(data stored in SCRATCH zone)

EMBL: CP000880

ID   CP000880; SV 1; circular; genomic DNA; STD; PRO; 4600800 BP.
XX
AC   CP000880;
XX
PR   Project:PRJNA13030;
XX
DT   01-DEC-2007 (Rel. 94, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Salmonella enterica subsp. arizonae serovar 62:z4,z23:--, complete genome.
XX
KW   .
XX
OS   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-4600800
RG   The Salmonella enterica serovar Arizonae Genome Sequencing Project
RA   McClelland M., Sanderson E.K., Porwollik S., Spieth J., Clifton W.S.,
RA   Fulton R., Chunyan W., Wollam A., Shah N., Pepin K., Bhonagiri V., Nash W.,
RA   Johnson M., Thiruvilangam P., Wilson R.;
RT   ;
RL   Submitted (02-NOV-2007) to the INSDC.
RL   Genetics, Genome Sequencing Center, 4444 Forest Park Parkway, St. Louis, MO
RL   63108, USA
XX
DR   MD5; fa76d4b376cef620b0fe60e92e6c6eff.
DR   BioSample; SAMN02604141.
DR   EnsemblGenomes-Gn; EBG00001111722.
DR   EnsemblGenomes-Gn; EBG00001111723.
DR   EnsemblGenomes-Gn; EBG00001111724.
DR   EnsemblGenomes-Gn; EBG00001111725.
DR   EnsemblGenomes-Gn; EBG00001111726.
DR   EnsemblGenomes-Gn; EBG00001111727.
DR   EnsemblGenomes-Gn; EBG00001111728.
DR   EnsemblGenomes-Gn; EBG00001111729.
DR   EnsemblGenomes-Gn; EBG00001111730.
DR   EnsemblGenomes-Gn; EBG00001111731.
DR   EnsemblGenomes-Gn; EBG00001111732.
DR   EnsemblGenomes-Gn; EBG00001111733.
DR   EnsemblGenomes-Gn; EBG00001111734.
DR   EnsemblGenomes-Gn; EBG00001111735.
DR   EnsemblGenomes-Gn; EBG00001111736.
DR   EnsemblGenomes-Gn; EBG00001111737.
DR   EnsemblGenomes-Gn; EBG00001111738.
DR   EnsemblGenomes-Gn; EBG00001111739.
DR   EnsemblGenomes-Gn; EBG00001111740.
DR   EnsemblGenomes-Gn; EBG00001111741.
DR   EnsemblGenomes-Gn; EBG00001111742.
DR   EnsemblGenomes-Gn; EBG00001111743.
DR   EnsemblGenomes-Gn; EBG00001111744.
DR   EnsemblGenomes-Gn; EBG00001111745.
DR   EnsemblGenomes-Gn; EBG00001111746.
DR   EnsemblGenomes-Gn; EBG00001111747.
DR   EnsemblGenomes-Gn; EBG00001111748.
DR   EnsemblGenomes-Gn; EBG00001111749.
DR   EnsemblGenomes-Gn; EBG00001111750.
DR   EnsemblGenomes-Gn; EBG00001111751.
DR   EnsemblGenomes-Gn; EBG00001111752.
DR   EnsemblGenomes-Gn; EBG00001111753.
DR   EnsemblGenomes-Gn; EBG00001111754.
DR   EnsemblGenomes-Gn; EBG00001111755.
DR   EnsemblGenomes-Gn; EBG00001111756.
DR   EnsemblGenomes-Gn; EBG00001111757.
DR   EnsemblGenomes-Gn; EBG00001111758.
DR   EnsemblGenomes-Gn; EBG00001111759.
DR   EnsemblGenomes-Gn; EBG00001111760.
DR   EnsemblGenomes-Gn; EBG00001111761.
DR   EnsemblGenomes-Gn; EBG00001111762.
DR   EnsemblGenomes-Gn; EBG00001111763.
DR   EnsemblGenomes-Gn; EBG00001111764.
DR   EnsemblGenomes-Gn; EBG00001111765.
DR   EnsemblGenomes-Gn; EBG00001111766.
DR   EnsemblGenomes-Gn; EBG00001111767.
DR   EnsemblGenomes-Gn; EBG00001111768.
DR   EnsemblGenomes-Gn; EBG00001111769.
DR   EnsemblGenomes-Gn; EBG00001111770.
DR   EnsemblGenomes-Gn; EBG00001111771.
DR   EnsemblGenomes-Gn; EBG00001111772.
DR   EnsemblGenomes-Gn; EBG00001111773.
DR   EnsemblGenomes-Gn; EBG00001111774.
DR   EnsemblGenomes-Gn; EBG00001111775.
DR   EnsemblGenomes-Gn; EBG00001111776.
DR   EnsemblGenomes-Gn; EBG00001111777.
DR   EnsemblGenomes-Gn; EBG00001111778.
DR   EnsemblGenomes-Gn; EBG00001111779.
DR   EnsemblGenomes-Gn; EBG00001111780.
DR   EnsemblGenomes-Gn; EBG00001111781.
DR   EnsemblGenomes-Gn; EBG00001111782.
DR   EnsemblGenomes-Gn; EBG00001111783.
DR   EnsemblGenomes-Gn; EBG00001111784.
DR   EnsemblGenomes-Gn; EBG00001111785.
DR   EnsemblGenomes-Gn; EBG00001111786.
DR   EnsemblGenomes-Gn; EBG00001111787.
DR   EnsemblGenomes-Gn; EBG00001111788.
DR   EnsemblGenomes-Gn; EBG00001111789.
DR   EnsemblGenomes-Gn; EBG00001111790.
DR   EnsemblGenomes-Gn; EBG00001111791.
DR   EnsemblGenomes-Gn; EBG00001111792.
DR   EnsemblGenomes-Gn; EBG00001111793.
DR   EnsemblGenomes-Gn; EBG00001111794.
DR   EnsemblGenomes-Gn; EBG00001111795.
DR   EnsemblGenomes-Gn; EBG00001111796.
DR   EnsemblGenomes-Gn; EBG00001111797.
DR   EnsemblGenomes-Gn; EBG00001111798.
DR   EnsemblGenomes-Gn; EBG00001111799.
DR   EnsemblGenomes-Gn; EBG00001111800.
DR   EnsemblGenomes-Gn; EBG00001111801.
DR   EnsemblGenomes-Gn; EBG00001111802.
DR   EnsemblGenomes-Gn; EBG00001111803.
DR   EnsemblGenomes-Gn; EBG00001111804.
DR   EnsemblGenomes-Gn; EBG00001111805.
DR   EnsemblGenomes-Gn; EBG00001111806.
DR   EnsemblGenomes-Gn; EBG00001111807.
DR   EnsemblGenomes-Gn; EBG00001111808.
DR   EnsemblGenomes-Gn; EBG00001111809.
DR   EnsemblGenomes-Gn; EBG00001111810.
DR   EnsemblGenomes-Gn; EBG00001111811.
DR   EnsemblGenomes-Gn; EBG00001111812.
DR   EnsemblGenomes-Gn; EBG00001111813.
DR   EnsemblGenomes-Gn; EBG00001111814.
DR   EnsemblGenomes-Gn; EBG00001111815.
DR   EnsemblGenomes-Gn; EBG00001111816.
DR   EnsemblGenomes-Gn; EBG00001111817.
DR   EnsemblGenomes-Gn; EBG00001111818.
DR   EnsemblGenomes-Gn; EBG00001111819.
DR   EnsemblGenomes-Gn; EBG00001111820.
DR   EnsemblGenomes-Gn; EBG00001111821.
DR   EnsemblGenomes-Gn; EBG00001111822.
DR   EnsemblGenomes-Gn; EBG00001111823.
DR   EnsemblGenomes-Gn; EBG00001111824.
DR   EnsemblGenomes-Gn; EBG00001111825.
DR   EnsemblGenomes-Gn; EBG00001111826.
DR   EnsemblGenomes-Gn; EBG00001111827.
DR   EnsemblGenomes-Gn; EBG00001111828.
DR   EnsemblGenomes-Gn; EBG00001111829.
DR   EnsemblGenomes-Gn; EBG00001111830.
DR   EnsemblGenomes-Gn; EBG00001111831.
DR   EnsemblGenomes-Gn; EBG00001111832.
DR   EnsemblGenomes-Gn; EBG00001111833.
DR   EnsemblGenomes-Gn; EBG00001111834.
DR   EnsemblGenomes-Gn; EBG00001111835.
DR   EnsemblGenomes-Gn; EBG00001111836.
DR   EnsemblGenomes-Gn; EBG00001111837.
DR   EnsemblGenomes-Gn; EBG00001111838.
DR   EnsemblGenomes-Gn; EBG00001111839.
DR   EnsemblGenomes-Gn; EBG00001111840.
DR   EnsemblGenomes-Gn; EBG00001111841.
DR   EnsemblGenomes-Gn; EBG00001111842.
DR   EnsemblGenomes-Gn; EBG00001111843.
DR   EnsemblGenomes-Gn; EBG00001111844.
DR   EnsemblGenomes-Gn; EBG00001111845.
DR   EnsemblGenomes-Gn; EBG00001111846.
DR   EnsemblGenomes-Gn; EBG00001111847.
DR   EnsemblGenomes-Gn; EBG00001111848.
DR   EnsemblGenomes-Gn; EBG00001111849.
DR   EnsemblGenomes-Gn; EBG00001111850.
DR   EnsemblGenomes-Gn; EBG00001111851.
DR   EnsemblGenomes-Gn; EBG00001111852.
DR   EnsemblGenomes-Gn; EBG00001111853.
DR   EnsemblGenomes-Gn; EBG00001111854.
DR   EnsemblGenomes-Gn; EBG00001111855.
DR   EnsemblGenomes-Gn; EBG00001111856.
DR   EnsemblGenomes-Gn; EBG00001111857.
DR   EnsemblGenomes-Gn; EBG00001111858.
DR   EnsemblGenomes-Gn; EBG00001111859.
DR   EnsemblGenomes-Gn; EBG00001111860.
DR   EnsemblGenomes-Gn; EBG00001111861.
DR   EnsemblGenomes-Gn; EBG00001111862.
DR   EnsemblGenomes-Gn; EBG00001111863.
DR   EnsemblGenomes-Gn; EBG00001111864.
DR   EnsemblGenomes-Gn; EBG00001111865.
DR   EnsemblGenomes-Gn; EBG00001111866.
DR   EnsemblGenomes-Gn; EBG00001111867.
DR   EnsemblGenomes-Gn; EBG00001111868.
DR   EnsemblGenomes-Gn; EBG00001111869.
DR   EnsemblGenomes-Gn; EBG00001111870.
DR   EnsemblGenomes-Gn; EBG00001111871.
DR   EnsemblGenomes-Gn; EBG00001111872.
DR   EnsemblGenomes-Gn; EBG00001111873.
DR   EnsemblGenomes-Gn; EBG00001111874.
DR   EnsemblGenomes-Gn; EBG00001111875.
DR   EnsemblGenomes-Gn; EBG00001111876.
DR   EnsemblGenomes-Gn; EBG00001111877.
DR   EnsemblGenomes-Gn; EBG00001111878.
DR   EnsemblGenomes-Gn; EBG00001111879.
DR   EnsemblGenomes-Gn; EBG00001111880.
DR   EnsemblGenomes-Gn; EBG00001111881.
DR   EnsemblGenomes-Gn; EBG00001111882.
DR   EnsemblGenomes-Gn; EBG00001111883.
DR   EnsemblGenomes-Gn; EBG00001111884.
DR   EnsemblGenomes-Gn; EBG00001111885.
DR   EnsemblGenomes-Gn; EBG00001111886.
DR   EnsemblGenomes-Gn; EBG00001111887.
DR   EnsemblGenomes-Gn; EBG00001111888.
DR   EnsemblGenomes-Gn; EBG00001111889.
DR   EnsemblGenomes-Gn; EBG00001111890.
DR   EnsemblGenomes-Gn; EBG00001111891.
DR   EnsemblGenomes-Gn; EBG00001111892.
DR   EnsemblGenomes-Gn; EBG00001111893.
DR   EnsemblGenomes-Gn; EBG00001111894.
DR   EnsemblGenomes-Gn; EBG00001111895.
DR   EnsemblGenomes-Gn; EBG00001111896.
DR   EnsemblGenomes-Gn; EBG00001111897.
DR   EnsemblGenomes-Gn; EBG00001111898.
DR   EnsemblGenomes-Gn; EBG00001111899.
DR   EnsemblGenomes-Gn; EBG00001111900.
DR   EnsemblGenomes-Gn; EBG00001111901.
DR   EnsemblGenomes-Gn; EBG00001111902.
DR   EnsemblGenomes-Gn; EBG00001111903.
DR   EnsemblGenomes-Gn; EBG00001111904.
DR   EnsemblGenomes-Gn; EBG00001111905.
DR   EnsemblGenomes-Gn; EBG00001111906.
DR   EnsemblGenomes-Gn; EBG00001111907.
DR   EnsemblGenomes-Gn; EBG00001111908.
DR   EnsemblGenomes-Gn; EBG00001111909.
DR   EnsemblGenomes-Gn; EBG00001111910.
DR   EnsemblGenomes-Gn; EBG00001111911.
DR   EnsemblGenomes-Gn; EBG00001111912.
DR   EnsemblGenomes-Gn; EBG00001111913.
DR   EnsemblGenomes-Gn; EBG00001111914.
DR   EnsemblGenomes-Gn; EBG00001111915.
DR   EnsemblGenomes-Gn; EBG00001111916.
DR   EnsemblGenomes-Gn; EBG00001111917.
DR   EnsemblGenomes-Gn; EBG00001111918.
DR   EnsemblGenomes-Gn; EBG00001111919.
DR   EnsemblGenomes-Gn; EBG00001111920.
DR   EnsemblGenomes-Gn; EBG00001111921.
DR   EnsemblGenomes-Gn; EBG00001111922.
DR   EnsemblGenomes-Gn; EBG00001111923.
DR   EnsemblGenomes-Gn; EBG00001111924.
DR   EnsemblGenomes-Gn; EBG00001111925.
DR   EnsemblGenomes-Gn; EBG00001111926.
DR   EnsemblGenomes-Gn; EBG00001111927.
DR   EnsemblGenomes-Gn; EBG00001111928.
DR   EnsemblGenomes-Gn; EBG00001111929.
DR   EnsemblGenomes-Gn; EBG00001111930.
DR   EnsemblGenomes-Gn; EBG00001111931.
DR   EnsemblGenomes-Gn; EBG00001111932.
DR   EnsemblGenomes-Gn; EBG00001111933.
DR   EnsemblGenomes-Gn; EBG00001111934.
DR   EnsemblGenomes-Gn; EBG00001111935.
DR   EnsemblGenomes-Gn; EBG00001111936.
DR   EnsemblGenomes-Gn; EBG00001111937.
DR   EnsemblGenomes-Gn; EBG00001111938.
DR   EnsemblGenomes-Gn; EBG00001111939.
DR   EnsemblGenomes-Gn; EBG00001111940.
DR   EnsemblGenomes-Gn; EBG00001111941.
DR   EnsemblGenomes-Gn; EBG00001111942.
DR   EnsemblGenomes-Gn; EBG00001111943.
DR   EnsemblGenomes-Gn; EBG00001111944.
DR   EnsemblGenomes-Gn; EBG00001111945.
DR   EnsemblGenomes-Gn; EBG00001111946.
DR   EnsemblGenomes-Gn; EBG00001111947.
DR   EnsemblGenomes-Gn; EBG00001111948.
DR   EnsemblGenomes-Gn; EBG00001111949.
DR   EnsemblGenomes-Gn; EBG00001111950.
DR   EnsemblGenomes-Gn; SARI_00148.
DR   EnsemblGenomes-Gn; SARI_00149.
DR   EnsemblGenomes-Gn; SARI_00150.
DR   EnsemblGenomes-Gn; SARI_00151.
DR   EnsemblGenomes-Gn; SARI_00152.
DR   EnsemblGenomes-Gn; SARI_00234.
DR   EnsemblGenomes-Gn; SARI_00267.
DR   EnsemblGenomes-Gn; SARI_00268.
DR   EnsemblGenomes-Gn; SARI_00269.
DR   EnsemblGenomes-Gn; SARI_00465.
DR   EnsemblGenomes-Gn; SARI_00466.
DR   EnsemblGenomes-Gn; SARI_00467.
DR   EnsemblGenomes-Gn; SARI_00468.
DR   EnsemblGenomes-Gn; SARI_00472.
DR   EnsemblGenomes-Gn; SARI_00473.
DR   EnsemblGenomes-Gn; SARI_00505.
DR   EnsemblGenomes-Gn; SARI_00621.
DR   EnsemblGenomes-Gn; SARI_00658.
DR   EnsemblGenomes-Gn; SARI_00878.
DR   EnsemblGenomes-Gn; SARI_00880.
DR   EnsemblGenomes-Gn; SARI_00885.
DR   EnsemblGenomes-Gn; SARI_00902.
DR   EnsemblGenomes-Gn; SARI_00904.
DR   EnsemblGenomes-Gn; SARI_00993.
DR   EnsemblGenomes-Gn; SARI_00994.
DR   EnsemblGenomes-Gn; SARI_00995.
DR   EnsemblGenomes-Gn; SARI_01195.
DR   EnsemblGenomes-Gn; SARI_01196.
DR   EnsemblGenomes-Gn; SARI_01558.
DR   EnsemblGenomes-Gn; SARI_01559.
DR   EnsemblGenomes-Gn; SARI_01720.
DR   EnsemblGenomes-Gn; SARI_01736.
DR   EnsemblGenomes-Gn; SARI_01864.
DR   EnsemblGenomes-Gn; SARI_01926.
DR   EnsemblGenomes-Gn; SARI_02014.
DR   EnsemblGenomes-Gn; SARI_02181.
DR   EnsemblGenomes-Gn; SARI_02182.
DR   EnsemblGenomes-Gn; SARI_02183.
DR   EnsemblGenomes-Gn; SARI_02184.
DR   EnsemblGenomes-Gn; SARI_02185.
