
FT                   /db_xref="InterPro:IPR017488"
FT                   /db_xref="InterPro:IPR025585"
FT                   /db_xref="InterPro:IPR038450"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEC9"
FT                   /protein_id="ABX08439.1"
FT   gene            complement(476186..477988)
FT                   /gene="proS"
FT                   /locus_tag="P9211_05091"
FT   CDS_pept        complement(476186..477988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="P9211_05091"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG442 Prolyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08440"
FT                   /db_xref="GOA:A9BED0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BED0"
FT                   /protein_id="ABX08440.1"
FT   gene            478145..478609
FT                   /locus_tag="P9211_05101"
FT   CDS_pept        478145..478609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05101"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08441"
FT                   /db_xref="UniProtKB/TrEMBL:A9BED1"
FT                   /protein_id="ABX08441.1"
FT   gene            478729..479022
FT                   /locus_tag="P9211_05111"
FT   CDS_pept        478729..479022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05111"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08442"
FT                   /db_xref="GOA:A9BED2"
FT                   /db_xref="UniProtKB/TrEMBL:A9BED2"
FT                   /protein_id="ABX08442.1"
FT   gene            478964..479491
FT                   /locus_tag="P9211_05121"
FT   CDS_pept        478964..479491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05121"
FT                   /product="Inorganic pyrophosphatase"
FT                   /EC_number=""
FT                   /note="COG221 Inorganic pyrophosphatase [Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08443"
FT                   /db_xref="GOA:A9BED3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A9BED3"
FT                   /protein_id="ABX08443.1"
FT                   CIEAKNNAESNN"
FT   gene            479538..479894
FT                   /gene="arsC"
FT                   /locus_tag="P9211_05131"
FT   CDS_pept        479538..479894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="P9211_05131"
FT                   /product="putative arsenate reductase"
FT                   /EC_number=""
FT                   /note="COG1393 Arsenate reductase and related proteins,
FT                   glutaredoxin family [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08444"
FT                   /db_xref="GOA:A9BED4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9BED4"
FT                   /protein_id="ABX08444.1"
FT                   VGFKEPSWKDFFQN"
FT   gene            complement(479866..481365)
FT                   /locus_tag="P9211_05141"
FT   CDS_pept        complement(479866..481365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05141"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08445"
FT                   /db_xref="GOA:A9BED5"
FT                   /db_xref="UniProtKB/TrEMBL:A9BED5"
FT                   /protein_id="ABX08445.1"
FT   gene            481453..482169
FT                   /locus_tag="P9211_05151"
FT   CDS_pept        481453..482169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05151"
FT                   /product="Signal peptidase I"
FT                   /EC_number=""
FT                   /note="COG681 Signal peptidase I [Intracellular trafficking
FT                   and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08446"
FT                   /db_xref="GOA:A9BED6"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A9BED6"
FT                   /protein_id="ABX08446.1"
FT                   RATWRFWPINRIGGLR"
FT   gene            complement(482144..483418)
FT                   /locus_tag="P9211_05161"
FT   CDS_pept        complement(482144..483418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05161"
FT                   /product="putative dihydroorotase"
FT                   /EC_number=""
FT                   /note="COG44 Dihydroorotase and related cyclic
FT                   amidohydrolases [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08447"
FT                   /db_xref="GOA:A9BED7"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9BED7"
FT                   /protein_id="ABX08447.1"
FT   gene            complement(483423..484754)
FT                   /gene="gpmB"
FT                   /locus_tag="P9211_05171"
FT   CDS_pept        complement(483423..484754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="P9211_05171"
FT                   /product="possible alpha-ribazole-5'-P phosphatase"
FT                   /note="COG406 Fructose-2,6-bisphosphatase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08448"
FT                   /db_xref="GOA:A9BED8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A9BED8"
FT                   /protein_id="ABX08448.1"
FT   gene            484864..486225
FT                   /locus_tag="P9211_05181"
FT   CDS_pept        484864..486225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05181"
FT                   /product="Possible membrane associated protease"
FT                   /note="COG1266 Predicted metal-dependent membrane protease
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08449"
FT                   /db_xref="GOA:A9BED9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A9BED9"
FT                   /protein_id="ABX08449.1"
FT   gene            486386..486775
FT                   /locus_tag="P9211_05191"
FT   CDS_pept        486386..486775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05191"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08450"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEE0"
FT                   /protein_id="ABX08450.1"
FT   gene            486781..488577
FT                   /locus_tag="P9211_05201"
FT   CDS_pept        486781..488577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05201"
FT                   /product="putative peptidoglycan synthetase (pbp
FT                   transpeptidase domain)"
FT                   /EC_number=""
FT                   /note="COG768 Cell division protein FtsI/penicillin-binding
FT                   protein 2 [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08451"
FT                   /db_xref="GOA:A9BEE1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEE1"
FT                   /protein_id="ABX08451.1"
FT   gene            488681..489700
FT                   /gene="tal"
FT                   /locus_tag="P9211_05211"
FT   CDS_pept        488681..489700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="P9211_05211"
FT                   /product="Transaldolase"
FT                   /EC_number=""
FT                   /note="COG176 Transaldolase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08452"
FT                   /db_xref="GOA:A9BEE2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEE2"
FT                   /protein_id="ABX08452.1"
FT   gene            complement(489879..491006)
FT                   /gene="fixC"
FT                   /locus_tag="P9211_05221"
FT   CDS_pept        complement(489879..491006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="P9211_05221"
FT                   /product="NAD binding site"
FT                   /note="COG644 Dehydrogenases (flavoproteins) [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08453"
FT                   /db_xref="GOA:A9BEE3"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEE3"
FT                   /protein_id="ABX08453.1"
FT   gene            complement(491003..491551)
FT                   /gene="frr"
FT                   /locus_tag="P9211_05231"
FT   CDS_pept        complement(491003..491551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="P9211_05231"
FT                   /product="Ribosome recycling factor"
FT                   /EC_number=""
FT                   /note="COG233 Ribosome recycling factor [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08454"
FT                   /db_xref="GOA:A9BEE4"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEE4"
FT                   /protein_id="ABX08454.1"
FT   gene            complement(491598..492311)
FT                   /gene="pyrH"
FT                   /locus_tag="P9211_05241"
FT   CDS_pept        complement(491598..492311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="P9211_05241"
FT                   /product="uridylate kinase"
FT                   /note="COG528 Uridylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08455"
FT                   /db_xref="GOA:A9BEE5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEE5"
FT                   /protein_id="ABX08455.1"
FT                   AVAGEEIGSLITNSR"
FT   gene            492456..492620
FT                   /locus_tag="P9211_05251"