DR   EnsemblGenomes-Gn; SARI_02263.
DR   EnsemblGenomes-Gn; SARI_02264.
DR   EnsemblGenomes-Gn; SARI_02265.
DR   EnsemblGenomes-Gn; SARI_02266.
DR   EnsemblGenomes-Gn; SARI_02268.
DR   EnsemblGenomes-Gn; SARI_02269.
DR   EnsemblGenomes-Gn; SARI_02270.
DR   EnsemblGenomes-Gn; SARI_02406.
DR   EnsemblGenomes-Gn; SARI_02466.
DR   EnsemblGenomes-Gn; SARI_02689.
DR   EnsemblGenomes-Gn; SARI_02737.
DR   EnsemblGenomes-Gn; SARI_02746.
DR   EnsemblGenomes-Gn; SARI_02747.
DR   EnsemblGenomes-Gn; SARI_02750.
DR   EnsemblGenomes-Gn; SARI_02751.
DR   EnsemblGenomes-Gn; SARI_02752.
DR   EnsemblGenomes-Gn; SARI_03024.
DR   EnsemblGenomes-Gn; SARI_03025.
DR   EnsemblGenomes-Gn; SARI_03026.
DR   EnsemblGenomes-Gn; SARI_03156.
DR   EnsemblGenomes-Gn; SARI_03170.
DR   EnsemblGenomes-Gn; SARI_03277.
DR   EnsemblGenomes-Gn; SARI_03278.
DR   EnsemblGenomes-Gn; SARI_03279.
DR   EnsemblGenomes-Gn; SARI_03311.
DR   EnsemblGenomes-Gn; SARI_03476.
DR   EnsemblGenomes-Gn; SARI_03477.
DR   EnsemblGenomes-Gn; SARI_03478.
DR   EnsemblGenomes-Gn; SARI_03479.
DR   EnsemblGenomes-Gn; SARI_03519.
DR   EnsemblGenomes-Gn; SARI_03520.
DR   EnsemblGenomes-Gn; SARI_03521.
DR   EnsemblGenomes-Gn; SARI_03522.
DR   EnsemblGenomes-Gn; SARI_03526.
DR   EnsemblGenomes-Gn; SARI_03527.
DR   EnsemblGenomes-Gn; SARI_03529.
DR   EnsemblGenomes-Gn; SARI_03530.
DR   EnsemblGenomes-Gn; SARI_03531.
DR   EnsemblGenomes-Gn; SARI_03540.
DR   EnsemblGenomes-Gn; SARI_03668.
DR   EnsemblGenomes-Gn; SARI_03669.
DR   EnsemblGenomes-Gn; SARI_03670.
DR   EnsemblGenomes-Gn; SARI_03671.
DR   EnsemblGenomes-Gn; SARI_03719.
DR   EnsemblGenomes-Gn; SARI_03720.
DR   EnsemblGenomes-Gn; SARI_03721.
DR   EnsemblGenomes-Gn; SARI_03722.
DR   EnsemblGenomes-Gn; SARI_03755.
DR   EnsemblGenomes-Gn; SARI_03756.
DR   EnsemblGenomes-Gn; SARI_03757.
DR   EnsemblGenomes-Gn; SARI_03758.
DR   EnsemblGenomes-Gn; SARI_03759.
DR   EnsemblGenomes-Gn; SARI_03760.
DR   EnsemblGenomes-Gn; SARI_04000.
DR   EnsemblGenomes-Gn; SARI_04229.
DR   EnsemblGenomes-Gn; SARI_04230.
DR   EnsemblGenomes-Gn; SARI_04231.
DR   EnsemblGenomes-Gn; SARI_04234.
DR   EnsemblGenomes-Gn; SARI_04235.
DR   EnsemblGenomes-Gn; SARI_04236.
DR   EnsemblGenomes-Gn; SARI_04333.
DR   EnsemblGenomes-Gn; SARI_04335.
DR   EnsemblGenomes-Gn; SARI_04371.
DR   EnsemblGenomes-Gn; SARI_04416.
DR   EnsemblGenomes-Gn; SARI_04530.
DR   EnsemblGenomes-Gn; SARI_04613.
DR   EnsemblGenomes-Gn; SARI_04670.
DR   EnsemblGenomes-Gn; SARI_04671.
DR   EnsemblGenomes-Tr; EBT00001702881.
DR   EnsemblGenomes-Tr; EBT00001702883.
DR   EnsemblGenomes-Tr; EBT00001702885.
DR   EnsemblGenomes-Tr; EBT00001702886.
DR   EnsemblGenomes-Tr; EBT00001702892.
DR   EnsemblGenomes-Tr; EBT00001702894.
DR   EnsemblGenomes-Tr; EBT00001702895.
DR   EnsemblGenomes-Tr; EBT00001702896.
DR   EnsemblGenomes-Tr; EBT00001702898.
DR   EnsemblGenomes-Tr; EBT00001702899.
DR   EnsemblGenomes-Tr; EBT00001702900.
DR   EnsemblGenomes-Tr; EBT00001702901.
DR   EnsemblGenomes-Tr; EBT00001702903.
DR   EnsemblGenomes-Tr; EBT00001702906.
DR   EnsemblGenomes-Tr; EBT00001702908.
DR   EnsemblGenomes-Tr; EBT00001702910.
DR   EnsemblGenomes-Tr; EBT00001702911.
DR   EnsemblGenomes-Tr; EBT00001702912.
DR   EnsemblGenomes-Tr; EBT00001702913.
DR   EnsemblGenomes-Tr; EBT00001702914.
DR   EnsemblGenomes-Tr; EBT00001702915.
DR   EnsemblGenomes-Tr; EBT00001702916.
DR   EnsemblGenomes-Tr; EBT00001702917.
DR   EnsemblGenomes-Tr; EBT00001702918.
DR   EnsemblGenomes-Tr; EBT00001702919.
DR   EnsemblGenomes-Tr; EBT00001702920.
DR   EnsemblGenomes-Tr; EBT00001702921.
DR   EnsemblGenomes-Tr; EBT00001702922.
DR   EnsemblGenomes-Tr; EBT00001702923.
DR   EnsemblGenomes-Tr; EBT00001702924.
DR   EnsemblGenomes-Tr; EBT00001702925.
DR   EnsemblGenomes-Tr; EBT00001702926.
DR   EnsemblGenomes-Tr; EBT00001702927.
DR   EnsemblGenomes-Tr; EBT00001702928.
DR   EnsemblGenomes-Tr; EBT00001702929.
DR   EnsemblGenomes-Tr; EBT00001702930.
DR   EnsemblGenomes-Tr; EBT00001702931.
DR   EnsemblGenomes-Tr; EBT00001702932.
DR   EnsemblGenomes-Tr; EBT00001702933.
DR   EnsemblGenomes-Tr; EBT00001702934.
DR   EnsemblGenomes-Tr; EBT00001702935.
DR   EnsemblGenomes-Tr; EBT00001702936.
DR   EnsemblGenomes-Tr; EBT00001702937.
DR   EnsemblGenomes-Tr; EBT00001702938.
DR   EnsemblGenomes-Tr; EBT00001702939.
DR   EnsemblGenomes-Tr; EBT00001702940.
DR   EnsemblGenomes-Tr; EBT00001702941.
DR   EnsemblGenomes-Tr; EBT00001702942.
DR   EnsemblGenomes-Tr; EBT00001702943.
DR   EnsemblGenomes-Tr; EBT00001702944.
DR   EnsemblGenomes-Tr; EBT00001702945.
DR   EnsemblGenomes-Tr; EBT00001702946.
DR   EnsemblGenomes-Tr; EBT00001702947.
DR   EnsemblGenomes-Tr; EBT00001702948.
DR   EnsemblGenomes-Tr; EBT00001702949.
DR   EnsemblGenomes-Tr; EBT00001702950.
DR   EnsemblGenomes-Tr; EBT00001702951.
DR   EnsemblGenomes-Tr; EBT00001702952.
DR   EnsemblGenomes-Tr; EBT00001702953.
DR   EnsemblGenomes-Tr; EBT00001702954.
DR   EnsemblGenomes-Tr; EBT00001702955.
DR   EnsemblGenomes-Tr; EBT00001702956.
DR   EnsemblGenomes-Tr; EBT00001702957.
DR   EnsemblGenomes-Tr; EBT00001702958.
DR   EnsemblGenomes-Tr; EBT00001702959.
DR   EnsemblGenomes-Tr; EBT00001702960.
DR   EnsemblGenomes-Tr; EBT00001702961.
DR   EnsemblGenomes-Tr; EBT00001702962.
DR   EnsemblGenomes-Tr; EBT00001702963.
DR   EnsemblGenomes-Tr; EBT00001702964.
DR   EnsemblGenomes-Tr; EBT00001702965.
DR   EnsemblGenomes-Tr; EBT00001702966.
DR   EnsemblGenomes-Tr; EBT00001702967.
DR   EnsemblGenomes-Tr; EBT00001702968.
DR   EnsemblGenomes-Tr; EBT00001702969.
DR   EnsemblGenomes-Tr; EBT00001702970.
DR   EnsemblGenomes-Tr; EBT00001702971.
DR   EnsemblGenomes-Tr; EBT00001702972.
DR   EnsemblGenomes-Tr; EBT00001702973.
DR   EnsemblGenomes-Tr; EBT00001702974.
DR   EnsemblGenomes-Tr; EBT00001702975.
DR   EnsemblGenomes-Tr; EBT00001702976.
DR   EnsemblGenomes-Tr; EBT00001702977.
DR   EnsemblGenomes-Tr; EBT00001702978.
DR   EnsemblGenomes-Tr; EBT00001702979.
DR   EnsemblGenomes-Tr; EBT00001702980.
DR   EnsemblGenomes-Tr; EBT00001702981.
DR   EnsemblGenomes-Tr; EBT00001702982.
DR   EnsemblGenomes-Tr; EBT00001702983.
DR   EnsemblGenomes-Tr; EBT00001702984.
DR   EnsemblGenomes-Tr; EBT00001702985.
DR   EnsemblGenomes-Tr; EBT00001702986.
DR   EnsemblGenomes-Tr; EBT00001702987.
DR   EnsemblGenomes-Tr; EBT00001702988.
DR   EnsemblGenomes-Tr; EBT00001702989.
DR   EnsemblGenomes-Tr; EBT00001702990.
DR   EnsemblGenomes-Tr; EBT00001702991.
DR   EnsemblGenomes-Tr; EBT00001702992.
DR   EnsemblGenomes-Tr; EBT00001702993.
DR   EnsemblGenomes-Tr; EBT00001702994.
DR   EnsemblGenomes-Tr; EBT00001702995.
DR   EnsemblGenomes-Tr; EBT00001702996.
DR   EnsemblGenomes-Tr; EBT00001702997.
DR   EnsemblGenomes-Tr; EBT00001702998.
DR   EnsemblGenomes-Tr; EBT00001702999.
DR   EnsemblGenomes-Tr; EBT00001703000.
DR   EnsemblGenomes-Tr; EBT00001703001.
DR   EnsemblGenomes-Tr; EBT00001703002.
DR   EnsemblGenomes-Tr; EBT00001703003.
DR   EnsemblGenomes-Tr; EBT00001703004.
DR   EnsemblGenomes-Tr; EBT00001703005.
DR   EnsemblGenomes-Tr; EBT00001703006.
DR   EnsemblGenomes-Tr; EBT00001703007.
DR   EnsemblGenomes-Tr; EBT00001703008.
DR   EnsemblGenomes-Tr; EBT00001703009.
DR   EnsemblGenomes-Tr; EBT00001703010.
DR   EnsemblGenomes-Tr; EBT00001703011.
DR   EnsemblGenomes-Tr; EBT00001703012.
DR   EnsemblGenomes-Tr; EBT00001703013.
DR   EnsemblGenomes-Tr; EBT00001703014.
DR   EnsemblGenomes-Tr; EBT00001703015.
DR   EnsemblGenomes-Tr; EBT00001703016.
DR   EnsemblGenomes-Tr; EBT00001703017.
DR   EnsemblGenomes-Tr; EBT00001703018.
DR   EnsemblGenomes-Tr; EBT00001703019.
DR   EnsemblGenomes-Tr; EBT00001703020.
DR   EnsemblGenomes-Tr; EBT00001703021.
DR   EnsemblGenomes-Tr; EBT00001703022.
DR   EnsemblGenomes-Tr; EBT00001703023.
DR   EnsemblGenomes-Tr; EBT00001703024.
DR   EnsemblGenomes-Tr; EBT00001703025.
DR   EnsemblGenomes-Tr; EBT00001703026.
DR   EnsemblGenomes-Tr; EBT00001703027.
DR   EnsemblGenomes-Tr; EBT00001703028.
DR   EnsemblGenomes-Tr; EBT00001703029.
DR   EnsemblGenomes-Tr; EBT00001703030.
DR   EnsemblGenomes-Tr; EBT00001703031.
DR   EnsemblGenomes-Tr; EBT00001703032.
DR   EnsemblGenomes-Tr; EBT00001703033.
DR   EnsemblGenomes-Tr; EBT00001703034.
DR   EnsemblGenomes-Tr; EBT00001703035.
DR   EnsemblGenomes-Tr; EBT00001703036.
DR   EnsemblGenomes-Tr; EBT00001703037.
DR   EnsemblGenomes-Tr; EBT00001703038.
DR   EnsemblGenomes-Tr; EBT00001703039.
DR   EnsemblGenomes-Tr; EBT00001703040.
DR   EnsemblGenomes-Tr; EBT00001703041.
DR   EnsemblGenomes-Tr; EBT00001703042.
DR   EnsemblGenomes-Tr; EBT00001703043.
DR   EnsemblGenomes-Tr; EBT00001703044.
DR   EnsemblGenomes-Tr; EBT00001703045.
DR   EnsemblGenomes-Tr; EBT00001703046.
DR   EnsemblGenomes-Tr; EBT00001703047.
DR   EnsemblGenomes-Tr; EBT00001703048.
DR   EnsemblGenomes-Tr; EBT00001703049.
DR   EnsemblGenomes-Tr; EBT00001703050.
DR   EnsemblGenomes-Tr; EBT00001703051.
DR   EnsemblGenomes-Tr; EBT00001703052.
DR   EnsemblGenomes-Tr; EBT00001703053.
DR   EnsemblGenomes-Tr; EBT00001703054.
DR   EnsemblGenomes-Tr; EBT00001703055.
DR   EnsemblGenomes-Tr; EBT00001703056.
DR   EnsemblGenomes-Tr; EBT00001703057.
DR   EnsemblGenomes-Tr; EBT00001703058.
DR   EnsemblGenomes-Tr; EBT00001703059.
DR   EnsemblGenomes-Tr; EBT00001703060.
DR   EnsemblGenomes-Tr; EBT00001703061.
DR   EnsemblGenomes-Tr; EBT00001703062.
DR   EnsemblGenomes-Tr; EBT00001703063.
DR   EnsemblGenomes-Tr; EBT00001703064.
DR   EnsemblGenomes-Tr; EBT00001703065.
DR   EnsemblGenomes-Tr; EBT00001703066.
DR   EnsemblGenomes-Tr; EBT00001703067.
DR   EnsemblGenomes-Tr; EBT00001703068.
DR   EnsemblGenomes-Tr; EBT00001703069.
DR   EnsemblGenomes-Tr; EBT00001703070.
DR   EnsemblGenomes-Tr; EBT00001703071.
DR   EnsemblGenomes-Tr; EBT00001703072.
DR   EnsemblGenomes-Tr; EBT00001703073.
DR   EnsemblGenomes-Tr; EBT00001703074.
DR   EnsemblGenomes-Tr; EBT00001703075.
DR   EnsemblGenomes-Tr; EBT00001703076.
DR   EnsemblGenomes-Tr; EBT00001703077.
DR   EnsemblGenomes-Tr; EBT00001703078.
DR   EnsemblGenomes-Tr; EBT00001703079.
DR   EnsemblGenomes-Tr; EBT00001703080.
DR   EnsemblGenomes-Tr; EBT00001703081.
DR   EnsemblGenomes-Tr; EBT00001703082.
DR   EnsemblGenomes-Tr; EBT00001703083.
DR   EnsemblGenomes-Tr; EBT00001703084.
DR   EnsemblGenomes-Tr; EBT00001703085.
DR   EnsemblGenomes-Tr; EBT00001703086.
DR   EnsemblGenomes-Tr; EBT00001703087.
DR   EnsemblGenomes-Tr; EBT00001703088.
DR   EnsemblGenomes-Tr; EBT00001703089.
DR   EnsemblGenomes-Tr; EBT00001703090.
DR   EnsemblGenomes-Tr; EBT00001703091.
DR   EnsemblGenomes-Tr; EBT00001703092.
DR   EnsemblGenomes-Tr; EBT00001703093.
DR   EnsemblGenomes-Tr; EBT00001703094.
DR   EnsemblGenomes-Tr; EBT00001703095.
DR   EnsemblGenomes-Tr; EBT00001703096.
DR   EnsemblGenomes-Tr; EBT00001703097.
DR   EnsemblGenomes-Tr; EBT00001703098.
DR   EnsemblGenomes-Tr; EBT00001703099.
DR   EnsemblGenomes-Tr; EBT00001703100.
DR   EnsemblGenomes-Tr; EBT00001703101.
DR   EnsemblGenomes-Tr; EBT00001703102.
DR   EnsemblGenomes-Tr; EBT00001703103.
DR   EnsemblGenomes-Tr; EBT00001703104.
DR   EnsemblGenomes-Tr; EBT00001703105.
DR   EnsemblGenomes-Tr; EBT00001703106.
DR   EnsemblGenomes-Tr; EBT00001703107.
DR   EnsemblGenomes-Tr; EBT00001703108.
DR   EnsemblGenomes-Tr; EBT00001703109.
DR   EnsemblGenomes-Tr; EBT00001703110.
DR   EnsemblGenomes-Tr; EBT00001703111.
DR   EnsemblGenomes-Tr; EBT00001703112.
DR   EnsemblGenomes-Tr; EBT00001703113.
DR   EnsemblGenomes-Tr; EBT00001703114.
DR   EnsemblGenomes-Tr; EBT00001703115.
DR   EnsemblGenomes-Tr; EBT00001703116.
DR   EnsemblGenomes-Tr; EBT00001703117.
DR   EnsemblGenomes-Tr; EBT00001703118.
DR   EnsemblGenomes-Tr; EBT00001703119.
DR   EnsemblGenomes-Tr; EBT00001703120.
DR   EnsemblGenomes-Tr; EBT00001703121.
DR   EnsemblGenomes-Tr; EBT00001703122.
DR   EnsemblGenomes-Tr; EBT00001703123.
DR   EnsemblGenomes-Tr; SARI_00148-1.
DR   EnsemblGenomes-Tr; SARI_00149-1.
DR   EnsemblGenomes-Tr; SARI_00150-1.
DR   EnsemblGenomes-Tr; SARI_00151-1.
DR   EnsemblGenomes-Tr; SARI_00152-1.
DR   EnsemblGenomes-Tr; SARI_00234-1.
DR   EnsemblGenomes-Tr; SARI_00267-1.
DR   EnsemblGenomes-Tr; SARI_00268-1.
DR   EnsemblGenomes-Tr; SARI_00269-1.
DR   EnsemblGenomes-Tr; SARI_00465-1.
DR   EnsemblGenomes-Tr; SARI_00466-1.
DR   EnsemblGenomes-Tr; SARI_00467-1.
DR   EnsemblGenomes-Tr; SARI_00468-1.
DR   EnsemblGenomes-Tr; SARI_00472-1.
DR   EnsemblGenomes-Tr; SARI_00473-1.
DR   EnsemblGenomes-Tr; SARI_00505-1.
DR   EnsemblGenomes-Tr; SARI_00621-1.
DR   EnsemblGenomes-Tr; SARI_00658-1.
DR   EnsemblGenomes-Tr; SARI_00878-1.
DR   EnsemblGenomes-Tr; SARI_00880-1.
DR   EnsemblGenomes-Tr; SARI_00885-1.
DR   EnsemblGenomes-Tr; SARI_00902-1.
DR   EnsemblGenomes-Tr; SARI_00904-1.
DR   EnsemblGenomes-Tr; SARI_00993-1.
DR   EnsemblGenomes-Tr; SARI_00994-1.
DR   EnsemblGenomes-Tr; SARI_00995-1.
DR   EnsemblGenomes-Tr; SARI_01195-1.
DR   EnsemblGenomes-Tr; SARI_01196-1.
DR   EnsemblGenomes-Tr; SARI_01558-1.
DR   EnsemblGenomes-Tr; SARI_01559-1.
DR   EnsemblGenomes-Tr; SARI_01720-1.
DR   EnsemblGenomes-Tr; SARI_01736-1.
DR   EnsemblGenomes-Tr; SARI_01864-1.
DR   EnsemblGenomes-Tr; SARI_01926-1.
DR   EnsemblGenomes-Tr; SARI_02014-1.
DR   EnsemblGenomes-Tr; SARI_02181-1.
DR   EnsemblGenomes-Tr; SARI_02182-1.
DR   EnsemblGenomes-Tr; SARI_02183-1.
DR   EnsemblGenomes-Tr; SARI_02184-1.
DR   EnsemblGenomes-Tr; SARI_02185-1.
DR   EnsemblGenomes-Tr; SARI_02263-1.
DR   EnsemblGenomes-Tr; SARI_02264-1.
DR   EnsemblGenomes-Tr; SARI_02265-1.
DR   EnsemblGenomes-Tr; SARI_02266-1.
DR   EnsemblGenomes-Tr; SARI_02268-1.
DR   EnsemblGenomes-Tr; SARI_02269-1.
DR   EnsemblGenomes-Tr; SARI_02270-1.
DR   EnsemblGenomes-Tr; SARI_02406-1.
DR   EnsemblGenomes-Tr; SARI_02466-1.
DR   EnsemblGenomes-Tr; SARI_02689-1.
DR   EnsemblGenomes-Tr; SARI_02737-1.
DR   EnsemblGenomes-Tr; SARI_02746-1.
DR   EnsemblGenomes-Tr; SARI_02747-1.
DR   EnsemblGenomes-Tr; SARI_02750-1.
DR   EnsemblGenomes-Tr; SARI_02751-1.
DR   EnsemblGenomes-Tr; SARI_02752-1.
DR   EnsemblGenomes-Tr; SARI_03024-1.
DR   EnsemblGenomes-Tr; SARI_03025-1.
DR   EnsemblGenomes-Tr; SARI_03026-1.
DR   EnsemblGenomes-Tr; SARI_03156-1.
DR   EnsemblGenomes-Tr; SARI_03170-1.
DR   EnsemblGenomes-Tr; SARI_03277-1.
DR   EnsemblGenomes-Tr; SARI_03278-1.
DR   EnsemblGenomes-Tr; SARI_03279-1.
DR   EnsemblGenomes-Tr; SARI_03311-1.
DR   EnsemblGenomes-Tr; SARI_03476-1.
DR   EnsemblGenomes-Tr; SARI_03477-1.
DR   EnsemblGenomes-Tr; SARI_03478-1.
DR   EnsemblGenomes-Tr; SARI_03479-1.
DR   EnsemblGenomes-Tr; SARI_03519-1.
DR   EnsemblGenomes-Tr; SARI_03520-1.
DR   EnsemblGenomes-Tr; SARI_03521-1.
DR   EnsemblGenomes-Tr; SARI_03522-1.
DR   EnsemblGenomes-Tr; SARI_03526-1.
DR   EnsemblGenomes-Tr; SARI_03527-1.
DR   EnsemblGenomes-Tr; SARI_03529-1.
DR   EnsemblGenomes-Tr; SARI_03530-1.
DR   EnsemblGenomes-Tr; SARI_03531-1.
DR   EnsemblGenomes-Tr; SARI_03540-1.
DR   EnsemblGenomes-Tr; SARI_03668-1.
DR   EnsemblGenomes-Tr; SARI_03669-1.
DR   EnsemblGenomes-Tr; SARI_03670-1.
DR   EnsemblGenomes-Tr; SARI_03671-1.
DR   EnsemblGenomes-Tr; SARI_03719-1.
DR   EnsemblGenomes-Tr; SARI_03720-1.
DR   EnsemblGenomes-Tr; SARI_03721-1.
DR   EnsemblGenomes-Tr; SARI_03722-1.
DR   EnsemblGenomes-Tr; SARI_03755-1.
DR   EnsemblGenomes-Tr; SARI_03756-1.
DR   EnsemblGenomes-Tr; SARI_03757-1.
DR   EnsemblGenomes-Tr; SARI_03758-1.
DR   EnsemblGenomes-Tr; SARI_03759-1.
DR   EnsemblGenomes-Tr; SARI_03760-1.
DR   EnsemblGenomes-Tr; SARI_04000-1.
DR   EnsemblGenomes-Tr; SARI_04229-1.
DR   EnsemblGenomes-Tr; SARI_04230-1.
DR   EnsemblGenomes-Tr; SARI_04231-1.
DR   EnsemblGenomes-Tr; SARI_04234-1.
DR   EnsemblGenomes-Tr; SARI_04235-1.
DR   EnsemblGenomes-Tr; SARI_04236-1.
DR   EnsemblGenomes-Tr; SARI_04333-1.
DR   EnsemblGenomes-Tr; SARI_04335-1.
DR   EnsemblGenomes-Tr; SARI_04371-1.
DR   EnsemblGenomes-Tr; SARI_04416-1.
DR   EnsemblGenomes-Tr; SARI_04530-1.
DR   EnsemblGenomes-Tr; SARI_04613-1.
DR   EnsemblGenomes-Tr; SARI_04670-1.
DR   EnsemblGenomes-Tr; SARI_04671-1.
DR   EuropePMC; PMC2668413; 19218378.
DR   EuropePMC; PMC3133335; 21602358.
DR   EuropePMC; PMC3158058; 21876672.
DR   EuropePMC; PMC3220660; 21942987.
DR   EuropePMC; PMC3356390; 22623967.
DR   EuropePMC; PMC3411829; 22880062.
DR   EuropePMC; PMC3732745; 22983040.
DR   EuropePMC; PMC4136169; 24899022.
DR   EuropePMC; PMC4511000; 26203341.
DR   EuropePMC; PMC4549013; 26303940.
DR   EuropePMC; PMC4583067; 26408088.
DR   EuropePMC; PMC5261728; 28118395.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00106; RNAI.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01384; InvR.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01387; isrC.
DR   RFAM; RF01388; isrD.
DR   RFAM; RF01391; isrH.
DR   RFAM; RF01392; isrI.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01395; isrL.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01397; isrO.
DR   RFAM; RF01399; isrQ.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01402; STnc150.
DR   RFAM; RF01403; STnc290.
DR   RFAM; RF01404; STnc440.
DR   RFAM; RF01406; STnc500.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01409; STnc250.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01795; FourU.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01804; Lambda_thermo.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02049; STnc460.
DR   RFAM; RF02050; STnc470.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02056; STnc390.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02059; STnc50.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02062; STnc361.
DR   RFAM; RF02063; STnc350.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02067; STnc310.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02070; STnc300.
DR   RFAM; RF02071; STnc280.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02075; STnc230.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02077; STnc220.
DR   RFAM; RF02078; STnc210.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02088; STnc510.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000880.
DR   SILVA-SSU; CP000880.
DR   StrainInfo; 698081; 0.
XX
CC   Salmonella enterica subspecies IIIa (Arizonae) serovar
CC   62:z4,z23:--Most bacteria in the species S. enterica belong to one
CC   of seven subspecies; all but subspecies I normally grow only in
CC   cold-blooded animals. Subspecies IIIa (S. Arizonae) is naturally
CC   found in reptiles, but also causes outbreaks of salmonellosis in
CC   turkeys and sheep and can occasionally produce both gastroenteritis
CC   and serious disseminated disease in humans. Many human infections
CC   can be traced to contact with reptiles or ingestion of various
CC   reptile products, particularly from rattlesnakes. Fewer than ten
CC   cases in humans are typically reported in the US each year.
CC   The strain of S. Arizonae (62:z4,z23:-) being sequenced is
CC   CDC346-86; it was named RSK2980 by R.K. Selander and is strain
CC   SARC5 of the Salmonella Reference C set. This serovar is of
CC   interest because of its taxonomic position. It appears to be the
CC   most divergent subspecies among the S. enterica. It can be obtained
CC   from the American Type Culture Collection as ATCC BAA-731, or the
CC   Salmonella Genetic Stock Centre as SGSC4693. The genome was
CC   sequenced to 8X coverage, using plasmid and fosmid libraries and
CC   was finished to an error rate of less than 1 per 10,000 bases.
CC   Automated annotation was performed and manual annotation will
CC   continue in the labs of Michael McClelland and Kenneth Sanderson.
CC   The National Institute of Allergy and Infectious Diseases (NIAID),
CC   National Institutes of Health (NIH) has funded this project.
CC   Coding sequences below are predicted using GeneMark v3.3 and
CC   Glimmer2  v2.13.Intergenic regions not spanned by GeneMark and
CC   Glimmer2 were blasted against NCBI's non-redundant (NR) database
CC   and predictions generated based on protein alignments. RNA genes
CC   were determined  using tRNAscan-SE 1.23 or Rfam v8.0. This sequence
CC   was finished as follows unless otherwise noted: all regions were
CC   double stranded, sequenced with an alternate chemistries or covered
CC   by high quality data(i.e., phred quality >=30);an attempt was made
CC   to resolve all sequencing problems, such as compressions and
CC   repeats; all regions were covered by sequence from more than one
CC   m13 subclone.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4600800
FT                   /organism="Salmonella enterica subsp. arizonae serovar
FT                   62:z4,z23:-"
FT                   /strain="RSK2980"
FT                   /mol_type="genomic DNA"
FT                   /serovar="62:z4,z23:--"
FT                   /db_xref="taxon:41514"
FT                   /culture_collection="ATCC:BAA-731"
FT   unsure          3
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            978..2318
FT                   /locus_tag="SARI_00001"
FT   CDS_pept        978..2318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00001"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2961 8.8e-243 ygcY; putative
FT                   D-glucarate dehydratase K01706; COG: COG4948
FT                   L-alanine-DL-glutamate epimerase and related enzymes of
FT                   enolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19955"
FT                   /db_xref="GOA:A9MEG1"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A9MEG1"
FT                   /inference="protein motif:HMMPanther:IPR001354"
FT                   /inference="protein motif:HMMPfam:IPR013341"
FT                   /inference="protein motif:HMMPfam:IPR013342"
FT                   /inference="protein motif:ScanRegExp:IPR001354"
FT                   /inference="similar to AA sequence:INSD:AAL21841.1"
FT                   /protein_id="ABX19955.1"
FT                   /translation="MTRQSSPVITDMKVIPVAGHDSMLLNIGGAHNAYFTRNIVVLTDN
FT                   AGHTGVGEAPGGEVIYQTLVDAIPMVLGQEVARLNSVVQRVHKGNQAADFDTFGKGAWT
FT                   FELRVNAVAALEAALLDLLGQALNVPVCELLGPGKQRDAVTVLGYLFYIGDRTKTELPY
FT                   LESTPGSHEWYRLRHQEALNSDTVVRLAEASQDRYGFKDFKLKGGVLPGEQEIDTVRAL
FT                   KKRFPDARITVDPNGAWLLDEAIALCKGLNDVLAYAEDPCGAEQGFSGREVMAEFRRAT
FT                   GLPVATNMIATNWREMGHAVMLNAVDIPLADPHFWTLSGAVRVAQLCDDWGLTWGCHSN
FT                   NHFDISLAMFTHVGAAAPGKPTAIDTHWIWQEGDCRLTKNPLEIKNGTIAVPDAPGLGV
FT                   ELDWEQVRKAHDAYKKLPGGARNDAGPMQYLIPGWTFDRKRPVFGRH"
FT   gene            2375..3679
FT                   /locus_tag="SARI_00002"
FT   CDS_pept        2375..3679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00002"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2900 8.7e-236 gudD; D-glucarate
FT                   dehydratase K01706; COG: COG4948 L-alanine-DL-glutamate
FT                   epimerase and related enzymes of enolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19956"
FT                   /db_xref="GOA:A9MEG2"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A9MEG2"
FT                   /inference="protein motif:HMMPanther:IPR001354"
FT                   /inference="protein motif:HMMPfam:IPR013342"
FT                   /inference="similar to AA sequence:INSD:AAX66806.1"
FT                   /protein_id="ABX19956.1"
FT                   /translation="MQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPG
FT                   GEKIRKTLEDAIPLVMGKTLGEYKNVLTAVRNQFADRDAGGRGLQTFDLRTTIHVVTGI
FT                   EAAMLDLLGQHLGVNVASLLGDGQQRSEVEMLGYLFFVGNRKATPLPYQSQPDEQCDWY
FT                   RLRHEEAMTPETVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAKRFPNARVTL
FT                   DPNGAWSLNEAINIGRYLKGSLAYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIAT
FT                   DWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISLAMFT
FT                   HVAAAAPGKITAIDTHWIWQEGNQRLTKEPFEIKGGMVQVPAKPGLGVEIDMDQVMKAH
FT                   ELYQKHGLGARDDAMGMQYLIPGWTFDNKRPCMVR"
FT   gene            3757..4899
FT                   /locus_tag="SARI_00003"
FT   CDS_pept        3757..4899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00003"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t2868 3.3e-188 glycerate kinase K00865;
FT                   COG: COG1929 Glycerate kinase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19957"
FT                   /db_xref="GOA:A9MEG3"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A9MEG3"
FT                   /inference="protein motif:HMMPanther:IPR004381"
FT                   /inference="protein motif:HMMPfam:IPR004381"
FT                   /inference="protein motif:HMMTigr:IPR004381"
FT                   /inference="similar to AA sequence:INSD:CAD06073.1"
FT                   /protein_id="ABX19957.1"
FT                   /translation="MKIVIAPDSYKESLSALEVATAIEQGFREIWPDADYLKLPLADGG
FT                   EGTVEAMVEATAGRIVHVDVTGPLGRRVNAFYGLSGDARSAFIEMAAASGLEQVPPALR
FT                   DPLKTTSWGTGELIRHALDAGVEHIIVGIGGSATNDGGAGMMQALGARLRDAQGNDIAQ
FT                   GGIGLETLASIDISGLDKRLSACRIDVACDVTNPLTGKEGASAVFGPQKGATPEMIERL
FT                   DTALIRYAHLIARELHVDVLDLAGGGAAGGMGAALYAFCGAQLRRGIEIVTDALHLEER
FT                   LANADLVITGEGRIDSQTIHGKVPIGVANIAKRHNKPVIGIAGSLTADVGVVHEHGLDA
FT                   VFSVIYTICTLEEALDNAAENVRMTARNVAATLKIGSLLR"
FT   gene            complement(5009..7765)
FT                   /locus_tag="SARI_00004"
FT   CDS_pept        complement(5009..7765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2958 0. barA; sensory histidine kinase
FT                   K07678; COG: COG4999 Uncharacterized domain of BarA-like
FT                   signal transduction histidine kinases; Psort location:
FT                   CytoplasmicMembrane, score:7.88"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19958"
FT                   /db_xref="GOA:A9MEG4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR019247"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9MEG4"
FT                   /inference="protein motif:BlastProDom:IPR001789"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMPfam:IPR003661"
FT                   /inference="protein motif:HMMPfam:IPR008207"
FT                   /inference="protein motif:HMMPIR:IPR009184"
FT                   /inference="protein motif:HMMSmart:IPR001789"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR003660"
FT                   /inference="protein motif:HMMSmart:IPR003661"
FT                   /inference="protein motif:HMMSmart:IPR008207"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="protein motif:superfamily:IPR008207"
FT                   /inference="protein motif:superfamily:IPR009082"
FT                   /inference="protein motif:superfamily:IPR011006"
FT                   /protein_id="ABX19958.1"
FT                   /translation="MTNYSLRARMMILILAPTVLIGLLLSIFFVVHRYNDLQRQLEDAG
FT                   SSIIEPLAVSSEYGMNLQNRESIGQLISVLHRRHSDIVRAISVYDDHNRLFVTSNFHLD
FT                   PSQMQLPAGAPFPRHLSVDRHGDIMILRTPIISESYSPDESAIADAKNTKNMLGYVALE
FT                   LDLKSVRLQQYKEIFISSVMMLFCIGIALIFGWRLMRDVTGPIRNMVNTVDRIRRGQLD
FT                   SRVEGFMLGELDMLKNGINSMAMSLAAYHEEMQHNIDQATSDLRETLEQMEIQNVELDL
FT                   AKKRAQEAARIKSEFLANMSHELRTPLNGVIGFTRLTLKTELNPTQRDHLNTIERSANN
FT                   LLAIINDVLDFSKLEAGKLILESIPFPLRNTLDEVVTLLAHSSHDKGLELTLNIKNDVP
FT                   DNVIGDPLRLQQVITNLVGNAIKFTESGNIDILVEKRALSNTKVQIEVQIRDTGIGIPE
FT                   RDQSRLFQAFRQADASISRRHGGTGLGLVITQKLVNEMGGDISFHSQPNRGSTFWFHIN
FT                   LDLNPNVIIDGPSTACLAGKRLAYVEPNATAAQCTLDLLSDTPVEVVYSPTFSALPLAH
FT                   YDIMILSVPVTFREPLTMQHERLAKAASMTDFLLLALPCHAQINAEKLKQGGAAACLLK
FT                   PLTSTRLLPALTEYCQLNHHPEPLLMDASKIAMTVMAVDDNPANLKLIGALLEDKVQHV
FT                   ELCDSGHQAVDRAKQMQFDLILMDIQMPDMDGIRACELIHQLPHQQQTPVIAVTAHAMA
FT                   GQKEKLLSAGMNDYLAKPIEEEKLHNLLLRYKPGANVAARLMAPEPAEFIFNPNATLDW
FT                   QLALRQAAGKPDLARDMLQMLIDFLPEVRNKIEEQLVGENPNGLVDLVHKLHGSCGYSG
FT                   VPRMKNLCQLIEQQLRSGVHEEELEPEFLELLDEMDNVAREAKKILG"
FT   gene            7823..9118
FT                   /locus_tag="SARI_00005"
FT   CDS_pept        7823..9118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA2822 4.7e-221 ygcA; putative RNA
FT                   methyltransferase K03215; COG: COG2265 SAM-dependent
FT                   methyltransferases related to tRNA