FT   CDS_pept        492456..492620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05251"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08456"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEE6"
FT                   /protein_id="ABX08456.1"
FT                   DLTALDDSV"
FT   gene            complement(492617..493309)
FT                   /gene="cobO"
FT                   /locus_tag="P9211_05261"
FT   CDS_pept        complement(492617..493309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="P9211_05261"
FT                   /product="possible cob(I)alamin adenosyltransferase"
FT                   /EC_number=""
FT                   /note="COG2109 ATP:corrinoid adenosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08457"
FT                   /db_xref="GOA:A9BEE7"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEE7"
FT                   /protein_id="ABX08457.1"
FT                   KAQKGIEF"
FT   gene            complement(493382..494551)
FT                   /locus_tag="P9211_05271"
FT   CDS_pept        complement(493382..494551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05271"
FT                   /product="Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08458"
FT                   /db_xref="GOA:A9BEE8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEE8"
FT                   /protein_id="ABX08458.1"
FT   gene            494613..495788
FT                   /gene="hemH"
FT                   /locus_tag="P9211_05281"
FT   CDS_pept        494613..495788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="P9211_05281"
FT                   /product="Ferrochelatase"
FT                   /EC_number=""
FT                   /note="COG276 Protoheme ferro-lyase (ferrochelatase)
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08459"
FT                   /db_xref="GOA:A9BEE9"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEE9"
FT                   /protein_id="ABX08459.1"
FT   gene            495944..497797
FT                   /gene="ilvB"
FT                   /locus_tag="P9211_05291"
FT   CDS_pept        495944..497797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="P9211_05291"
FT                   /product="Acetolactate synthase large subunit"
FT                   /EC_number=""
FT                   /note="COG28 Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase] [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08460"
FT                   /db_xref="GOA:A9BEF0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEF0"
FT                   /protein_id="ABX08460.1"
FT   gene            497779..498150
FT                   /locus_tag="P9211_05301"
FT   CDS_pept        497779..498150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08461"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEF1"
FT                   /protein_id="ABX08461.1"
FT   gene            complement(498192..498974)
FT                   /locus_tag="P9211_05311"
FT   CDS_pept        complement(498192..498974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05311"
FT                   /product="DUF152"
FT                   /note="COG1496 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08462"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEF2"
FT                   /protein_id="ABX08462.1"
FT   gene            complement(499009..499896)
FT                   /locus_tag="P9211_05321"
FT   CDS_pept        complement(499009..499896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08463"
FT                   /db_xref="GOA:A9BEF3"
FT                   /db_xref="InterPro:IPR009472"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEF3"
FT                   /protein_id="ABX08463.1"
FT                   KFSGFWMLRDLGEN"
FT   gene            complement(499893..501143)
FT                   /gene="rps1b"
FT                   /gene_synonym="rpsA2"
FT                   /gene_synonym="nbp1"
FT                   /locus_tag="P9211_05331"
FT   CDS_pept        complement(499893..501143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps1b"
FT                   /gene_synonym="rpsA2"
FT                   /gene_synonym="nbp1"
FT                   /locus_tag="P9211_05331"
FT                   /product="30S ribosomal protein S1-like protein B, putative
FT                   Nbp1"
FT                   /note="COG1098 Predicted RNA binding protein (contains
FT                   ribosomal protein S1 domain) [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08464"
FT                   /db_xref="GOA:A9BEF4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEF4"
FT                   /protein_id="ABX08464.1"
FT                   AKKVRGILKKKEESTEE"
FT   gene            501124..502029
FT                   /locus_tag="P9211_05341"
FT   CDS_pept        501124..502029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05341"
FT                   /product="Creatininase"
FT                   /EC_number=""
FT                   /note="COG1402 Uncharacterized protein, putative amidase
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08465"
FT                   /db_xref="GOA:A9BEF5"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEF5"
FT                   /protein_id="ABX08465.1"
FT   gene            502126..502854
FT                   /locus_tag="P9211_05351"
FT   CDS_pept        502126..502854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08466"
FT                   /db_xref="GOA:A9BEF6"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR022612"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEF6"
FT                   /protein_id="ABX08466.1"
FT   gene            503010..504050
FT                   /locus_tag="P9211_05361"
FT   CDS_pept        503010..504050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05361"
FT                   /product="Predicted dehydrogenase"
FT                   /note="COG5322 Predicted dehydrogenase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08467"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR016836"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEF7"
FT                   /protein_id="ABX08467.1"
FT                   LQAAIA"
FT   gene            504074..505063
FT                   /gene="accA"
FT                   /locus_tag="P9211_05371"
FT   CDS_pept        504074..505063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="P9211_05371"
FT                   /product="acetyl-CoA carboxylase, alpha subunit"
FT                   /EC_number=""
FT                   /note="COG825 Acetyl-CoA carboxylase alpha subunit [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08468"
FT                   /db_xref="GOA:A9BEF8"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEF8"
FT                   /protein_id="ABX08468.1"
FT   gene            505091..505798
FT                   /locus_tag="P9211_05381"
FT   CDS_pept        505091..505798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05381"
FT                   /product="putative short-chain dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG4221 Short-chain alcohol dehydrogenase of unknown
FT                   specificity [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08469"
FT                   /db_xref="GOA:A9BEF9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEF9"
FT                   /protein_id="ABX08469.1"
FT                   IEDITLMPSAGVL"
FT   gene            complement(505835..506503)
FT                   /gene="trpF"
FT                   /locus_tag="P9211_05391"
FT   CDS_pept        complement(505835..506503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="P9211_05391"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number=""
FT                   /note="COG135 Phosphoribosylanthranilate isomerase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08470"
FT                   /db_xref="GOA:A9BEG0"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEG0"
FT                   /protein_id="ABX08470.1"
FT                   "
FT   gene            506599..507840
FT                   /locus_tag="P9211_05401"
FT   CDS_pept        506599..507840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05401"
FT                   /product="Zn-dependent protease"
FT                   /note="COG1994 Zn-dependent proteases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08471"
FT                   /db_xref="GOA:A9BEG1"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEG1"
FT                   /protein_id="ABX08471.1"
FT                   TGLVQEPNSNESMK"
FT   gene            complement(507807..508553)
FT                   /gene="lplA"
FT                   /locus_tag="P9211_05411"
FT   CDS_pept        complement(507807..508553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="P9211_05411"
FT                   /product="Biotin/lipoate A/B protein ligase family"
FT                   /EC_number=""
FT                   /note="COG95 Lipoate-protein ligase A [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08472"
FT                   /db_xref="GOA:A9BEG2"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEG2"
FT                   /protein_id="ABX08472.1"
FT   gene            508711..508815
FT                   /locus_tag="P9211_05421"
FT   CDS_pept        508711..508815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05421"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08473"
FT                   /db_xref="GOA:A9BEG3"
FT                   /db_xref="InterPro:IPR010010"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEG3"
FT                   /protein_id="ABX08473.1"
FT   gene            508955..509299
FT                   /locus_tag="P9211_05431"
FT   CDS_pept        508955..509299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08474"
FT                   /db_xref="GOA:A9BEG4"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEG4"
FT                   /protein_id="ABX08474.1"
FT                   MPNSIRVIWR"
FT   gene            509372..510388
FT                   /locus_tag="P9211_05441"
FT   CDS_pept        509372..510388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05441"
FT                   /product="Light dependent protochlorophyllide
FT                   oxido-reductase"
FT                   /EC_number=""
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08475"
FT                   /db_xref="GOA:A9BEG5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR005979"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEG5"
FT                   /protein_id="ABX08475.1"
FT   gene            complement(510394..511284)
FT                   /gene="chlL"
FT                   /locus_tag="P9211_05451"
FT   CDS_pept        complement(510394..511284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlL"
FT                   /locus_tag="P9211_05451"
FT                   /product="Protochlorophyllide reductase iron-sulfur
FT                   ATP-binding protein"
FT                   /EC_number=""
FT                   /note="COG1348 Nitrogenase subunit NifH (ATPase) [Inorganic
FT                   ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08476"
FT                   /db_xref="GOA:A9BEG6"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005971"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEG6"
FT                   /protein_id="ABX08476.1"
FT                   EPLKDREIFDLLGFD"
FT   gene            complement(511469..513064)
FT                   /gene="chlB"
FT                   /locus_tag="P9211_05461"
FT   CDS_pept        complement(511469..513064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlB"
FT                   /locus_tag="P9211_05461"
FT                   /product="Light-independent protochlorophyllide reductase
FT                   subunit B"
FT                   /note="COG2710 Nitrogenase molybdenum-iron protein, alpha
FT                   and beta chains [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08477"
FT                   /db_xref="GOA:A9BEG7"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005969"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEG7"
FT                   /protein_id="ABX08477.1"
FT                   DGETLLDAKAHFNA"
FT   gene            complement(513073..514329)
FT                   /gene="chlN"
FT                   /locus_tag="P9211_05471"
FT   CDS_pept        complement(513073..514329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlN"
FT                   /locus_tag="P9211_05471"
FT                   /product="Light-independent protochlorophyllide reductase
FT                   subunit N"
FT                   /note="COG2710 Nitrogenase molybdenum-iron protein, alpha
FT                   and beta chains [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08478"
FT                   /db_xref="GOA:A9BEG8"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005970"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEG8"
FT                   /protein_id="ABX08478.1"
FT   gene            complement(514506..514874)
FT                   /locus_tag="P9211_05481"
FT   CDS_pept        complement(514506..514874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08479"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEG9"
FT                   /protein_id="ABX08479.1"
FT                   RNVWKLSQVDKESSYWRN"
FT   gene            514976..515752
FT                   /locus_tag="P9211_05491"
FT   CDS_pept        514976..515752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08480"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEH0"
FT                   /protein_id="ABX08480.1"
FT   gene            complement(515749..516336)
FT                   /locus_tag="P9211_05501"
FT   CDS_pept        complement(515749..516336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05501"
FT                   /product="HAM1 family protein"
FT                   /EC_number=""
FT                   /note="COG127 Xanthosine triphosphate pyrophosphatase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08481"
FT                   /db_xref="GOA:A9BEH1"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEH1"
FT                   /protein_id="ABX08481.1"
FT   gene            516678..516989
FT                   /gene="ccmK"
FT                   /locus_tag="P9211_05511"
FT   CDS_pept        516678..516989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmK"
FT                   /locus_tag="P9211_05511"
FT                   /product="carboxysome shell protein CsoS1"
FT                   /note="COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein [Secondary metabolites
FT                   biosynthesis, transport, and catabolism / Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08482"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEH2"
FT                   /protein_id="ABX08482.1"
FT   gene            517060..518472
FT                   /gene="rbcL"
FT                   /locus_tag="P9211_05521"
FT   CDS_pept        517060..518472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcL"
FT                   /locus_tag="P9211_05521"
FT                   /product="Ribulose bisphosphate carboxylase, large chain"
FT                   /EC_number=""
FT                   /note="COG1850 Ribulose 1,5-bisphosphate carboxylase, large
FT                   subunit [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08483"
FT                   /db_xref="GOA:A9BEH3"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEH3"
FT                   /protein_id="ABX08483.1"
FT                   FEFDTVDKLDVQ"
FT   gene            518572..518913
FT                   /gene="rbcS"
FT                   /locus_tag="P9211_05531"
FT   CDS_pept        518572..518913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcS"
FT                   /locus_tag="P9211_05531"
FT                   /product="Ribulose bisphosphate carboxylase, small chain"
FT                   /EC_number=""
FT                   /note="COG4451 Ribulose bisphosphate carboxylase small
FT                   subunit [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08484"
FT                   /db_xref="GOA:A9BEH4"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEH4"
FT                   /protein_id="ABX08484.1"
FT                   TCFVVFEGR"
FT   gene            519019..521376
FT                   /gene="csoS2"
FT                   /locus_tag="P9211_05541"
FT   CDS_pept        519019..521376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csoS2"
FT                   /locus_tag="P9211_05541"
FT                   /product="carboxysome shell protein CsoS2"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08485"
FT                   /db_xref="InterPro:IPR020990"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEH5"
FT                   /protein_id="ABX08485.1"
FT   gene            521384..522913
FT                   /gene="csoS3"
FT                   /locus_tag="P9211_05551"
FT   CDS_pept        521384..522913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csoS3"
FT                   /locus_tag="P9211_05551"
FT                   /product="carboxysome shell protein CsoS3"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08486"
FT                   /db_xref="GOA:A9BEH6"
FT                   /db_xref="InterPro:IPR014074"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEH6"
FT                   /protein_id="ABX08486.1"
FT   gene            522915..523175
FT                   /gene="ccmL"
FT                   /locus_tag="P9211_05561"
FT   CDS_pept        522915..523175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmL"
FT                   /locus_tag="P9211_05561"
FT                   /product="putative carboxysome peptide A"
FT                   /note="COG4576 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein [Secondary metabolites