FT                   (uracil-5-)-methyltransferase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19959"
FT                   /db_xref="GOA:A9MEG5"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:A9MEG5"
FT                   /inference="protein motif:HMMPfam:IPR002792"
FT                   /inference="protein motif:HMMPfam:IPR010280"
FT                   /inference="protein motif:HMMTigr:IPR001566"
FT                   /inference="protein motif:ScanRegExp:IPR010280"
FT                   /inference="similar to AA sequence:SwissProt:Q5PEJ4"
FT                   /protein_id="ABX19959.1"
FT                   /translation="MAQFYSAKRRVTTRQIITVKVNDLDPFGQGVARHNGKALFIPGLL
FT                   PEESAEVIITEDKKQFSRARVLRRLNDSPERETPRCPHFGVCGGCQQQHIGIALQQRSK
FT                   SAALARLMKHEVNDIIAGAPWGYRRRARLSLNCLSDKTLQMGFRKAGSNDIVNVEQCPI
FT                   LAPQLEALLPRIRACLTSLHGTRHLGHVELVQAGNGTLMILRHTAPLSAADKEKLERFS
FT                   HSEGLSLFLAPFSEILESVTGETPWYDSHGLRLAFSPRDFIQVNEAVNQQMVARALEWL
FT                   DVRAEDRVLDLFCGMGNFTLPLATSAASVVGVEGVPALVEKGRENAIRNGLHNVTFFHE
FT                   NLEEDVTKQPWAKNGFDKVLLDPARAGATGVMRHIIKLKPIRVVYVSCNPATLARDSEA
FT                   LVNAGYEATRLAMLDMFPHTGHLESMVLFVRM"
FT   gene            9170..11404
FT                   /locus_tag="SARI_00006"
FT   CDS_pept        9170..11404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t2865 0. relA; GTP pyrophosphokinase
FT                   K00951; COG: COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19960"
FT                   /db_xref="GOA:A9MEG6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A9MEG6"
FT                   /inference="protein motif:Gene3D:IPR012675"
FT                   /inference="protein motif:HMMPfam:IPR002912"
FT                   /inference="protein motif:HMMPfam:IPR004095"
FT                   /inference="protein motif:HMMPfam:IPR007685"
FT                   /inference="protein motif:HMMTigr:IPR004811"
FT                   /inference="protein motif:superfamily:IPR008921"
FT                   /inference="protein motif:superfamily:IPR012676"
FT                   /protein_id="ABX19960.1"
FT                   /translation="MVAVRSAHINKAGEFDPKKWIASLGISSQQSCERLAETWAYCLQQ
FT                   TQGHPDADLLLWRGVEMVEILSTLSMDIDTLRAALLFPLADANVVSEDVLRESVGKSIV
FT                   TLIHGVRDMAAIRQLNATHNDSVSSEQVDNVRRMLLAMVDDFRCVVIKLAERIAHLREV
FT                   KEAPEDERVLAAKECTNIYAPLANRLGIGQLKWELEDYCFRYLHPAEYKRIAKLLHERR
FT                   IDREHYIEEFVGHLRAEMKNEGVLAEVYGRPKHIYSIWRKMQKKHLAFDELFDVRAVRI
FT                   VAERLQDCYAALGIVHTHYRHLPDEFDDYVANPKPNGYQSIHTVVLGPGGKTVEIQIRT
FT                   KQMHEDAELGVAAHWKYKEGAASGGVRSGHEDRIAWLRKLIAWQEEMADSGEMLDEVRS
FT                   QVFDDRVYVFTPKGDVVDLPAGSTPLDFAYHIHSDVGHRCIGAKIGGRIVPFTYQLQMG
FT                   DQVEIITQKQPNPSRDWLNPNLGYVTTSRGRSKIHAWFRKQDRDKNILAGRQILDDELA
FT                   HLGISLKEAEKHLLPRYNFNELEELLAAIGGGDIRLNQMVNFLQSQFNKPSAEEQDAAA
FT                   LKQLQQKTYAPQNRRKDDGRVVVEGVGNLMHHIARCCQPIPGDEIVGFITQGRGISVHR
FT                   ADCEQLAELRSHAPERIVEAVWGESYSAGYSLVVRVTANDRSGLLRDITTILANEKVNV
FT                   LGVASRSDIKQQIATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGN"
FT   gene            11437..12270
FT                   /locus_tag="SARI_00007"
FT   CDS_pept        11437..12270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pha:PSHAa0740 4.2e-62 mazG; nucleoside
FT                   triphosphate pyrophosphohydrolase, non-specific K02428;
FT                   COG: COG1694 Predicted pyrophosphatase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19961"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF09"
FT                   /inference="protein motif:HMMPfam:IPR004518"
FT                   /inference="protein motif:HMMPIR:IPR012199"
FT                   /inference="protein motif:HMMPIR:IPR012231"
FT                   /inference="protein motif:HMMTigr:IPR011551"
FT                   /inference="protein motif:superfamily:IPR011029"
FT                   /inference="similar to AA sequence:REFSEQ:YP_151973.1"
FT                   /protein_id="ABX19961.1"
FT                   /translation="MALYSSGLRFQDILMNQIDRLLNIMQRLRDPEGGCPWDKEQTFAS
FT                   IAPYTLEETYEVLDAIAREDFDDLRGELGDLLFQVVFYAQMAQEEGLFDFNDICAAISD
FT                   KLERRHPHVFGALSAENSEEVLARWEQIKTEERAQKAQHSALDDIPRSLPALMRAQKIQ
FT                   KRCSNVGFDWTTLGPVVDKVYEEIDEVMFEARQAVIDQAKLEEEMGDLLFATVNMARHL
FT                   GTKAELALQKANDKFERRFREVERIVAARGLEMTGVDLETMEEVWQEVKRQEIDL"
FT   gene            12498..14135
FT                   /locus_tag="SARI_00008"
FT   CDS_pept        12498..14135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA2810 2.3e-290 pyrG; CTP synthetase
FT                   K01937; COG: COG0504 CTP synthase (UTP-ammonia lyase);
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19962"
FT                   /db_xref="GOA:A9MF10"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF10"
FT                   /inference="protein motif:HMMPanther:IPR004468"
FT                   /inference="protein motif:HMMPfam:IPR000991"
FT                   /inference="protein motif:HMMPfam:IPR004468"
FT                   /inference="protein motif:HMMTigr:IPR004468"
FT                   /inference="protein motif:ScanRegExp:IPR012998"
FT                   /inference="similar to AA sequence:REFSEQ:YP_151972.1"
FT                   /protein_id="ABX19962.1"
FT                   /translation="MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYI
FT                   NVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKER
FT                   RGDYLGATVQVIPHITNAIKERVLEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQMAVE
FT                   IGREHTLFMHLTLVPYMAAAGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERA
FT                   KIALFCNVPEKAVISLKDVDSIYKIPGLLKSQGLDDYICKRFSLNCPEANLSEWEQVIY
FT                   EEANPAGEVTIGMVGKYIELPDAYKSVIEALKHGGLKNRVTVNIKLIDSQDVETRGVEI
FT                   LKDLDAILIPGGFGYRGVEGKIATARYARENNIPYLGICLGMQVALIEFARNVAGMDNA
FT                   NSTEFVPDCKYPVVALITEWRDEDGNVEVRSEKSDLGGTMRLGAQQCQLNDDSLVRQLY
FT                   GAPTIVERHRHRYEVNNMLLKQIEAAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPE
FT                   FTSTPRDGHPLFAGFVKAASEHQKRQAK"
FT   gene            14218..15516
FT                   /locus_tag="SARI_00009"
FT   CDS_pept        14218..15516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t2853 4.4e-225 eno; enolase K01689; COG:
FT                   COG0148 Enolase; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19963"
FT                   /db_xref="GOA:A9MF11"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF11"
FT                   /inference="protein motif:BlastProDom:IPR000941"
FT                   /inference="protein motif:FPrintScan:IPR000941"
FT                   /inference="protein motif:HMMPanther:IPR000941"
FT                   /inference="protein motif:HMMPfam:IPR000941"
FT                   /inference="protein motif:HMMTigr:IPR000941"
FT                   /inference="protein motif:ScanRegExp:IPR000941"
FT                   /inference="similar to AA sequence:INSD:AAX66792.1"
FT                   /protein_id="ABX19963.1"
FT                   /translation="MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGS
FT                   REALELRDGDKSRFLGKGVTKAVGAVNGPIAQAILGKDAKDQAGIDKIMIDLDGTENKS
FT                   NFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNN
FT                   VDIQEFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKGKGMNTAVGDEGGYAPNLGSNAEA
FT                   LAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELT
FT                   KQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSIL
FT                   IKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSR
FT                   SDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA"
FT   gene            15649..16842
FT                   /locus_tag="SARI_00010"
FT   CDS_pept        15649..16842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00010"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG04673 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19964"
FT                   /db_xref="GOA:A9MF12"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF12"
FT                   /inference="protein motif:HMMPfam:IPR002559"
FT                   /inference="protein motif:superfamily:IPR012337"
FT                   /inference="similar to AA sequence:REFSEQ:YP_540438.1"
FT                   /protein_id="ABX19964.1"
FT                   /translation="MPARQVCQNFFRDALAPLHKYRQNALLDATIALINGASLTLTSIG
FT                   RYLPGTAQVKNKIKRVDRLRGNESLHRNIPLIFRNIIAMLTSQLSLCVIAVDWSGYPSQ
FT                   EHHVLRASLICDGRSIPLLRWIVPSEKQQNAKVQQAFLNTLAEAVNPEARVIIVTDAGF
FT                   QNAWFRHIESLGWDFIGRIRGNIQMRLEAKGEYWFRRQELQASSKPEYLGPGTLARSEY
FT                   ARCDGHFYLHKKEPKGRKNKRSRCGIARPSQLKDASPAAKEPWLIFSSTDDFKPRVIMK
FT                   LYSRRMQIEQHFRDEKSERFGFGLRASYSRSAGRVLALRLLATLSTIVLWLVGYHAENK
FT                   GLHLRYQANSVRIWRVITYLTLAENVLRQSPLILKRTVLRTVLNHLARIYQNMVLVY"
FT   gene            16852..16989
FT                   /locus_tag="SARI_00011"
FT   CDS_pept        16852..16989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19965"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF13"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217872.1"
FT                   /protein_id="ABX19965.1"
FT                   /translation="MGIPQRFGGVFCICSIAQPLHMTGQTKSAIINDYHLNRERYAVPD
FT                   "
FT   gene            16973..17644
FT                   /locus_tag="SARI_00012"
FT   CDS_pept        16973..17644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hpa:HPAG1_0914 8.5e-06 hypothetical protein
FT                   K04071; COG: COG0602 Organic radical activating enzymes;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19966"
FT                   /db_xref="GOA:A9MF14"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR027609"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF14"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457340.1"
FT                   /protein_id="ABX19966.1"
FT                   /translation="MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWD
FT                   KLSDREVSLYSILAKTKESDKWGAASSEDLLTVINRQDYTARHVVITGGEPCIHDLMPL
FT                   TDLLEKSGFSSQIETSGTHEVLCTPNTWVTVSPKVNMRGGYDVLTQALERANEIKHPVG
FT                   RIRDIEALDELLATLSDDKPRVIALQPISQKEDATRLCIETCIARNWRLSMQTHKYLNI
FT                   A"
FT   gene            complement(17943..18305)
FT                   /locus_tag="SARI_00013"
FT   CDS_pept        complement(17943..18305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY3077 4.5e-65 6-pyruvoyltetrahydropterin
FT                   synthase K01737; COG: COG0720 6-pyruvoyl-tetrahydropterin
FT                   synthase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19967"
FT                   /db_xref="GOA:A9MF15"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF15"
FT                   /inference="protein motif:BlastProDom:IPR007115"
FT                   /inference="protein motif:HMMPanther:IPR007115"
FT                   /inference="protein motif:HMMPfam:IPR007115"
FT                   /inference="protein motif:HMMPIR:IPR007115"
FT                   /inference="protein motif:HMMTigr:IPR007116"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457338.1"
FT                   /protein_id="ABX19967.1"
FT                   /translation="MSTTLYKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVD
FT                   PHTGWIMDFADLKAAFKPTYDRLDHYYLNDIPGLSNPTSEVLAKWIWDQVKPVVPLLSA
FT                   VMVKETCTAGCVYRGE"
FT   gene            18795..20594
FT                   /locus_tag="SARI_00014"
FT   CDS_pept        18795..20594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2879 3.5e-287 cysJ; sulfite reductase,
FT                   beta (flavoprotein) subunit K00380; COG: COG0369 Sulfite
FT                   reductase, alpha subunit (flavoprotein); Psort location:
FT                   OuterMembrane, score:9.49"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00014"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19968"
FT                   /db_xref="GOA:A9MF16"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR029758"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF16"
FT                   /inference="protein motif:FPrintScan:IPR001094"
FT                   /inference="protein motif:FPrintScan:IPR001709"
FT                   /inference="protein motif:HMMPfam:IPR001433"
FT                   /inference="protein motif:HMMPfam:IPR003097"
FT                   /inference="protein motif:HMMPfam:IPR008254"
FT                   /inference="protein motif:HMMTigr:IPR010199"
FT                   /inference="similar to AA sequence:SwissProt:Q57KH7"
FT                   /protein_id="ABX19968.1"
FT                   /translation="MTTQAPLTGLLPLNPQQLARLQAATTDFTPEQLAWVSGYFWGVLN
FT                   PRSGADAVARAPERGSLGITLISASQTGNARRVAEALRDDLLAVNLNVNLVNAGDYKFK
FT                   QIACEKLLVVVTSTQGEGEPPEEAVALHKFLFSKKAPRLNNTAFAVFSLGDTSYEFFCQ
FT                   AGKDFDNKLAELGGERLLDRVDADVEYQTVAAQWRARIVDVLKSRTPVTTPVPSVVSGA
FT                   VNEIHTSPYTKEAPLRASLSVNQKITGRNSEKDVRHIEIDLGDSGLCYQPGDALGVWYQ
FT                   NDPALVKEIVELLWLKGDEPVAVDGKLLPLTEALQWHFELTVNTAGIVENYATLTRSEF
FT                   LLPLVGDKAQLQHYAAATPIADMLRFSPSQLDADALVGLLRPLTPRLYSIASSQAEVEN
FT                   EVHLTVGVVRYDIEGRARAGGASSFLADRVDDEGEVRVFIEHNDNFRLPTNPETPIIMI
FT                   GSGTGIAPFRAFIQQRAADEASGKNWLFFGNPHFTEDFLYQVEWQRYVKEGLLSRIDLA
FT                   WSRDQKEKIYVQDKLRERGAELWRWINDGAHIYVCGDANRMAKDVEQALLEVIVEFGGM
FT                   DLESADEYLSELRVARRYQRDVY"
FT   gene            20594..22306
FT                   /locus_tag="SARI_00015"
FT   CDS_pept        20594..22306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2947 1.8e-299 cysI; sulfite reductase,
FT                   alpha subunit, NADPH dependent K00381; COG: COG0155 Sulfite
FT                   reductase, beta subunit (hemoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19969"
FT                   /db_xref="GOA:A9MF17"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF17"
FT                   /inference="protein motif:HMMPfam:IPR005117"
FT                   /inference="protein motif:HMMPfam:IPR006067"
FT                   /inference="protein motif:HMMPIR:IPR008287"
FT                   /inference="protein motif:HMMTigr:IPR011786"
FT                   /inference="protein motif:ScanRegExp:IPR006066"
FT                   /inference="protein motif:superfamily:IPR011255"
FT                   /inference="similar to AA sequence:SwissProt:P17845"
FT                   /protein_id="ABX19969.1"
FT                   /translation="MSEKHPGPLVVEGKLSDAERMKRESNYLRGTIAEDLNDGLTGGFK
FT                   GDNFLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPGGVITTKQWQVIDKFAA
FT                   DNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLHSVGLDALATANDMNRNVLCTSNPYE
FT                   SQLHSEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTDEEPILGQTYLPRKFKTTVVI
FT                   PPQNDIDLHANDMSFVAIAENGKLVGFNLLVGGGLSIEHGNKKTYARTASEFGFLPLEH
FT                   TLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGLETFKAEVERRAGITFEPIRPYEFT
FT                   GRGDRIGWVKGIDDNWHLTLFIENGRILDYPGRPLKSGLLEIAKIHQGEFRITANQNLI
FT                   VASVPESQKMKVEKLALDYGLMNAVSPQRENSMACVSFPTCPLAMAEAERFLPSFVDKV
FT                   EAVMAKHGVGNEHIVLRVTGCPNGCGRAMLAEIGLVGKAPGRYNLHLGGNRIGSRIPRM
FT                   YKENITEPAILASLDELIGRWAKEREAGEGFGDFTVRAGIIRPVLDPARDFWE"
FT   gene            22409..23143
FT                   /locus_tag="SARI_00016"
FT   CDS_pept        22409..23143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t2847 3.8e-123 cysH; 3'-phosphoadenosine
FT                   5'-phosphosulfate sulfotransferase K00390; COG: COG0175
FT                   3-phosphoadenosine 5-phosphosulfate sulfotransferase (PAPS
FT                   reductase)/FAD synthetase and related enzymes; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00016"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19970"
FT                   /db_xref="GOA:A9MF18"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF18"
FT                   /inference="protein motif:HMMPfam:IPR002500"
FT                   /inference="protein motif:HMMTigr:IPR004511"
FT                   /inference="protein motif:HMMTigr:IPR011800"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX19970.1"
FT                   /translation="MSVLDLNALNDLPKVDRVLALAETNAELEKLVAEERVAWSLENLP
FT                   GEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYQFIDALTDKLKLNLKVY
FT                   RATESAAWQEARYGKLWEQGVEGIEKYNEINKVEPMNRALQDLNAQTWFAGLRREQSGS
FT                   RTSLPVLAIQRGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLWHQGYLSVGDTHTTRKWE
FT                   PGMAEEETRFFGLKRECGLHEG"
FT   gene            complement(23241..24194)
FT                   /locus_tag="SARI_00017"
FT   CDS_pept        complement(23241..24194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00017"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG25864 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19971"
FT                   /db_xref="GOA:A9MF19"
FT                   /db_xref="InterPro:IPR022747"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF19"
FT                   /inference="similar to AA sequence:INSD:AAO70403.1"
FT                   /protein_id="ABX19971.1"
FT                   /translation="MPVTLNFGNYQNYTLNESRLAHLLSADKEKATHMGRWDKLQDHFR
FT                   SEKKDHALEVLHSIIHGQGRGEPGEMDVNVEDMAKIYAFKRLQNLACPAHQDLFKIKMD
FT                   ASQTQFLFIVGDTVISQSKIQDILNISDTVAVESMSREERKLFLQICEMIGSTITCHPE
FT                   LLQASSSTLRKEVTGNTKIKEAVYGMMRPAEAPDHQLVEWQDSLSENEKSTLACINAGN
FT                   FDPITQFCKIGYQEIQGEVAFSMIHPCISYLLHTYSPLTEFKGTNAGFLNKLNQDYKDY
FT                   HKNKMNIDPILEKIYLAHEHSLHIGKNECSRNILLA"
FT   gene            24531..24716
FT                   /locus_tag="SARI_00018"
FT   CDS_pept        24531..24716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19972"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF20"
FT                   /protein_id="ABX19972.1"
FT                   /translation="MFKYNFKMCNFFRYLKKALKRREVLSLSTCWSLRVDITIGESPGG
FT                   EKLTAAMIIIFFVGIV"
FT   gene            24740..25495
FT                   /locus_tag="SARI_00019"
FT   CDS_pept        24740..25495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00019"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1203 Predicted helicases"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00019"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19973"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF21"
FT                   /inference="similar to AA sequence:INSD:AAL21824.1"
FT                   /protein_id="ABX19973.1"
FT                   /translation="MVIDNIYFIDHHLKKLGIKNKEQTAQFFAWILFWHDIGKFAHSFQ
FT                   QLYRHEALNAFNEPTRYYKKIAHPTLGYGLWNSWLSECPELFPPSSLSVRKSKRVMALW
FT                   MPVTTGHHGRPPDAIQELDQFRQQDKDAARDFLLRVKALFPSTANVSVFTGIETLFPFI
FT                   QHPTLLQQKVLELDINMDGAQLFILEDVTGAGKTEAALILVHRLMAAGKAQGLYFGLPT
FT                   MAVTPFKHNNLRLLGLSNKVLLCSPRQRG"
FT   gene            complement(25575..26621)
FT                   /locus_tag="SARI_00020"
FT   CDS_pept        complement(25575..26621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2936 9.2e-177 iap; aminopeptidase
FT                   K01269; COG: COG2234 Predicted aminopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19974"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF22"
FT                   /inference="protein motif:HMMPfam:IPR007484"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461857.1"
FT                   /protein_id="ABX19974.1"
FT                   /translation="MFSATRRFTVILALGVGFIFPAQAASPGPGEIANIQARHIATFFP
FT                   GRMTGSPAEMLTADYLRQQFARMGYQSDIRTFNSRFIYTTRDNRKNWHNVTGSMVIAAH
FT                   EGHVPQQIIIMAHLDTYAPQSDADIDANLGGLTLQGMDDNAAGLGVMLELAARLKDIPT
FT                   HYGIRFIATSGEEEGKLGAENLLKRMSDTEKKNTLLIINLDNLIVGDKLYFNSGKNTPE
FT                   AVRTLTRERALAIARHYGIAASTNPGLNPAYPKGTGCCNDAEVFDKAGLSVLSVEATNW
FT                   NLGKKDGYQQRAKNASFPNGNSWHDVRLDNQQHIDKALPGRIERRSRDVVRIMLPLVKE
FT                   LAKAEKTP"
FT   gene            26873..27781
FT                   /locus_tag="SARI_00021"
FT   CDS_pept        26873..27781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t2836 3.0e-162 cysD; ATP sulfurylase
FT                   subunit K00957; COG: COG0175 3-phosphoadenosine
FT                   5-phosphosulfate sulfotransferase (PAPS reductase)/FAD
FT                   synthetase and related enzymes; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19975"
FT                   /db_xref="GOA:A9MF23"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF23"
FT                   /inference="protein motif:HMMPfam:IPR002500"
FT                   /inference="protein motif:HMMTigr:IPR011784"
FT                   /inference="similar to AA sequence:SwissProt:P65672"
FT                   /protein_id="ABX19975.1"
FT                   /translation="MDQKRLTHLRQLEAESIHIIREVAAEFANPVMLYSIGKDSSVMLH
FT                   LARKAFYPGTLPFPLLHVDTGWKFREMYAFRDRTANTYGCELLVHKNPEGVAMDINPFV
FT                   HGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQ
FT                   RPELWRNYNGQINTGESIRVFPLSNWTEQDIWQYIWLENIEIVPLYLAAERPVLERDGM
FT                   LMMVDDDRIDLQPGEVIKKRMVRFRTLGCWPLTGAVESHAQTLPEIIEEMLVSTTSERQ
FT                   GRVIDRDQAGSMELKKRQGYF"
FT   gene            27791..29230
FT                   /locus_tag="SARI_00022"
FT   CDS_pept        27791..29230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2934 3.8e-242 cysN; ATP-sulfurylase,
FT                   subunit 1 (ATP:sulfate adenylyltransferase) K00956; COG:
FT                   COG2895 GTPases - Sulfate adenylate transferase subunit 1;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19976"
FT                   /db_xref="GOA:A9MF24"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF24"
FT                   /inference="protein motif:HMMPfam:IPR000795"
FT                   /inference="protein motif:HMMPfam:IPR004161"
FT                   /inference="protein motif:HMMTigr:IPR005225"
FT                   /inference="protein motif:HMMTigr:IPR011779"
FT                   /inference="protein motif:ScanRegExp:IPR000795"
FT                   /inference="protein motif:superfamily:IPR009001"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461855.1"
FT                   /protein_id="ABX19976.1"
FT                   /translation="MNTILAQQIAKEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIG
FT                   RLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFST
FT                   EKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLDQTRRHSFISTLLGIKHL
FT                   VVAINKMDLVDYREETFARIREDYLTFAERLPGDLDIRFVPLSALEGDNVAAQSANMRW
FT                   YSGPTLLEVLETVDIQRVVDRQPMRFPVQYVNRPNLDFRGYVGTLASGSIKVGERIKVL
FT                   PSGVESSVSRIVTFDGDREEAYAGEAITLVLNDEIDISRGDLLLAANEALAPAQYAAID
FT                   VVWMAEQPLTPGQSYDVKLAGKKTRARVETIRYQIDINNLTQRDVESLPLNGIGLVEMA
FT                   FDEPLALDIYQQNPVTGGLIFIDRLSNITVGAGMVREPVERGVTPPMEYSAFELELNAL
FT                   VRRHFPHWNARDLLGDKHGAA"
FT   gene            29217..29822
FT                   /locus_tag="SARI_00023"
FT   CDS_pept        29217..29822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2865 6.2e-100 cysC; adenosine
FT                   5'-phosphosulfate kinase K00860; COG: COG0529
FT                   Adenylylsulfate kinase and related kinases; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00023"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19977"
FT                   /db_xref="GOA:A9MF25"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF25"
FT                   /inference="protein motif:BlastProDom:IPR002891"
FT                   /inference="protein motif:HMMPfam:IPR002891"
FT                   /inference="protein motif:HMMTigr:IPR002891"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217852.1"
FT                   /protein_id="ABX19977.1"
FT                   /translation="MALHDENVVWHPHPVTVTAREQLHGHRGVVLWFTGLSGSGKSTVA
FT                   GALEEALHHRSVSTYLLDGDNVRHGLCRNLGFSDADRKENIRRVGEVASLMADAGLIVL
FT                   TAFISPHRAERQLVQERVGHDRFIEIYVDTPLAVCEQRDPKGLYKKARAGELRNFTGID
FT                   GIYEAPESPQIHLNGEQLVTNLVSQLLDLLRRRDIISS"
FT   gene            29840..30196
FT                   /locus_tag="SARI_00024"
FT   CDS_pept        29840..30196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00024"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG12170 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19978"
FT                   /db_xref="GOA:A9MF26"
FT                   /db_xref="InterPro:IPR022721"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF26"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457321.1"
FT                   /protein_id="ABX19978.1"
FT                   /translation="MPGMVKVTGFDMRNSHNITFTRSDAFIVDDDTTSSLPGAVVGFVS
FT                   WLLALGIPFLLYGPNTLFFFLYTWPFFLALMPVSVIIGIALHLLVKGKLLFSIMFTLLA
FT                   VGALFGALFIWLLG"
FT   gene            30387..30698
FT                   /locus_tag="SARI_00025"
FT   CDS_pept        30387..30698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00025"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2919 Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19979"
FT                   /db_xref="GOA:A9MF27"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF27"
FT                   /inference="protein motif:HMMPfam:IPR007060"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00696532.1"
FT                   /protein_id="ABX19979.1"
FT                   /translation="MGKLTLLLLALLVWLQYSLWFGKNGIHDYSRVNDDVVAQQATNAK
FT                   LKARNDQLFAEIDDLNGGQEAIEERARNELSMTKPGETFYRLVPDASKRAQTAGQNNR"
FT   gene            30717..31427
FT                   /locus_tag="SARI_00026"
FT   CDS_pept        30717..31427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t2831 1.5e-121 ygbP;
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
FT                   K00991; COG: COG1211
FT                   4-diphosphocytidyl-2-methyl-D-erithritol synthase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19980"
FT                   /db_xref="GOA:A9MF28"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF28"
FT                   /inference="protein motif:HMMPfam:IPR001228"
FT                   /inference="protein motif:HMMPIR:IPR008233"
FT                   /inference="protein motif:HMMTigr:IPR001228"
FT                   /inference="protein motif:ScanRegExp:IPR001228"
FT                   /inference="similar to AA sequence:REFSEQ:NP_806528.1"
FT                   /protein_id="ABX19980.1"
FT                   /translation="MAATLLDVCAVVPAAGFGRRMQTECPKQYLSIGNKTILEHSVHAL
FT                   LAHPRVTRVVIVISPGDHRFAQLPLANHPQITVVDGGNERADSVMAGLQAVAQAKWVLV
FT                   HDAARPCLHQDDLARLLAISENSRVGGILASPVRDTMKRGEPGKAAIAHTVERADLWHA
FT                   LTPQFFPRELLHDCLTRALKEGATITDEASALEYCGFHPALVEGRADNIKVTRPEDLAL
FT                   AEFYLTRTIHQEKA"
FT   gene            31427..31906
FT                   /locus_tag="SARI_00027"
FT   CDS_pept        31427..31906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA2785 2.8e-81 ygbB;
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
FT                   K01770; COG: COG0245 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19981"
FT                   /db_xref="GOA:A9MF29"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF29"
FT                   /inference="protein motif:HMMPfam:IPR003526"
FT                   /inference="protein motif:HMMPIR:IPR010925"
FT                   /inference="protein motif:HMMTigr:IPR003526"
FT                   /inference="protein motif:ScanRegExp:IPR003526"
FT                   /inference="protein motif:superfamily:IPR003526"
FT                   /inference="similar to AA sequence:INSD:AAV78640.1"
FT                   /protein_id="ABX19981.1"
FT                   /translation="MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALT
FT                   DALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYILGNVDVTIIAQAPK
FT                   MLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGITCEAVALLMKAAK"
FT   gene            31903..32952
FT                   /locus_tag="SARI_00028"
FT   CDS_pept        31903..32952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2928 5.9e-182 ygbO; paral putative
FT                   hydrogenase subunit K06176; COG: COG0585 Uncharacterized
FT                   conserved protein; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19982"
FT                   /db_xref="GOA:A9MF30"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF30"
FT                   /inference="protein motif:HMMPfam:IPR001656"
FT                   /inference="protein motif:HMMTigr:IPR001656"
FT                   /inference="protein motif:ScanRegExp:IPR001656"
FT                   /inference="similar to AA sequence:INSD:AAV78639.1"
FT                   /protein_id="ABX19982.1"
FT                   /translation="MTEFENLTWLHGKPQGSGLLKANPEDFVVVEDLGFTPDGEGEHIL
FT                   VRILKNGCNTRFVADALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDFSAF
FT                   QLEGCKVLEYARHKRKLRLGALKGNAFTLVLREISDRRDVETRLQAIRDSGVPNYFGAQ
FT                   RFGIGGSNLQGALRWAQSDAPVRDRNKRSFWLSAARSALFNQIVSQRLKKTDFNQVVDG
FT                   DTLQLAGRGSWFVATSEELPELQRRVDEKELMITASLPGRGEWGTQRDALAFEQDAIAQ
FT                   ETVLQSLLLREKVEASRRAMLLYPQQLSWNWWDDVTVELRFWLPAGSFATSVVRELINT
FT                   IGDYAHIAE"
FT   gene            32933..33694
FT                   /locus_tag="SARI_00029"
FT   CDS_pept        32933..33694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY3052 2.5e-135 surE; acid phosphatase
FT                   K03787; COG: COG0496 Predicted acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19983"
FT                   /db_xref="GOA:A9MF31"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF31"
FT                   /inference="protein motif:BlastProDom:IPR002828"
FT                   /inference="protein motif:HMMPfam:IPR002828"
FT                   /inference="protein motif:HMMTigr:IPR002828"
FT                   /inference="similar to AA sequence:SwissProt:P66881"
FT                   /protein_id="ABX19983.1"
FT                   /translation="MRILLSNDDGIHAPGIQTLAKALREFADVQVVAPDRNRSGASNSL
FT                   TLESSLRTFTFDNGDIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYS
FT                   GTVAAAMEGRHLGFPALAVSLNGYQHYDTAAAVTCALLRGLSREPLRTGRILNVNVPDL
FT                   PLAQIKGIRVTRCGSRHPADKVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYV
FT                   SVTPLHVDLTAHSAHDVVSDWLDSVGVGTQW"
FT   gene            33688..34314
FT                   /locus_tag="SARI_00030"
FT   CDS_pept        33688..34314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2926 9.2e-106 pcm; L-isoaspartate
FT                   protein carboxylmethyltransferase type II K00573; COG:
FT                   COG2518 Protein-L-isoaspartate carboxylmethyltransferase;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19984"
FT                   /db_xref="GOA:A9MF32"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF32"
FT                   /inference="protein motif:HMMPanther:IPR000682"
FT                   /inference="protein motif:HMMPfam:IPR000682"
FT                   /inference="protein motif:HMMTigr:IPR000682"
FT                   /inference="protein motif:ScanRegExp:IPR000682"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461847.1"
FT                   /protein_id="ABX19984.1"
FT                   /translation="MVSRRVQALLEQLRAQGIRDEQVLDALAAVPREKFIDEAFEHKAW
FT                   ENIALPIGQGQTISQPYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVHHVCSVE
FT                   RIKGLQWQARRRLKQLDLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMAQLD
FT                   EGGILVLPVGDEQQFLKRVRRRGGEFIIDTVEAVRFVPLVRGELA"
FT   gene            complement(34454..34651)
FT                   /locus_tag="SARI_00031"
FT   CDS_pept        complement(34454..34651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19985"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF33"
FT                   /inference="similar to AA sequence:REFSEQ:YP_542096.1"
FT                   /protein_id="ABX19985.1"
FT                   /translation="MINIPELVFDDKPPSTDETGAGGFDELEQPASHSETSDSAAMRLT
FT                   VNFGLPALIYPPGKNLVNSQ"
FT   gene            34665..35612
FT                   /locus_tag="SARI_00032"
FT   CDS_pept        34665..35612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3250 1.6e-44 ygeR; hypothetical
FT                   lipoprotein YgeR precursor; COG: COG0739 Membrane proteins
FT                   related to metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00032"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19986"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF34"
FT                   /inference="protein motif:HMMPfam:IPR002482"
FT                   /inference="protein motif:HMMPfam:IPR002886"
FT                   /inference="protein motif:HMMSmart:IPR002482"
FT                   /inference="protein motif:superfamily:IPR011054"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217844.1"
FT                   /protein_id="ABX19986.1"
FT                   /translation="MGATTQQAPQIQPVQRPVTQPVQTQPVAEQPVQMENGRIVYNRQY
FT                   GNIPKGSYAGGSTYTVKKGDTLFYIAWITGNDFRDLAQRNSIPAPYSLNVGQILQVGNA
FT                   SGTPITGGNAITQADAAQQGVVTRSAQNSTVAVASQPTITYSEGSGEQSANKMLPNNKP