FT                   biosynthesis, transport, and catabolism / Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08487"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR014076"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEH7"
FT                   /protein_id="ABX08487.1"
FT   gene            523175..523426
FT                   /locus_tag="P9211_05571"
FT   CDS_pept        523175..523426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05571"
FT                   /product="putative carboxysome peptide B"
FT                   /note="COG4576 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein [Secondary metabolites
FT                   biosynthesis, transport, and catabolism / Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08488"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR014077"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEH8"
FT                   /protein_id="ABX08488.1"
FT   gene            523476..524048
FT                   /locus_tag="P9211_05581"
FT   CDS_pept        523476..524048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05581"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08489"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEH9"
FT                   /protein_id="ABX08489.1"
FT   gene            524128..524394
FT                   /locus_tag="P9211_05591"
FT   CDS_pept        524128..524394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05591"
FT                   /product="Pterin-4a-carbinolamine dehydratase"
FT                   /EC_number=""
FT                   /note="COG2154 Pterin-4a-carbinolamine dehydratase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08490"
FT                   /db_xref="GOA:A9BEI0"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEI0"
FT                   /protein_id="ABX08490.1"
FT   gene            complement(524415..524639)
FT                   /locus_tag="P9211_05601"
FT   CDS_pept        complement(524415..524639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05601"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08491"
FT                   /db_xref="InterPro:IPR021483"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEI1"
FT                   /protein_id="ABX08491.1"
FT   gene            complement(524729..525127)
FT                   /gene="tdcF"
FT                   /locus_tag="P9211_05611"
FT   CDS_pept        complement(524729..525127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdcF"
FT                   /locus_tag="P9211_05611"
FT                   /product="Putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /note="COG251 Putative translation initiation inhibitor,
FT                   yjgF family [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05611"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08492"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEI2"
FT                   /protein_id="ABX08492.1"
FT   gene            complement(525163..525924)
FT                   /locus_tag="P9211_05621"
FT   CDS_pept        complement(525163..525924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05621"
FT                   /product="Putative hydroxyacylglutathione hydrolase"
FT                   /EC_number=""
FT                   /note="COG491 Zn-dependent hydrolases, including
FT                   glyoxylases [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05621"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08493"
FT                   /db_xref="GOA:A9BEI3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEI3"
FT                   /protein_id="ABX08493.1"
FT   gene            525960..526610
FT                   /gene="hisG"
FT                   /locus_tag="P9211_05631"
FT   CDS_pept        525960..526610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="P9211_05631"
FT                   /product="possible ATP phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="COG40 ATP phosphoribosyltransferase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05631"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08494"
FT                   /db_xref="GOA:A9BEI4"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEI4"
FT                   /protein_id="ABX08494.1"
FT   gene            526610..528409
FT                   /locus_tag="P9211_05641"
FT   CDS_pept        526610..528409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05641"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /EC_number=""
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05641"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08495"
FT                   /db_xref="GOA:A9BEI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEI5"
FT                   /protein_id="ABX08495.1"
FT   gene            528434..528982
FT                   /locus_tag="P9211_05651"
FT   CDS_pept        528434..528982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05651"
FT                   /product="possible acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05651"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08496"
FT                   /db_xref="GOA:A9BEI6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEI6"
FT                   /protein_id="ABX08496.1"
FT   gene            complement(529021..529731)
FT                   /locus_tag="P9211_05661"
FT   CDS_pept        complement(529021..529731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05661"
FT                   /product="Glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /note="COG463 Glycosyltransferases involved in cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05661"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08497"
FT                   /db_xref="GOA:A9BEI7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEI7"
FT                   /protein_id="ABX08497.1"
FT                   EDPEKLFNEYYSIK"
FT   gene            complement(529662..530363)
FT                   /locus_tag="P9211_05671"
FT   CDS_pept        complement(529662..530363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05671"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG3222 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05671"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08498"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEI8"
FT                   /protein_id="ABX08498.1"
FT                   LLYPPSTNLKG"
FT   gene            530649..532013
FT                   /gene="dnaA"
FT                   /locus_tag="P9211_05681"
FT   CDS_pept        530649..532013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="P9211_05681"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /EC_number=""
FT                   /note="COG593 ATPase involved in DNA replication initiation
FT                   [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05681"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08499"
FT                   /db_xref="GOA:A9BEI9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEI9"
FT                   /protein_id="ABX08499.1"
FT   gene            complement(532010..532777)
FT                   /locus_tag="P9211_05691"
FT   CDS_pept        complement(532010..532777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05691"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG4318 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05691"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08500"
FT                   /db_xref="InterPro:IPR014956"
FT                   /db_xref="InterPro:IPR016932"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEJ0"
FT                   /protein_id="ABX08500.1"
FT   gene            complement(532704..533942)
FT                   /locus_tag="P9211_05701"
FT   CDS_pept        complement(532704..533942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05701"
FT                   /product="Glutathione S-transferase"
FT                   /EC_number=""
FT                   /note="COG625 Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05701"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08501"
FT                   /db_xref="GOA:A9BEJ1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEJ1"
FT                   /protein_id="ABX08501.1"
FT                   RNRFDQDPSPFLK"
FT   gene            533979..535349
FT                   /gene="gor"
FT                   /locus_tag="P9211_05711"
FT   CDS_pept        533979..535349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="P9211_05711"
FT                   /product="probable glutathione reductase (NADPH)"
FT                   /EC_number=""
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05711"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08502"
FT                   /db_xref="GOA:A9BEJ2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEJ2"
FT                   /protein_id="ABX08502.1"
FT   gene            complement(535409..536491)
FT                   /gene="ecm27"
FT                   /locus_tag="P9211_05721"
FT   CDS_pept        complement(535409..536491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecm27"
FT                   /locus_tag="P9211_05721"
FT                   /product="putative CaCA family sodium/calcium exchanger"
FT                   /note="COG530 Ca2+/Na+ antiporter [Inorganic ion transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05721"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08503"
FT                   /db_xref="GOA:A9BEJ3"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEJ3"
FT                   /protein_id="ABX08503.1"
FT   gene            536635..537708
FT                   /locus_tag="P9211_05731"
FT   CDS_pept        536635..537708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05731"
FT                   /product="Dihydroorotase"
FT                   /EC_number=""
FT                   /note="COG418 Dihydroorotase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05731"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08504"
FT                   /db_xref="GOA:A9BEJ4"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEJ4"
FT                   /protein_id="ABX08504.1"
FT                   FHAGESLSWSISSPKEN"
FT   gene            complement(537745..537830)
FT                   /locus_tag="P9211_tRNALeuVIMSS1309350"
FT                   /note="tRNA-Leu"
FT   tRNA            complement(537745..537830)
FT                   /locus_tag="P9211_tRNALeuVIMSS1309350"
FT                   /product="tRNA-Leu"
FT   gene            538149..538472
FT                   /locus_tag="P9211_05741"
FT   CDS_pept        538149..538472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05741"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05741"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08505"
FT                   /db_xref="GOA:A9BEJ5"
FT                   /db_xref="InterPro:IPR021562"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEJ5"
FT                   /protein_id="ABX08505.1"
FT                   DKK"
FT   gene            538547..539362
FT                   /gene="trpA"
FT                   /locus_tag="P9211_05751"
FT   CDS_pept        538547..539362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="P9211_05751"
FT                   /product="Tryptophan synthase, alpha subunit"
FT                   /EC_number=""
FT                   /note="COG159 Tryptophan synthase alpha chain [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05751"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08506"
FT                   /db_xref="GOA:A9BEJ6"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEJ6"
FT                   /protein_id="ABX08506.1"
FT   gene            complement(539494..539862)
FT                   /locus_tag="P9211_05761"
FT   CDS_pept        complement(539494..539862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05761"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05761"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08507"
FT                   /db_xref="GOA:A9BEJ7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEJ7"
FT                   /protein_id="ABX08507.1"
FT                   LGRKQIRLVPAGSEDSDD"
FT   gene            539964..540233
FT                   /locus_tag="P9211_05771"
FT   CDS_pept        539964..540233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05771"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG2350 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05771"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08508"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEJ8"
FT                   /protein_id="ABX08508.1"
FT   gene            complement(540209..540595)
FT                   /gene="petJ"
FT                   /locus_tag="P9211_05781"
FT   CDS_pept        complement(540209..540595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petJ"
FT                   /locus_tag="P9211_05781"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05781"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08509"
FT                   /db_xref="GOA:A9BEJ9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEJ9"
FT                   /protein_id="ABX08509.1"
FT   gene            complement(540597..540911)
FT                   /locus_tag="P9211_05791"
FT   CDS_pept        complement(540597..540911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05791"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05791"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08510"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEK0"
FT                   /protein_id="ABX08510.1"
FT                   "
FT   gene            complement(540914..541279)
FT                   /locus_tag="P9211_05801"
FT   CDS_pept        complement(540914..541279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05801"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3339 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05801"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08511"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEK1"
FT                   /protein_id="ABX08511.1"
FT                   PQIKSRARRKLDTWFPL"
FT   gene            complement(541387..542325)
FT                   /locus_tag="P9211_05811"
FT   CDS_pept        complement(541387..542325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05811"
FT                   /product="Putative type II alternative sigma factor,
FT                   sigma70 family"
FT                   /note="COG568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32) [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05811"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08512"
FT                   /db_xref="GOA:A9BEK2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEK2"
FT                   /protein_id="ABX08512.1"
FT   gene            complement(542571..543239)
FT                   /gene="hisI"
FT                   /locus_tag="P9211_05821"
FT   CDS_pept        complement(542571..543239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="P9211_05821"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG139 Phosphoribosyl-AMP cyclohydrolase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05821"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08513"
FT                   /db_xref="GOA:A9BEK3"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEK3"
FT                   /protein_id="ABX08513.1"
FT                   "
FT   gene            543300..543773
FT                   /locus_tag="P9211_05831"
FT   CDS_pept        543300..543773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05831"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05831"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08514"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEK4"
FT                   /protein_id="ABX08514.1"
FT   gene            complement(543977..545527)
FT                   /gene="crtH"
FT                   /locus_tag="P9211_05841"
FT   CDS_pept        complement(543977..545527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtH"
FT                   /locus_tag="P9211_05841"
FT                   /product="putative carotenoid isomerase"
FT                   /note="COG1233 Phytoene dehydrogenase and related proteins
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05841"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08515"
FT                   /db_xref="GOA:A9BEK5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014101"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEK5"
FT                   /protein_id="ABX08515.1"
FT   gene            complement(545573..546997)
FT                   /gene="gid"
FT                   /locus_tag="P9211_05851"
FT   CDS_pept        complement(545573..546997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gid"
FT                   /locus_tag="P9211_05851"
FT                   /product="NAD binding site:Glucose inhibited division
FT                   protein A family"
FT                   /note="COG1206 NAD(FAD)-utilizing enzyme possibly involved
FT                   in translation [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05851"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08516"
FT                   /db_xref="GOA:A9BEK6"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEK6"
FT                   /protein_id="ABX08516.1"
FT                   CLAQELGISKLPIYRS"
FT   gene            complement(547033..547158)
FT                   /gene="psbY"
FT                   /locus_tag="P9211_05861"
FT   CDS_pept        complement(547033..547158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbY"
FT                   /locus_tag="P9211_05861"
FT                   /product="possible Photosystem II reaction center Y protein
FT                   (PsbY)"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05861"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08517"