FT                   AGTVVTAPVTAPTVSTTEPNASSTSTSAPISAWRWPTDGKVIENFGASEGGNKGIDIAG
FT                   SKGQAIVATANGRVVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQK
FT                   IATMGSTGTSSTRLHFEIRYKGKSVNPLRYLPQR"
FT   gene            35676..36668
FT                   /locus_tag="SARI_00033"
FT   CDS_pept        35676..36668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A2373 7.7e-70 rpoS; DNA-directed RNA
FT                   polymerase sigma subunit (sigma38) K00960; COG: COG0568
FT                   DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32); Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19987"
FT                   /db_xref="GOA:A9MF35"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012761"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF35"
FT                   /inference="protein motif:FPrintScan:IPR000943"
FT                   /inference="protein motif:HMMPfam:IPR007624"
FT                   /inference="protein motif:HMMPfam:IPR007627"
FT                   /inference="protein motif:HMMPfam:IPR007630"
FT                   /inference="protein motif:HMMPfam:IPR009042"
FT                   /inference="protein motif:HMMTigr:IPR012761"
FT                   /inference="protein motif:ScanRegExp:IPR000943"
FT                   /inference="protein motif:superfamily:IPR013324"
FT                   /inference="protein motif:superfamily:IPR013325"
FT                   /inference="similar to AA sequence:INSD:CAD06030.1"
FT                   /protein_id="ABX19987.1"
FT                   /translation="MSQNTLKVHDLNEDAEFDENGVEAFDEKALSEEEPSDNDLAEEEL
FT                   LSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVK
FT                   IARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFSFSTYATWWIRQTIERAIMNQTR
FT                   TIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSV
FT                   DTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLL
FT                   GYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQTQGLNIEALFRE"
FT   gene            complement(36715..36951)
FT                   /locus_tag="SARI_00034"
FT   CDS_pept        complement(36715..36951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00034"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG14130 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19988"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF36"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457312.1"
FT                   /protein_id="ABX19988.1"
FT                   /translation="MICPRCADEHIELMATSPVKGVWTVYQCQHCLYTWRDTEPLRRTS
FT                   REHYPQAFRMTQKDIDNAPMVPSIPPLLAEDKR"
FT   gene            complement(36962..38389)
FT                   /locus_tag="SARI_00035"
FT   CDS_pept        complement(36962..38389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll3010 3.8e-52
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD K03182;
FT                   COG: COG0043 3-polyprenyl-4-hydroxybenzoate decarboxylase
FT                   and related decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19989"
FT                   /db_xref="GOA:A9MF37"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032902"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF37"
FT                   /inference="protein motif:HMMPfam:IPR002830"
FT                   /inference="protein motif:HMMTigr:IPR002830"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461843.1"
FT                   /protein_id="ABX19989.1"
FT                   /translation="MAFDDLRSFLHALDQQGQLLKISEEVNAEPDLAAAANATGRIGDG
FT                   APALWFDNIRGFTDARVAMNTIGSWQNHAISLGLPPNTPVKKQIDEFIRRWDNFPVAPE
FT                   RRANPGWAENTVDGDAINLFDILPLFRLNDGDGGFYLDKACVVSRDPLDPDNFGKQNVG
FT                   IYRMEVKGKRKLGLQPVPMHDIALHLHKAEERGEDLPIAITLGNDPIITLMGATPLKYD
FT                   QSEYEMAGALRESPYPIATAPLTGFDVPWGSEVILEGVIESRKREIEGPFGEFTDHYSG
FT                   GRNMTVVRIDKVSYRSKPIFESLYLGMPWTEIDYLMGPATCVPLYQQLKAEFPEVQAVN
FT                   AMYTHGLLAIISTKKRYGGFARAVGLRAMTTPHGLGYVKMVIMVDEDVDPFNLPQVMWA
FT                   LSSKVNPAGDLVQLPNMSVLELDPGSSPAGITDKLIIDATTPVAPDNRGHYSQPVSDLP
FT                   ETKAWAEKLTAMLANRK"
FT   gene            complement(38389..38982)
FT                   /locus_tag="SARI_00036"
FT   CDS_pept        complement(38389..38982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2851 1.2e-96 pad; putative flavoprotein
FT                   K03186; COG: COG0163 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19990"
FT                   /db_xref="GOA:A9MF38"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR032901"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF38"
FT                   /inference="protein motif:Gene3D:IPR003382"
FT                   /inference="protein motif:HMMPfam:IPR003382"
FT                   /inference="protein motif:HMMTigr:IPR004507"
FT                   /inference="protein motif:superfamily:IPR003382"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217838.1"
FT                   /protein_id="ABX19990.1"
FT                   /translation="MRLIVGMTGATGAPLGVALLQALRTIPNVETHLVMSKWAKTTIEL
FT                   ETPYTSMEVAALADYCHSPADQAATISSGSFRTDGMIIIPCSMKTLAGIRSGYAEGLVG
FT                   RAADVVLKEGRKLVLVPREMPLSTIHLENMLTLSHMGVAIVPPMPAFYNLPQTVDDIIQ
FT                   HIVARVLDQFGLEHTRARRWQGLRQAANFSQENG"
FT   gene            39119..39556
FT                   /locus_tag="SARI_00037"
FT   CDS_pept        39119..39556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00037"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1846 Transcriptional regulators; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19991"
FT                   /db_xref="GOA:A9MF39"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF39"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000835"
FT                   /inference="protein motif:HMMSmart:IPR000835"
FT                   /inference="protein motif:ScanRegExp:IPR000835"
FT                   /inference="similar to AA sequence:INSD:AAX66756.1"
FT                   /protein_id="ABX19991.1"
FT                   /translation="MIEKVNLSGVIMELRNTAFHLLRQLFQQHTARWQHELPELTKPQY
FT                   AVMRAIAEHSGIEQVDLTEAAVCTKATLAEMLSRMENRGLVKRENDPLDKRRRFVYLTA
FT                   QGRALLAAAIPLGDRVDDEFLGRLSDEEREQFAQLVRKMMA"
FT   gene            complement(39575..40297)
FT                   /pseudo
FT                   /locus_tag="SARI_00038"
FT                   /note="Pseudogene based on alignment with
FT                   gi|16766225|ref|NP_461840.1|"
FT   gene            complement(40680..41810)
FT                   /locus_tag="SARI_00039"
FT   CDS_pept        complement(40680..41810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00039"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 1.1e-07 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19992"
FT                   /db_xref="GOA:A9MF40"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF40"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:INSD:CAD06018.1"
FT                   /protein_id="ABX19992.1"
FT                   /translation="MQIDGHRGKSHAGNKQINQIKKEAEQVNHRHFTAIRHYLSSGRGA
FT                   NVAVRRKSDKSALQRYTVKIILTVKGLIMLNLQRMSLFVAVVDSGSFTAAAAVSGQTKA
FT                   VVSFNIRQLEKELGVTLLLRSTRRLTLTDAGVLFYQKGVNLLNAAKNLQDEVRASHSGL
FT                   GGELRITTTSEFGEQVVIPVLAQFSQRHPDLRIRHMSSSHHADLIAERFDVAIRLGSLA
FT                   DSRYRATLISRFTILPVASPQWLARYPVSSLESLAQAEWIIHERLSTPLRWTLTDNDGQ
FT                   HSRLEISKAGRISVDSARSLMAFALAGSGVALLPEWLVKTALEDGALVHVLPDYHFPRQ
FT                   GIYAVYPDTRHVSTKVRAFIDFLRSQWNCGEHAPSS"
FT   gene            41922..42908
FT                   /locus_tag="SARI_00040"
FT   CDS_pept        41922..42908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ani:AN1180.2 2.4e-05 hypothetical protein
FT                   K04428; COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19993"
FT                   /db_xref="GOA:A9MF41"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF41"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="protein motif:ScanRegExp:IPR005829"
FT                   /inference="similar to AA sequence:REFSEQ:YP_151935.1"
FT                   /protein_id="ABX19993.1"
FT                   /translation="MFSLILFSVAAAAAGFADSLYGLVFWRIVQGAGGGLLIPVGQALT
FT                   WQQFKPHERAGVSSVVMMVALLAPACSPAIGGLLVETCGWRWIFFATLPVAIITLLLAY
FT                   LWLNADSTTVASARLLHLPLLADRLLRFAMIVYQCVPGMFIGISVVGMFYLQNVAQLSP
FT                   AAAGSLMLPWSIASFVAIMLTGRYFNWLGPRPLIIVGCLLQAAGILLLTHVTPATSHRV
FT                   LMVIFALMGAGGSLCSSTAQSSAFLTIARQEMPDASALWNLNRQLSFFIGATLLTMLLN
FT                   ALQRVLSLEAAYRWTFIAAAIITLLPLIDAVCLNNRKVLLYLKKERP"
FT   gene            42905..43285
FT                   /locus_tag="SARI_00041"
FT   CDS_pept        42905..43285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00041"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4460 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19994"
FT                   /db_xref="InterPro:IPR016918"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF42"
FT                   /inference="similar to AA sequence:INSD:AAL21790.1"
FT                   /protein_id="ABX19994.1"
FT                   /translation="MNSYKEEILHTHVAIENWLSRGAGSLEALLQRFAADFSMVTPGGA
FT                   CLDYPALGAFFQAQRACRPGLVIVVEHIDLVAEWPEGAALRYRERQQLPGQAETVRWST
FT                   VILKRERGRIVWRHLHETTVTA"
FT   gene            complement(43341..45923)
FT                   /locus_tag="SARI_00042"
FT   CDS_pept        complement(43341..45923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK3528 4.3e-153 mutS; DNA mismatch
FT                   repair protein, MutS family K03555; COG: COG0249 Mismatch
FT                   repair ATPase (MutS family)"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00042"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19995"
FT                   /db_xref="GOA:A9MF43"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF43"
FT                   /inference="protein motif:BlastProDom:IPR000432"
FT                   /inference="protein motif:HMMPfam:IPR000432"
FT                   /inference="protein motif:HMMPfam:IPR007695"
FT                   /inference="protein motif:HMMPfam:IPR007696"
FT                   /inference="protein motif:HMMPfam:IPR007860"
FT                   /inference="protein motif:HMMPfam:IPR007861"
FT                   /inference="protein motif:HMMSmart:IPR000432"
FT                   /inference="protein motif:HMMSmart:IPR007696"
FT                   /inference="protein motif:HMMTigr:IPR005748"
FT                   /inference="protein motif:ScanRegExp:IPR000432"
FT                   /protein_id="ABX19995.1"
FT                   /translation="MSKINMNEDIDKDFSSHTPMMQQYLKLKAQHPEILLFYRMGDFYE
FT                   LFYDDAKRASQLLDISLTKRGASAGEPIPMAGIPHHAVENYLAKLVNQGESVAICEQIG
FT                   DPATSKGPVERKVVRIVTPGTISDEALLQERQDNLLAAIWQDGKGYGYATLDISSGRFR
FT                   LSEPADRETMAAELQRTNPAELLYAEDFAEMALIEGRRGLRRRPLWEFEIDTARQQLNL
FT                   QFGTRDLVGFGVENASRGLCAAGCLLQYVKDTQRTSLPHIRSITMERQQDSIIMDAATR
FT                   RNLEITQNLAGGIENTLAAVLDCTVTPMGSRMLKRWLHMPIRNTDILRERQQTIGALQD
FT                   TVSELQPVLRQVGDLERILARLALRTARPRDLARMRHAFQQLPELHAQLETVDSAPVQA
FT                   LRKKMGDFAELRDLLERAIIDAPPVLVRDGGVIAPGYHQELDEWRALADGATDYLDRLE
FT                   IRERERTGLDTLKVGYNAVHGYYIQISRGQSHLAPINYVRRQTLKNAERYIIPELKEYE
FT                   DKVLTSKGKALALEKQLYDELFDLLLPHLADLQQSASALAELDVLVNLAERAYTLNYTC
FT                   PTFTDKPGIRIIEGRHPVVEQVLNEPFIANPLNLSPQRRMLIITGPNMGGKSTYMRQTA
FT                   LIALLAWIGSYVPAQNVEIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEN
FT                   SLVLMDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKMEGVANVH
FT                   LDALEHGDTIAFMHSVQDGAASKSYGLAVAALAGVPKEVIKRARQKLRELESISPNAAA
FT                   TQVDGTQMSLLAAPEETSPAVEALENLDPDSLTPRQALEWIYRLKSLV"
FT   gene            46026..46379
FT                   /locus_tag="SARI_00043"
FT   CDS_pept        46026..46379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00043"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG29516 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00043"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19996"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF44"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217827.1"
FT                   /protein_id="ABX19996.1"
FT                   /translation="MVLLLLWATNSGDTLKTTLNQAFIINKLSIDVKPELSSSGKVVFE
FT                   ANPDQKPYIVFDDHRDSPVGFGVKVSLTKKTYVIQRRVSSGDRSVSEGKKPSSVLKVKV
FT                   GNVSDFPSIDQAA"
FT   gene            complement(46535..47011)
FT                   /locus_tag="SARI_00044"
FT   CDS_pept        complement(46535..47011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_1143 1.4e-08 helix-turn-helix,
FT                   fis-type K00986; COG: COG2801 Transposase and inactivated
FT                   derivatives; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00044"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19997"
FT                   /db_xref="GOA:A9MF45"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF45"
FT                   /inference="protein motif:HMMPfam:IPR000653"
FT                   /inference="protein motif:HMMPfam:IPR001584"
FT                   /inference="protein motif:superfamily:IPR012337"
FT                   /inference="similar to AA sequence:REFSEQ:NP_943514.1"
FT                   /protein_id="ABX19997.1"
FT                   /translation="MDFVSDNLFNGRRFRALPVVDNFSRECLAIHAGKSLKGEDVVRIM
FT                   EALRVLDKRLPVRIQTDNGSEFISKSLDKWAYEHGVTMDFSRPGKPTDNPFIESFNGSL
FT                   RDECLNIHWFLSLEDAQEKLDNWRREYNHERTHSSLNDMTPAEFIRSLRKDEDL"
FT   gene            complement(47233..48171)
FT                   /locus_tag="SARI_00045"
FT   CDS_pept        complement(47233..48171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00045"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4644 Transposase and inactivated
FT                   derivatives, TnpA family"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19998"
FT                   /db_xref="GOA:A9MF46"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF46"
FT                   /inference="protein motif:HMMPfam:IPR002513"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00829772.1"
FT                   /protein_id="ABX19998.1"
FT                   /translation="MRFIAPVRTVHAGPNRKYFGSSRGITWYNFISDQYSGFHGVVVPG
FT                   TLRDSIFVLEGLLEQQTGLNPTEIMTDTAGSSDLIFGLFWLLGYQFSPRLADAGASVFW
FT                   RVDKDADYGVLNDLARNTANTRKIEQHWDDMMRMAGSLTLGKIRASVAIRSLLSSDRPS
FT                   GLTQAIIEAGKINKTLYLLNYIDDEDYRRRILTQLNRGESRHAVARAICHGQKGEIRKR
FT                   YQDGQEEQLGALGLVTNAVVLWNTIYIQAALDHLRNEGETINEEDEVRLSPLRHAHINM
FT                   LGHYTFTLAEQITKGQLRPLKQAEETDEWPL"
FT   gene            complement(48295..49638)
FT                   /locus_tag="SARI_00046"
FT   CDS_pept        complement(48295..49638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00046"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4644 Transposase and inactivated
FT                   derivatives, TnpA family; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19999"
FT                   /db_xref="GOA:A9MF47"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF47"
FT                   /inference="protein motif:HMMPfam:IPR002513"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00829772.1"
FT                   /protein_id="ABX19999.1"
FT                   /translation="MPDGVRTSRFEQLRKGPVAISGPAFNQAVVRYLKLKAFGMQSLDF
FT                   TGIPPVRFNALARYADMISVYKIARMPPARRTAMLVAFVRSCEISALDNALDVLDGVIA
FT                   DIGREAKKIGQKKRLRTLKDLDKSALELAHICSVLLDENIDSELLRTTIFEKCPPARLA
FT                   DTITFINAIARPPDASVHDEMVEQYGRVRRFLPCLLENIEFSAAPAGETTLEAIRYLAA
FT                   IRSTRRQHIDDAPMAIITGPWKRLCYGKDGHLSRQGYTLCVMNKLRDSLRRRDIYVARS
FT                   ERWGDPRAKLLQGQDWHTSRVQVYRSLGHPLNAGEAVNALTRQLDTVYRQVAKNFADNQ
FT                   AVSLDFTGKRTKLTIAHLNGLDEPPTLKLLSKHISDLLPVVDLTELLLEINAHIGFADE
FT                   FTHASEAGARMDDLTVSICAVLLAEACNIGMEPFIRPNIPALTRYRLS"
FT   gene            complement(49882..50337)
FT                   /locus_tag="SARI_00047"
FT   CDS_pept        complement(49882..50337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00047"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4644 Transposase and inactivated
FT                   derivatives, TnpA family"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20000"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF48"
FT                   /inference="protein motif:HMMPfam:IPR002513"
FT                   /inference="similar to AA sequence:INSD:CAC14717.1"
FT                   /protein_id="ABX20000.1"