FT                   /db_xref="GOA:A9BEK7"
FT                   /db_xref="InterPro:IPR009388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BEK7"
FT                   /protein_id="ABX08517.1"
FT   gene            547369..547440
FT                   /locus_tag="P9211_tRNALysVIMSS1309373"
FT                   /note="tRNA-Lys"
FT   tRNA            547369..547440
FT                   /locus_tag="P9211_tRNALysVIMSS1309373"
FT                   /product="tRNA-Lys"
FT   gene            547383..547814
FT                   /locus_tag="P9211_05871"
FT   CDS_pept        547383..547814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05871"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05871"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08518"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEK8"
FT                   /protein_id="ABX08518.1"
FT   gene            548169..548498
FT                   /locus_tag="P9211_05881"
FT   CDS_pept        548169..548498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05881"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05881"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08519"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEK9"
FT                   /protein_id="ABX08519.1"
FT                   WISNS"
FT   gene            548621..548923
FT                   /locus_tag="P9211_05891"
FT   CDS_pept        548621..548923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05891"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05891"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08520"
FT                   /db_xref="InterPro:IPR021734"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEL0"
FT                   /protein_id="ABX08520.1"
FT   gene            complement(549482..549664)
FT                   /locus_tag="P9211_05901"
FT   CDS_pept        complement(549482..549664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05901"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05901"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08521"
FT                   /db_xref="GOA:A9BEL1"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEL1"
FT                   /protein_id="ABX08521.1"
FT                   VLVEALFNQINARKG"
FT   gene            549830..549903
FT                   /locus_tag="P9211_tRNAProVIMSS1309374"
FT                   /note="tRNA-Pro"
FT   tRNA            549830..549903
FT                   /locus_tag="P9211_tRNAProVIMSS1309374"
FT                   /product="tRNA-Pro"
FT   gene            550226..550408
FT                   /locus_tag="P9211_05911"
FT   CDS_pept        550226..550408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05911"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05911"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08522"
FT                   /db_xref="GOA:A9BEL2"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEL2"
FT                   /protein_id="ABX08522.1"
FT                   ISANSARVKMYFQYR"
FT   gene            550405..550686
FT                   /locus_tag="P9211_05921"
FT   CDS_pept        550405..550686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05921"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05921"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08523"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEL3"
FT                   /protein_id="ABX08523.1"
FT   gene            complement(550769..551227)
FT                   /locus_tag="P9211_05931"
FT   CDS_pept        complement(550769..551227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05931"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05931"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08524"
FT                   /db_xref="GOA:A9BEL4"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEL4"
FT                   /protein_id="ABX08524.1"
FT   gene            551558..551941
FT                   /locus_tag="P9211_05941"
FT   CDS_pept        551558..551941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05941"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05941"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08525"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEL5"
FT                   /protein_id="ABX08525.1"
FT   gene            551995..552264
FT                   /locus_tag="P9211_05951"
FT   CDS_pept        551995..552264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05951"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05951"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08526"
FT                   /db_xref="GOA:A9BEL6"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEL6"
FT                   /protein_id="ABX08526.1"
FT   gene            complement(552514..552684)
FT                   /locus_tag="P9211_05961"
FT   CDS_pept        complement(552514..552684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05961"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05961"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08527"
FT                   /db_xref="GOA:A9BEL7"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEL7"
FT                   /protein_id="ABX08527.1"
FT                   TKVYLGLGFDS"
FT   gene            552897..553103
FT                   /locus_tag="P9211_05971"
FT   CDS_pept        552897..553103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05971"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05971"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08528"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEL8"
FT                   /protein_id="ABX08528.1"
FT   gene            553084..553560
FT                   /locus_tag="P9211_05981"
FT   CDS_pept        553084..553560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05981"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05981"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08529"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEL9"
FT                   /protein_id="ABX08529.1"
FT   gene            553853..554068
FT                   /locus_tag="P9211_05991"
FT   CDS_pept        553853..554068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_05991"
FT                   /product="Predicted nucleic-acid-binding protein containing
FT                   a Zn-ribbon domain"
FT                   /note="COG3478 Predicted nucleic-acid-binding protein
FT                   containing a Zn-ribbon domain [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_05991"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08530"
FT                   /db_xref="InterPro:IPR018652"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEM0"
FT                   /protein_id="ABX08530.1"
FT   gene            554138..554302
FT                   /locus_tag="P9211_06001"
FT   CDS_pept        554138..554302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06001"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08531"
FT                   /db_xref="UniProtKB/TrEMBL:A9BEM1"
FT                   /protein_id="ABX08531.1"
FT                   GNMGTTRTD"
FT   gene            554306..555163
FT                   /locus_tag="P9211_06011"
FT   CDS_pept        554306..555163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06011"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08532"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9M0"
FT                   /protein_id="ABX08532.1"
FT                   SFFS"
FT   gene            complement(555359..555640)
FT                   /locus_tag="P9211_06021"
FT   CDS_pept        complement(555359..555640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06021"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08533"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9M1"
FT                   /protein_id="ABX08533.1"
FT   gene            555976..556107
FT                   /locus_tag="P9211_06031"
FT   CDS_pept        555976..556107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06031"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08534"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9M2"
FT                   /protein_id="ABX08534.1"
FT   gene            556151..556450
FT                   /locus_tag="P9211_06041"
FT   CDS_pept        556151..556450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06041"
FT                   /product="Hypothetical protein"
FT                   /note="COG5470 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08535"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9M3"
FT                   /protein_id="ABX08535.1"
FT   gene            556465..556590
FT                   /locus_tag="P9211_06051"
FT   CDS_pept        556465..556590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06051"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08536"
FT                   /db_xref="GOA:A9B9M4"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9M4"
FT                   /protein_id="ABX08536.1"
FT   gene            556590..556793
FT                   /locus_tag="P9211_06061"
FT   CDS_pept        556590..556793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06061"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08537"
FT                   /db_xref="GOA:A9B9M5"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9M5"
FT                   /protein_id="ABX08537.1"
FT   gene            complement(557166..557723)
FT                   /locus_tag="P9211_06071"
FT   CDS_pept        complement(557166..557723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06071"
FT                   /product="Micrococcal nuclease (thermonuclease)-like
FT                   protein"
FT                   /note="COG1525 Micrococcal nuclease (thermonuclease)
FT                   homologs [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08538"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9M6"
FT                   /protein_id="ABX08538.1"
FT   gene            complement(557778..558047)
FT                   /locus_tag="P9211_06081"
FT   CDS_pept        complement(557778..558047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06081"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08539"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9M7"
FT                   /protein_id="ABX08539.1"
FT   gene            558178..558309
FT                   /locus_tag="P9211_06091"
FT   CDS_pept        558178..558309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06091"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08540"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9M8"
FT                   /protein_id="ABX08540.1"
FT   gene            complement(558338..558580)
FT                   /locus_tag="P9211_06101"
FT   CDS_pept        complement(558338..558580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06101"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08541"
FT                   /db_xref="InterPro:IPR012663"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9M9"
FT                   /protein_id="ABX08541.1"
FT   gene            complement(558577..558741)
FT                   /locus_tag="P9211_06111"
FT   CDS_pept        complement(558577..558741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06111"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08542"
FT                   /db_xref="GOA:A9B9N0"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9N0"
FT                   /protein_id="ABX08542.1"
FT                   GKTDDSGNR"
FT   gene            complement(559045..559197)
FT                   /locus_tag="P9211_06121"
FT   CDS_pept        complement(559045..559197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06121"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08543"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9N1"
FT                   /protein_id="ABX08543.1"
FT                   KGEYF"
FT   gene            complement(559388..560731)
FT                   /gene="alsT"
FT                   /locus_tag="P9211_06131"
FT   CDS_pept        complement(559388..560731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alsT"
FT                   /locus_tag="P9211_06131"
FT                   /product="Na+/alanine symporter"
FT                   /EC_number=""
FT                   /note="COG1115 Na+/alanine symporter [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08544"
FT                   /db_xref="GOA:A9B9N2"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9N2"
FT                   /protein_id="ABX08544.1"
FT   gene            complement(560987..562690)
FT                   /locus_tag="P9211_06141"
FT   CDS_pept        complement(560987..562690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06141"
FT                   /product="Hypothetical protein"
FT                   /note="COG397 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08545"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9N3"
FT                   /protein_id="ABX08545.1"
FT   gene            562949..563179
FT                   /locus_tag="P9211_06151"
FT   CDS_pept        562949..563179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06151"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08546"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9N4"
FT                   /protein_id="ABX08546.1"
FT   gene            complement(563176..563646)
FT                   /locus_tag="P9211_06161"
FT   CDS_pept        complement(563176..563646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06161"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08547"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9N5"
FT                   /protein_id="ABX08547.1"
FT   gene            complement(563713..563877)
FT                   /locus_tag="P9211_06171"
FT   CDS_pept        complement(563713..563877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06171"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08548"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9N6"
FT                   /protein_id="ABX08548.1"
FT                   RREEQKEIT"
FT   gene            complement(563878..564063)
FT                   /locus_tag="P9211_06181"
FT   CDS_pept        complement(563878..564063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06181"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08549"
FT                   /db_xref="GOA:A9B9N7"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9N7"
FT                   /protein_id="ABX08549.1"
FT                   LVALENKLPFDIPGIG"
FT   gene            564184..564351
FT                   /locus_tag="P9211_06191"
FT   CDS_pept        564184..564351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06191"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08550"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9N8"
FT                   /protein_id="ABX08550.1"
FT                   QIINYYNETT"
FT   gene            complement(564344..564835)
FT                   /locus_tag="P9211_06201"
FT   CDS_pept        complement(564344..564835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06201"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08551"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9N9"
FT                   /protein_id="ABX08551.1"
FT                   "
FT   gene            complement(564921..565097)
FT                   /locus_tag="P9211_06211"
FT   CDS_pept        complement(564921..565097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06211"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08552"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9P0"
FT                   /protein_id="ABX08552.1"
FT                   DIEGIASRYGVMS"
FT   gene            complement(565102..565383)
FT                   /locus_tag="P9211_06221"
FT   CDS_pept        complement(565102..565383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06221"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08553"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9P1"
FT                   /protein_id="ABX08553.1"
FT   gene            565649..565810
FT                   /locus_tag="P9211_06231"
FT   CDS_pept        565649..565810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06231"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08554"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9P2"
FT                   /protein_id="ABX08554.1"
FT                   EYPLVHNG"
FT   gene            566084..566821
FT                   /locus_tag="P9211_06241"
FT   CDS_pept        566084..566821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06241"
FT                   /product="GMP synthase-Glutamine amidotransferase domain"
FT                   /EC_number=""
FT                   /note="COG518 GMP synthase - Glutamine amidotransferase
FT                   domain [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08555"
FT                   /db_xref="GOA:A9B9P3"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9P3"
FT                   /protein_id="ABX08555.1"
FT   gene            complement(567077..567319)
FT                   /locus_tag="P9211_06251"
FT   CDS_pept        complement(567077..567319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06251"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08556"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9P4"
FT                   /protein_id="ABX08556.1"
FT   gene            567414..568028
FT                   /locus_tag="P9211_06261"
FT   CDS_pept        567414..568028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06261"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08557"
FT                   /db_xref="GOA:A9B9P5"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9P5"