FT                   /translation="MLKILQSFRLAPKWEIRVKKTTVFFTHAREATLPADFLNADQRAS
FT                   YGQFSGEPNDVQLARFFLLDEADMAFINNRRGRANRLAVALLTGCVRFLGTWPHDLSSI
FT                   PANVQWFVARQLGISDTGVLSEYSRRETTLREHQALIRRQYGYRDFA"
FT   gene            50412..50981
FT                   /locus_tag="SARI_00048"
FT   CDS_pept        50412..50981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00048"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1961 Site-specific recombinases, DNA
FT                   invertase Pin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00048"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20001"
FT                   /db_xref="GOA:A9MF49"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF49"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR006119"
FT                   /inference="protein motif:HMMPfam:IPR006120"
FT                   /inference="protein motif:ScanRegExp:IPR006118"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:INSD:AAF23988.1"
FT                   /protein_id="ABX20001.1"
FT                   /translation="MLVGYARVSTDDQNLNLQRDALKLAGCTKIFEDQISGAKAERPGL
FT                   HAVLQFIRPGDTLVVWRLDRLSRSLKDLIEMVRQLESNSIGLKSLQESIDTTSSSGMLI
FT                   FHLFGALAEFERNLTRERTQVGLQAARARGRKGGRPKVLNKDKQALAVQLYDERKHTVA
FT                   QICELMGVSRPTLYKYIDAARSVTNV"
FT   gene            51090..52031
FT                   /locus_tag="SARI_00049"
FT   CDS_pept        51090..52031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00049"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3501 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20002"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF50"
FT                   /inference="similar to AA sequence:INSD:ABP58869.1"
FT                   /protein_id="ABX20002.1"
FT                   /translation="MIDQDDTMLTDITAVTDNAYKLNINNSPVIPDVLRFRGTEELSKP
FT                   FSWRIEFTTPQSNIRPEDMLMKYASFILRDSKRVHGIITRLEWLSTSADQSHYAATLES
FT                   RLALLSRSRRCALYQNLSVPEVVEQVLRSHGLEGPDFDFRLSRQYPVRELITQWRETDL
FT                   EFIQRILSEVGIWFRQEMNDVTELDVTLFGDSQLHYLFNGVLPYHEPSGLYDGAELCCW
FT                   GVRTWHNTVTGTISTRDYNPRTASEPMDSAVSVRSPAVTIGEHYRYAEPYREAGDDTTS
FT                   EPESESGAFYARLHHERELNKSARVHLFSNAY"
FT   gene            52044..53630
FT                   /locus_tag="SARI_00050"
FT   CDS_pept        52044..53630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00050"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3501 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20003"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF51"
FT                   /inference="protein motif:HMMPfam:IPR006533"
FT                   /inference="similar to AA sequence:INSD:ABP58869.1"
FT                   /protein_id="ABX20003.1"
FT                   /translation="MVFDPQGVNLKDLSDGVIITFTSFTGARDSRLHVSVWGMPYREEY
FT                   GFRPAEMARPEIHGTLPARVESREKNDTYAHIDEYGRFRVRLDFNLDDCEPGYAYPWLR
FT                   MAKPYTGDGYGWHTPLIDGTEVAIAYCNGDIDLPYISHAFHDSEHLDVVNRDNRSQNIL
FT                   RTAARNELRMEDKRGEEHIALSTEFAKSQLNQGNITDAQDKPRGTGFELRTDERGVIRV
FT                   AKGLFISADGQQKAAGGVLDMDTALREIDICLQQLRQLEMAAEQAQALKADVDSQIRMF
FT                   NERLKPLNETLVFSAPEGIALTSGEHMQLAATSNVAINAGGDISVGVMGNMTALAGDKI
FT                   GMFSRTGQLSLKASEGTIEMQARNGNMRLFAEKKLTISSESDISFTGKKRITLIGGGSY
FT                   LKLEAGKVEYGTTTTYMRKVKRTMAAAAQNMPMKMPRTGTAYIYSAIYQLQDKNGNILV
FT                   NTPYHLTTPSGQTATGFSDNEGRSVPVYTRQQENVELHVLTKTSQPEESMWFVGETDTQ
FT                   QLETELRESQP"
FT   gene            53630..54919
FT                   /locus_tag="SARI_00051"
FT   CDS_pept        53630..54919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00051"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG18468 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20004"
FT                   /db_xref="GOA:A9MF52"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF52"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001110267.1"
FT                   /protein_id="ABX20004.1"
FT                   /translation="MEMPDLPDTPTGAPNAPTGTNNQPWDCTTTGVEMVEKQSRLPNTE
FT                   NRQYLHIKVEYAMRFPQLSAQIRREGKTYRMSLKQTMMSGLIRVDEIARNYCWYYKAEV
FT                   AFDMRTTPPRPFLSSTLLKKDGAGRRHTTNPFPVPGKGIYRRPDVIIVKNKEDRWPGLA
FT                   GPDTEGNMHSDNLARLVEVKFPGDTLYEDQYDEYMKIVGKDRNRMTILEIHDCRPEEHQ
FT                   WIDQAVNVTMKAWQTSGAKYWPLVLYPPIFMPRPPSTPAAARIEPWTYAGHVVADLSEG
FT                   AVRGVAEGWDALSKETQQVLNSAASWLNDSGEWVYRKGSEAWVWASKTGKSVKSWTNAQ
FT                   IKAAWTEIQHATDMTLDMLKQVDWVQVLTNVAKTVGVILVAVGIGVLVVTLGILEAIIG
FT                   AFLLIVRLAISAWGTLAAILGTGTAALAVQ"
FT   gene            54932..56146
FT                   /locus_tag="SARI_00052"
FT   CDS_pept        54932..56146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00052"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG18467 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20005"
FT                   /db_xref="InterPro:IPR021815"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF53"
FT                   /inference="similar to AA sequence:REFSEQ:NP_794057.1"
FT                   /protein_id="ABX20005.1"
FT                   /translation="MELQDFELSYIEKWLPEASVKYKDGSPAVNLGLIITVFFKDGHTP
FT                   EVRRRMVECVDRFYAEFKPHLKKTITKNWVGITEKNYAKKRQEILDSTPEEIFSWYLGS
FT                   AEQDFLAPDYSILIMGKRIFHNDNDRSVIKLTLPLSLLKEPDGKKRYEGWLMWLCDTFS
FT                   VESGYAGLSFALPYARERMFPYEFALAQRFSGVMVDSLGTLEGGEAVEGLKGACWYTIL
FT                   GTPWLEKLGGAERLRHRLAKTPEISLLSYNNGILLKAGELPPPLGEMKIEGLSPLLIKV
FT                   NQIIRPVRYDGHNGLHFHSEYENFQFEKESSMAWFARFDEASALLDKEEMGKSYDPVRI
FT                   KCWTDETAPHAGQWAAMVNGTTEYIQTREGQKLPPFEDKYGKQHRACWKLLKRDDNGSV
FT                   YTLPE"
FT   gene            56215..56487
FT                   /locus_tag="SARI_00053"
FT   CDS_pept        56215..56487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20006"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF54"
FT                   /inference="similar to AA sequence:INSD:EDK49629.1"
FT                   /protein_id="ABX20006.1"
FT                   /translation="MIELSAEQRQLAKIVHDYASQFPLTEDGDTQLLQGCYDYMEAFKG
FT                   VMDSASKVQMDYICLQYPGYFRFAKWMERLAQGIADGVIKVPKDH"
FT   gene            complement(56661..56891)
FT                   /locus_tag="SARI_00054"
FT   CDS_pept        complement(56661..56891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00054"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2801 Transposase and inactivated
FT                   derivatives; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20007"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF55"
FT                   /inference="similar to AA sequence:INSD:AAS58598.1"
FT                   /protein_id="ABX20007.1"
FT                   /translation="MREAYRISVRRGCGLLMQSRTVYHWQSRRDDRAITLRIREIAETR
FT                   IRYGCPRIHIQLRREGWPVKGSEAQPYENVR"
FT   gene            complement(56924..57190)
FT                   /locus_tag="SARI_00055"
FT   CDS_pept        complement(56924..57190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00055"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2801 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20008"
FT                   /db_xref="GOA:A9MF56"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF56"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR002514"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:REFSEQ:YP_153352.1"
FT                   /protein_id="ABX20008.1"
FT                   /translation="MKKTRYTEEQIAFALKQAETGTRVGEVCRKMGISEATFYNWKKKF
FT                   AGLGVTELRRLRQLEDENQRLKKLVAELSLDKEMLQEVLKQKF"
FT   gene            complement(57942..58538)
FT                   /locus_tag="SARI_00056"
FT   CDS_pept        complement(57942..58538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20009"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF57"
FT                   /protein_id="ABX20009.1"
FT                   /translation="MPSALSEFNFSFDQKEKIKKVLYDEVFSDLYINLLRLDNLLRPYL
FT                   VLNHDLSYFDKFTAELTNNQIKRSLRDNQTEFNVRSPIIKDGYARPFYICSVFENYATC
FT                   NSNNSLGLQIVDVLISNFNRALKGNFDNPIQIAKAIGKLTINSYIKGVYPIELIYLSEK
FT                   LTLSKDELSLISMVEDMPYKLFGFKKDPDNIYKGI"
FT   gene            complement(58813..59001)
FT                   /locus_tag="SARI_00057"
FT   CDS_pept        complement(58813..59001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20010"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF58"
FT                   /protein_id="ABX20010.1"
FT                   /translation="MNFYIDESGNFSLKNSTWNSVGILAIPHQKEEEIASFVKTLKNKI
FT                   GIKKDDELKDYFRRDFD"
FT   gene            complement(59668..60087)
FT                   /locus_tag="SARI_00058"
FT   CDS_pept        complement(59668..60087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00058"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20011"
FT                   /db_xref="GOA:A9MF59"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF59"
FT                   /protein_id="ABX20011.1"
FT                   /translation="MTNMDSKKLKRCAQIILFFYGASFLLTFLIGISNLIPPYIYIIFF
FT                   TPFFVAYCGFSIYLGRKKVFKSLNDSILFSFAPIAMFKPVKILLFKAENINETISNSDK
FT                   ILMCLYLLIAVCSIIKALISLNELYDNLKKPEKNS"
FT   gene            complement(60099..60446)
FT                   /locus_tag="SARI_00059"
FT   CDS_pept        complement(60099..60446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00059"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG11501 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20012"
FT                   /db_xref="InterPro:IPR010862"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF60"
FT                   /inference="protein motif:HMMPfam:IPR010862"
FT                   /inference="similar to AA sequence:INSD:AAL21782.1"
FT                   /protein_id="ABX20012.1"
FT                   /translation="MDILLMDTIQQEVLALFREEIPGYLDSNWKEIPLELDSDLFEVPG
FT                   DDLHEALDKFERKFNVDLSQVKWSYYFPWENTPLFARWFKLKREDVERTRKPLTIKMFA
FT                   ESAKAGKWLYD"
FT   gene            complement(60431..60880)
FT                   /locus_tag="SARI_00060"
FT   CDS_pept        complement(60431..60880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00060"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG27628 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20013"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF61"
FT                   /inference="similar to AA sequence:INSD:AAL21781.1"
FT                   /protein_id="ABX20013.1"
FT                   /translation="MDTTEELNETYFYHGQSNLSAGELFDVIFLEQFCDELGIGIESGA
FT                   AILAGQPWLKTRTKPGEAIKGTSVISKYGRMLLRNARTPFGIRVPTPVGVRMRKTNNLA
FT                   AVIARYVPWLGWVGLVNSIYQVSRKTQAKYNLIARPKDRIQWTSF"
FT   gene            complement(60890..61372)
FT                   /locus_tag="SARI_00061"
FT   CDS_pept        complement(60890..61372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00061"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3157 Hemolysin-coregulated protein
FT                   (uncharacterized)"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20014"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF62"
FT                   /inference="protein motif:HMMPfam:IPR008514"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00823859.1"
FT                   /protein_id="ABX20014.1"
FT                   /translation="MAIPGNMWLYDDGGALIKGGCDVADREFSIEFKGFHHNLSIPTDN
FT                   ATGKPTGTRQHSPMIIVKEFDYSSPYLYKAVATGQNLKSAEIKWYKISDAGQEVEYFNM
FT                   LLEGVRIVSISPTMASPEDKNNNHLESVELRYEKITWKHCDGNIIFTDAWNERQTA"
FT   gene            complement(61793..62560)
FT                   /locus_tag="SARI_00062"
FT   CDS_pept        complement(61793..62560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00062"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00062"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20015"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF63"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00823810.1"
FT                   /protein_id="ABX20015.1"
FT                   /translation="MNFLSKTVVVVLAATLLSGCDNRPDKTLSPPVGAKWVDVTFRVPE
FT                   GITLQPAELLYRSAQCKSVRYNSSNEPHDIPGYNDVERPFGAPDGDNIRRLRVAVDGGG
FT                   SCQWQLNSLKVSFRIADYVPLMKGKEVIDTSYIFDFGDYGLSDGYGTGRAKVFSEKILD
FT                   LNTDFFPMVANHIDNTVSLKLFGGETGTEKWRRRFSLSNTQHIAIEPVVHLMKVVVLNP
FT                   PDHPGNLTATYPDGSREDIPNISPDYDKLLSMK"
FT   gene            complement(62544..64607)
FT                   /locus_tag="SARI_00063"
FT   CDS_pept        complement(62544..64607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5483 4.6e-11 lipase K01066; COG:
FT                   COG3675 Predicted lipase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00063"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20016"
FT                   /db_xref="GOA:A9MF64"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF64"
FT                   /inference="protein motif:HMMPfam:IPR002921"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00823825.1"
FT                   /protein_id="ABX20016.1"
FT                   /translation="MEIIGNNTCVTSLRPKYKAVQCRGEQHKYWLELQFVDENNTPVSG
FT                   LNVRLEYHPLASAKDVEMWRKSGYDYNPTPPPNPPAGVTDSQGVVRFDDLYWIAVDVNT
FT                   DGQPLADEMEKRPLGLRRNPNSQPVSNNMFRPETRDPKWRSDVQEKAEVAGYIHHYVTI
FT                   GELCDQLPEIEGWAEPEPPKFHFPPGRSLKGTEIARDALDKRHVIEVCPFRAWVLALHD
FT                   TKEYDLANALNLSIMADLVYAAEVKNPTIDYFFRQKCQDLSCLPQLVEYPNYFHMLAVD
FT                   VPFRERYQPPLYMNTGEGALGEGDTRLFTVECTSHVLVSWCGTDSLLNVQTDVSFGPKR
FT                   CPAELGGMGDVHGGFLEAYQLPKRKFGDKLDAVKDSLGKRKTLFVCGHSLGGALALLYA
FT                   AEMKAFNPVLYTYGMPRTFSRLAAYLLRGIIHYRHANDNDTVTQIPPEVDLDSELYEKL
FT                   GWLGDKLGFDWVTTSAIGLLPRTFGGNAGVDMGITQERDPYWHHGKTVLFLRAEQSVMR
FT                   SGERNALWIGGGTVSYTEKAAVKLYLVPALNEECLTSTREHQAAFIQCLAPGELEKRFP
FT                   KGENTASSGWFSKPSNHSMAHRYLPYIHNQVLELADPARDMDRKAMRAMFREGVEQKAN
FT                   FSNPDEVERNREFLALQDMLPVALRLTQAEETGKNALLRFAAVTEEKVELSQ"
FT   gene            complement(64680..65543)
FT                   /locus_tag="SARI_00064"
FT   CDS_pept        complement(64680..65543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG pol:Bpro_3660 5.2e-05 ribonuclease, Rne/Rng
FT                   family K08300"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20017"
FT                   /db_xref="InterPro:IPR006922"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF65"
FT                   /inference="protein motif:HMMPfam:IPR006922"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX20017.1"
FT                   /translation="MSSHLKMATDVRQKSSEQANATGQLLKQEFDRLGKCVSEALSLSG
FT                   QKISDDIAARNQELSDALRHHSNGMTEAMQSHRERRDAPGNAPVAVSAHDLAAAGRDVR
FT                   GRAVAPELENSGEPGRNRGAERHAGEAEREDVGRDVSGGQQRTFSGAAEGYESRSGLDG
FT                   GEREAERGEAGEGVRADDRAGNAVAERIRAATAGLLAKAGRVGERLRGIADDVWSYARG
FT                   QRAAERAGHALESAGGALERATESFEPVVQRHKYEVAAARAQVVHEQRQKELVKEREYP
FT                   GPSLEL"
FT   gene            complement(65676..66062)
FT                   /locus_tag="SARI_00065"
FT   CDS_pept        complement(65676..66062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20018"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF66"
FT                   /protein_id="ABX20018.1"
FT                   /translation="MFFVLSLFLLSACSLQAEFTPEGENLNDATVGVPYYNQINIFGGI
FT                   VLSYDIYGKQVIAGDIHPDNLGLHLQYCGDDEFNNCIQIRGIPTKAGIAKVRIHGGLGG
FT                   GMLSKSGEFDKTYTVTIKDSEGSS"
FT   gene            complement(66145..67089)
FT                   /locus_tag="SARI_00066"
FT   CDS_pept        complement(66145..67089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00066"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20019"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF67"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01494838.1"
FT                   /protein_id="ABX20019.1"
FT                   /translation="MTGNINEPLSTIYIMEMKLYRKTMLHTHCVTPVPFTKMYTLEEFA
FT                   SGKAWSPVKRENPCYFESKGTMKPESQGGETKHIKITVPERPFIAKEYPIGNPRDPFDK
FT                   NLIERQIDERFNGFDFPNQIAASVCGPAAFFYCLQKDRPDAYAQAARELWRYGKTKIGD
FT                   LIISPGEGCRHPTGIFYYDDGKPKIAGTDWMTLAGLRDSENTVLSFDALDSPVAGITMW
FT                   QTLTEWFEKAGYERIFSNVGITQAGIQGIRDLNKYKEQGYKVVTLINDGLLVNSTNKTT
FT                   LPTHWVVWDGLVTQDSNGYISLELYSRGKQETG"
FT   gene            complement(67158..67472)
FT                   /locus_tag="SARI_00067"
FT   CDS_pept        complement(67158..67472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20020"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF68"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01494839.1"