FT                   /protein_id="ABX08557.1"
FT   gene            567997..568158
FT                   /locus_tag="P9211_06271"
FT   CDS_pept        567997..568158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06271"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08558"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9P6"
FT                   /protein_id="ABX08558.1"
FT                   EVLSKNRF"
FT   gene            568269..568409
FT                   /locus_tag="P9211_06281"
FT   CDS_pept        568269..568409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06281"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08559"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9P7"
FT                   /protein_id="ABX08559.1"
FT                   G"
FT   gene            complement(569033..569290)
FT                   /locus_tag="P9211_06291"
FT   CDS_pept        complement(569033..569290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06291"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08560"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9P8"
FT                   /protein_id="ABX08560.1"
FT   gene            complement(569476..569694)
FT                   /locus_tag="P9211_06301"
FT   CDS_pept        complement(569476..569694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06301"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08561"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9P9"
FT                   /protein_id="ABX08561.1"
FT   gene            complement(569876..570037)
FT                   /locus_tag="P9211_06311"
FT   CDS_pept        complement(569876..570037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06311"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08562"
FT                   /db_xref="GOA:A9B9Q0"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9Q0"
FT                   /protein_id="ABX08562.1"
FT                   LLKKGNLP"
FT   gene            complement(570093..570401)
FT                   /locus_tag="P9211_06321"
FT   CDS_pept        complement(570093..570401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06321"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08563"
FT                   /db_xref="GOA:A9B9Q1"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9Q1"
FT                   /protein_id="ABX08563.1"
FT   gene            570903..572195
FT                   /locus_tag="P9211_06331"
FT   CDS_pept        570903..572195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06331"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG4487 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08564"
FT                   /db_xref="InterPro:IPR019219"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9Q2"
FT                   /protein_id="ABX08564.1"
FT   gene            complement(572637..572855)
FT                   /locus_tag="P9211_06341"
FT   CDS_pept        complement(572637..572855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08565"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9Q3"
FT                   /protein_id="ABX08565.1"
FT   gene            complement(573272..573556)
FT                   /locus_tag="P9211_06351"
FT   CDS_pept        complement(573272..573556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06351"
FT                   /product="Hypothetical protein"
FT                   /note="COG4095 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08566"
FT                   /db_xref="GOA:A9B9Q4"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9Q4"
FT                   /protein_id="ABX08566.1"
FT   gene            573743..574087
FT                   /locus_tag="P9211_06361"
FT   CDS_pept        573743..574087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06361"
FT                   /product="Hypothetical protein"
FT                   /note="COG5470 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08567"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9Q5"
FT                   /protein_id="ABX08567.1"
FT                   QRLRRAMGKK"
FT   gene            574087..574257
FT                   /locus_tag="P9211_06371"
FT   CDS_pept        574087..574257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06371"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08568"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9Q6"
FT                   /protein_id="ABX08568.1"
FT                   DLLRFLVGRWQ"
FT   gene            574409..574606
FT                   /locus_tag="P9211_06381"
FT   CDS_pept        574409..574606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06381"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08569"
FT                   /db_xref="GOA:A9B9Q7"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9Q7"
FT                   /protein_id="ABX08569.1"
FT   gene            574703..574846
FT                   /locus_tag="P9211_06391"
FT   CDS_pept        574703..574846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06391"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08570"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9Q8"
FT                   /protein_id="ABX08570.1"
FT                   RD"
FT   gene            574875..575006
FT                   /locus_tag="P9211_06401"
FT   CDS_pept        574875..575006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06401"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08571"
FT                   /db_xref="GOA:A9B9Q9"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9Q9"
FT                   /protein_id="ABX08571.1"
FT   gene            575048..575215
FT                   /locus_tag="P9211_06411"
FT   CDS_pept        575048..575215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06411"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08572"
FT                   /db_xref="GOA:A9B9R0"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9R0"
FT                   /protein_id="ABX08572.1"
FT                   SQVGIKIKWL"
FT   gene            complement(575301..575480)
FT                   /locus_tag="P9211_06421"
FT   CDS_pept        complement(575301..575480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06421"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08573"
FT                   /db_xref="GOA:A9B9R1"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9R1"
FT                   /protein_id="ABX08573.1"
FT                   YTSFYSKEGYALKD"
FT   gene            575641..575877
FT                   /locus_tag="P9211_06431"
FT   CDS_pept        575641..575877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06431"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08574"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9R2"
FT                   /protein_id="ABX08574.1"
FT   gene            complement(576369..576569)
FT                   /locus_tag="P9211_06441"
FT   CDS_pept        complement(576369..576569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06441"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08575"
FT                   /db_xref="GOA:A9B9R3"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9R3"
FT                   /protein_id="ABX08575.1"
FT   gene            complement(576650..577003)
FT                   /locus_tag="P9211_06451"
FT   CDS_pept        complement(576650..577003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06451"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08576"
FT                   /db_xref="InterPro:IPR023810"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9R4"
FT                   /protein_id="ABX08576.1"
FT                   NGRRVVRRSSANG"
FT   gene            complement(577112..577537)
FT                   /locus_tag="P9211_06461"
FT   CDS_pept        complement(577112..577537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06461"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08577"
FT                   /db_xref="GOA:A9B9R5"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9R5"
FT                   /protein_id="ABX08577.1"
FT   gene            complement(577507..578049)
FT                   /locus_tag="P9211_06471"
FT   CDS_pept        complement(577507..578049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06471"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08578"
FT                   /db_xref="GOA:A9B9R6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9R6"
FT                   /protein_id="ABX08578.1"
FT                   LILHLIFGWPAYLLAGK"
FT   gene            578349..578522
FT                   /locus_tag="P9211_06481"
FT   CDS_pept        578349..578522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9211_06481"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9211_06481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX08579"
FT                   /db_xref="UniProtKB/TrEMBL:A9B9R7"
FT                   /protein_id="