FT                   /protein_id="ABX20020.1"
FT                   /translation="MLCRCPDHYVYGSATQSTSTGTGSLTSRNTSQSPVPAQQAQDSGA
FT                   RNCIRFQCAGDDGQLMAGCRYTLMFPDGRSEAGVTDEHGVTGWHYAESAKDISLHILTD
FT                   "
FT   gene            67567..68139
FT                   /locus_tag="SARI_00068"
FT   CDS_pept        67567..68139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00068"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3328 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20021"
FT                   /db_xref="GOA:A9MF69"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF69"
FT                   /inference="protein motif:HMMPfam:IPR001207"
FT                   /inference="similar to AA sequence:REFSEQ:NP_783715.1"
FT                   /protein_id="ABX20021.1"
FT                   /translation="MSQPFDFDKALKALQSGQALTGKDGILTPLIKPLTEAALAAELDS
FT                   HLASDVEANRKNGSGKKTIKAATGSFELATPRDRNGTFEPQLVKKHQTTLSDEIVHKII
FT                   RLFALGMSCQDISREIEDLYALSVSTATISAVTDKVIPELKQWQQRPLEKVYPFVRLDA
FT                   IHYKVREDGAIRCGSFYHDAMGKAVAG"
FT   gene            complement(68304..68612)
FT                   /locus_tag="SARI_00070"
FT   CDS_pept        complement(68304..68612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20023"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF70"
FT                   /protein_id="ABX20023.1"
FT                   /translation="MKVASETLKSSDRRGVSIRWNGDNVEFSANINASSMRMDNRHSGG
FT                   FFHGNLLAHFSMNEGGDDGEITFLNGNKVTTVGSATVPEPCFFTGSYHQKADGCFLR"
FT   gene            68451..68774
FT                   /locus_tag="SARI_00069"
FT   CDS_pept        68451..68774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00069"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3547 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20022"
FT                   /db_xref="GOA:A9MF71"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF71"
FT                   /inference="similar to AA sequence:INSD:ABL64095.1"
FT                   /protein_id="ABX20022.1"
FT                   /translation="MSKEISMKKSSRMSVIHPHAAGVDIGAEFHVVAVPPDADAAPVRT
FT                   FQRFTGDLHRMSGWLKTCHITTIAMESTGFYWLPAFEIPEAAGFNVILVNARDAKKCSR
FT                   SQD"
FT   gene            68734..69810
FT                   /locus_tag="SARI_00071"
FT   CDS_pept        68734..69810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00071"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3547 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20024"
FT                   /db_xref="GOA:A9MF72"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF72"
FT                   /inference="protein motif:HMMPfam:IPR003346"
FT                   /inference="similar to AA sequence:INSD:ABL64095.1"
FT                   /protein_id="ABX20024.1"
FT                   /translation="MPETQKNVPGRKTDVNDAQWLQKLHSFGLLRASFRPEHDISVLRS
FT                   YLRQRERLTEYRAAHIQHMQKALMQMNVQLHHAVSDITGVTGLSIVRAIVSGERDPSVL
FT                   IQYRDVRCKKTPEVLQQALTGNWQPEHLFAPEQSVAFFDFYQEKIRECDDQIETSLLQL
FT                   STGTEEPEGVLPSARHRTKQPNQLSFDVRPLLWKITGADLTQIHGFGPYLALKFVAECG
FT                   TDMNRWPDASHFTSWLCLSPGNKISGGKVLSPKTRRSSSRIAAALRLAATTIGRSDTAL
FT                   GAFYRRLSSRIGKAKAVTATARKLAILFYNALKYSQKYVDPGADYYEERYRNRVLDGLK
FT                   RRAKSLGYSLQQDPELCV"
FT   gene            69922..70074
FT                   /locus_tag="SARI_00072"
FT   CDS_pept        69922..70074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20025"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF73"
FT                   /protein_id="ABX20025.1"
FT                   /translation="MRGSSQQLQMLEKRFFIANKKAAARRCCIKKQFDKCNVRDKWLTV
FT                   KVTTL"
FT   gene            complement(70155..70598)
FT                   /locus_tag="SARI_00073"
FT   CDS_pept        complement(70155..70598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00073"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG28130 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20026"
FT                   /db_xref="GOA:A9MF74"
FT                   /db_xref="InterPro:IPR006830"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF74"
FT                   /inference="protein motif:HMMPfam:IPR006830"
FT                   /inference="similar to AA sequence:INSD:AAC45074.1"
FT                   /protein_id="ABX20026.1"
FT                   /translation="MKKFYSCLPVFLLIGCAQVPPPSSGSKPVQQPEVQKEQQANANSI
FT                   DKCMSLPYVPSDLTENKTLSNQKSENSTSKNNTISSSVFCEKYRQTKEQAFTFFQEYPQ
FT                   YMRSKEDEEQLMTEFKKVLLESGSNNLSIYQTLLTAHKRLQTL"
FT   gene            70957..71706
FT                   /locus_tag="SARI_00074"
FT   CDS_pept        70957..71706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00074"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG14596 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20027"
FT                   /db_xref="GOA:A9MF75"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF75"
FT                   /inference="protein motif:FPrintScan:IPR000005"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR000005"
FT                   /inference="protein motif:HMMSmart:IPR000005"
FT                   /inference="protein motif:ScanRegExp:IPR000005"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217818.1"
FT                   /protein_id="ABX20027.1"
FT                   /translation="MLNTQEVLKEGEKRRVRSPEAWFMQACSAQKLHMSFSEGRHNESC
FT                   LIQEGALLFIEQAVVAPVSGDLVFRPLKIEVLSKLLAFIDGAGLMNTTYAEPNKWVLLS
FT                   PEFRAIWQDRKRCEYWFLQQIITPSPDFNKVLTLLRKSESYWLVGYLLAQSTSGSTMRM
FT                   LGEDYGVSYTHFRRLCSRALGGKAKSELRNWRMAQSLLNSVEGHANITQLAVNNGYSSP
FT                   SHFSNEIKELIGVSPRKLSNIIQLADK"
FT   gene            71703..73394
FT                   /locus_tag="SARI_00075"
FT   CDS_pept        71703..73394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00075"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1450 Type II secretory pathway, component
FT                   PulD; Psort location: OuterMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20028"
FT                   /db_xref="GOA:A9MF76"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF76"
FT                   /inference="protein motif:HMMPfam:IPR004846"
FT                   /inference="protein motif:HMMPfam:IPR005644"
FT                   /inference="protein motif:HMMTigr:IPR003522"
FT                   /inference="protein motif:ScanRegExp:IPR004845"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461819.1"
FT                   /protein_id="ABX20028.1"
FT                   /translation="MKTHILLARVLACAALVLVAPGYSSEKIPVTGSGFVAKDDSLRTF
FT                   FDAMALQLKEPVIVSKMAARKKITGNFEFNDPNALLEKLSLQLGLIWYFDGQAIYIYDA
FT                   SEMRNAVVSLRNVSLNEFNNFLKRSGLYNKNYPLRGDNRKGTFYVSGPPVYVDLVVNAA
FT                   TMMDKQNDGIELGRQKIGVMRLNNTFVGDRTYNLRDQKMVIPGIATAIERLLQGEEQPL
FT                   GNITSSEPVPAMPAFSANGEKSKTANYAGGMSLQEALKQNAAAGDIKIVAYPDTNSLLV
FT                   KGTAEQVHFIEMLVKALDVAKRHVELSLWIVDLNKSDLERLGASWSGSITIGDKLGVSL
FT                   NQSSISTLDGSRFIAAVNALEEKKQATVVSRPVLLTQENVPAIFDNNRTFYTKLIGERN
FT                   VALEHVTYGTMIRVLPRFSADGQIEMSLDIEDGNDTTPQTEITASVDALPEVGRTLIST
FT                   IARVPHGKSLLVGGYTRDANTDTVQSIPFLGKIPFIGGLFRYSSKNKSNVVRVFLIEPK
FT                   EIVDPLTPDASESVNNILKQSGTWSGDDKLQKWVRVYLDRGQEAIK"
FT   gene            73391..74509
FT                   /locus_tag="SARI_00076"
FT   CDS_pept        73391..74509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00076"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06182 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00076"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20029"
FT                   /db_xref="GOA:A9MF77"
FT                   /db_xref="InterPro:IPR003520"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013401"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF77"
FT                   /inference="protein motif:HMMPfam:IPR003520"
FT                   /inference="protein motif:HMMTigr:IPR013401"
FT                   /inference="similar to AA sequence:INSD:AAC45044.1"
FT                   /protein_id="ABX20029.1"
FT                   /translation="MIPGSTSGISFSRILSRQTSHQDATQHTDAQQAEIQQAAEDSSPG
FT                   AEVQKFVQSTDEMSAALAQFRNRRDYEKKSSNLSNSFERVLEDEALPKAKQILKLISVH
FT                   GGALEDFLRQARSLFPDPSDLVLVLRELLRRKDLEEIVRKKLESLLKHVEEQTDPRTLK
FT                   AGINCALKARLFGKTLSLKPGLLRASYRQFIQSESHEVEIYADWIASYGYQRRLVVLDF
FT                   IEGSLLTDIDANDASCSRLEFGQLLRRLTQLKMLRSADLLFVSTLLSYSFTKAFNAEES
FT                   SWLLLMLSLLQQPHEVDSLLADIIGLNALLLSHKEHASFLQIFYQVCKAIPSSLFYEEY
FT                   WQEELLMALRSMTDIAYKHEMAEQRRTIEKPS"
FT   gene            74594..76591
FT                   /locus_tag="SARI_00077"
FT   CDS_pept        74594..76591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00077"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4789 Type III secretory pathway, component
FT                   EscV; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20030"
FT                   /db_xref="GOA:A9MF78"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF78"
FT                   /inference="protein motif:HMMPfam:IPR001712"
FT                   /inference="protein motif:HMMTigr:IPR006302"
FT                   /inference="protein motif:ScanRegExp:IPR001712"
FT                   /protein_id="ABX20030.1"
FT                   /translation="MVMIISMFVIPLPTYLVDFLIALNIVLAILVFMGSFYIDRILSFS
FT                   TFPAVLLITTLFRLALSISTSRLILIEADAGEIIATFGQFVIGDSLAVGFVVFSIVTVV
FT                   QFIVITKGSERVAEVAARFSLDGMPGKQMSIDADLKAGIIDADAARERRSVLERESQLY
FT                   GSFDGAMKFIKGDAIAGIIIIFVNFIGGISVGMTRHGMDLSSALSTYTMLTIGDGLVAQ
FT                   IPALLIAISAGFIVTRVNGDSDNMGRNIMTQLLNNPFVLVVTAILTISMGTLPGFPLPV
FT                   FVILSVVLSVLFYFKFREAKRSAGTPKTSKGEQPLSIEEKEGTSLGLIGDLDKVSTETV
FT                   PLILLVPKSRREDLEKAQLADRLRSQFFIDYGVRLPEVLLRDGEGLDDNSIVLLINEIR
FT                   VEQFTVYFDLMRVVNYSDEVVSFGINPTTHQQGSSQYFWVTHEEGEKLRELGYVLRNAL
FT                   DELYHCLAVTLARNVNEYFGIQETKHMLDQLEAKFPDLLKEVLRHATVQRISEVLQRLL
FT                   SERVSVRNMKLIMEALALWAPREKDVINLVEHIRGAMARYICHKFANGGELRAVMVSAE
FT                   VEDVIRKGIRQTSGSTFLSLEPEASANLMDLITLKLDDLLIAHKDLVLLTSVDVRRFIK
FT                   KMIEGRFPDLEVLSFGEIADSKSVNVIKTI"
FT   gene            76615..77022
FT                   /locus_tag="SARI_00078"
FT   CDS_pept        76615..77022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00078"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG14129 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00078"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20031"
FT                   /db_xref="InterPro:IPR003065"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF79"
FT                   /inference="protein motif:BlastProDom:IPR003065"
FT                   /inference="protein motif:FPrintScan:IPR003065"
FT                   /inference="protein motif:HMMPfam:IPR003065"
FT                   /inference="similar to AA sequence:INSD:CAD06002.1"
FT                   /protein_id="ABX20031.1"
FT                   /translation="MQHLDIAELVRSALEVSGCDPSLIGGIDSHSTIVLDLFALPSICI
FT                   SVKDDDVWIWAQLGADSMVVLQQRAYEILMTIMEGCQFVRGGQLLLGEQNGELTLKALV
FT                   HPDFLSDGEKFSNALNGFYNYLEVFSRSLMR"
FT   gene            77019..78314
FT                   /locus_tag="SARI_00079"
FT   CDS_pept        77019..78314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2826 2.9e-221 invC; surface presentation
FT                   of antigens; secretory proteins K03224; COG: COG1157
FT                   Flagellar biosynthesis/type III secretory pathway ATPase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20032"
FT                   /db_xref="GOA:A9MF80"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF80"
FT                   /inference="protein motif:HMMPfam:IPR000194"
FT                   /inference="protein motif:HMMPfam:IPR004100"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR005714"
FT                   /inference="protein motif:ScanRegExp:IPR000194"
FT                   /inference="protein motif:superfamily:IPR004100"
FT                   /inference="similar to AA sequence:INSD:AAL21774.1"
FT                   /protein_id="ABX20032.1"
FT                   /translation="MKTPRLLQYLAYPQKITGPIIEAELRDVAIGELCEIRRGWHQKQV
FT                   VARAQVVGLQRERTVLSLIGNAQGLTRDVVLYPTGRALSAWVGYSVLGAVLDPTGKIVE
FT                   RFTTEVAPISEERVIDVAPPPYASRVGVHEPLITGVRAIDGLLTCGVGQRMGIFASAGC
FT                   GKTMLMHMLIEQTEADVFVIGLIGERGREVTEFVDMLRASHKKEKCVLVFATSDFPSVD
FT                   RCNAAQLATTVAEYFRDQGKRVVLFIDSMTRYARALRDVALASGERPARRGYPASVFDN
FT                   LPRLLERPGATGDGSITAFYTVLLESEEEADPMADEIRSILDGHLYLSRKLAGQGHYPA
FT                   IDVLKSVSRVFGQVTTATHAKQASSVRKLMTRLEELQLFIDLGEYRPGENIDNDRAMQM
FT                   RDSLKAWLCQPVTQYSSFDDTLSGMNAFADQD"
FT   gene            78391..78735
FT                   /locus_tag="SARI_00080"
FT   CDS_pept        78391..78735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bta:282041 0.0055 ROCK2; Rho-associated,
FT                   coiled-coil containing protein kinase 2 K04514; COG:
FT                   NOG18535 non supervised orthologous group; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20033"
FT                   /db_xref="InterPro:IPR002954"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF81"
FT                   /inference="protein motif:HMMPfam:IPR002954"
FT                   /inference="similar to AA sequence:INSD:AAC45013.1"
FT                   /protein_id="ABX20033.1"
FT                   /translation="MLHAEEEAIVEQIAGLKLLLDTLRAENRQLSREEIYSLLRRQSIV
FT                   RRQIRDLQLQITQIQEKRCELEKKTQEFQEKSKYWLRKEGNYQRWIVRQKRFYIQREIQ
FT                   QEEAESEEII"
FT   gene            78735..79742
FT                   /locus_tag="SARI_00081"
FT   CDS_pept        78735..79742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00081"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG19627 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20034"
FT                   /db_xref="InterPro:IPR003066"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF82"
FT                   /inference="protein motif:HMMPfam:IPR003066"
FT                   /inference="similar to AA sequence:INSD:AAC45014.1"
FT                   /protein_id="ABX20034.1"
FT                   /translation="MGDVSAVSSSGNILLPQQDEVGGLSEALKKAVEKHKTEYSDDKKD
FT                   REYGDTFMMHKETALPLLLAALRHGAPAKSEQHNGSVSGLHHNVKGELRIAEKLLKVTA
FT                   EKSVGLVSTEAVDKFAALQSSKNRQLEGVSGKKLSADLKAVESLSELADKAAERTDDNI
FT                   KVLPGDNKVIAGEGVRKEGALLARDVAPSRMAAANTSKFDDKEHKKIKEASQVPLQPTT
FT                   IADLSQLSGGDEKMPLAAQSKPMMTIFPTADGVKGEDSSLTYRFQRWGNDYSVNIQARQ
FT                   VGEFSLIPSNTQVEHRLHDQWQNGNPQRWHLTRDDQQNPQQQQHGQQSGEEDDA"
FT   gene            79742..80653
FT                   /locus_tag="SARI_00082"
FT   CDS_pept        79742..80653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00082"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1886 Flagellar motor switch/type III
FT                   secretory pathway protein; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00082"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20035"
FT                   /db_xref="GOA:A9MF83"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR003283"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF83"
FT                   /inference="protein motif:BlastProDom:IPR001543"
FT                   /inference="protein motif:HMMPfam:IPR001543"
FT                   /inference="protein motif:HMMTigr:IPR013385"
FT                   /inference="similar to AA sequence:INSD:AAC43944.1"
FT                   /protein_id="ABX20035.1"
FT                   /translation="MSLRVRQIDRREWLLTQTAAECQRNGQEVTLEYPSRQGMWVRLSD
FT                   SEKRWSAWIKPGDWLEHVSPALAGAAVSAGAEHLIVPWLAATERPFELPVPHLSYRRLC
FT                   VENPVPGSALPEGKLLHIMSDRGGLWFEHLPELPAVGGGRPKTLCWPLRFVIGSSDSPR
FT                   ALLGRIGIGDVLVIRTSSAEVYCYTKKLGHFKRVEGGIIVETLDIQHIEEEKNETETAE
FT                   ILPGLSQLPVKLEFVLYRKQVTLADLEAIGQQQLLSLPTNAECNVEIMANGVLLGNGEL
FT                   VQMNDTLGVEIHKWLSESGNGE"
FT   gene            80643..81317
FT                   /locus_tag="SARI_00083"
FT   CDS_pept        80643..81317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00083"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4790 Type III secretory pathway, component
FT                   EscR; Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20036"
FT                   /db_xref="GOA:A9MF84"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF84"
FT                   /inference="protein motif:BlastProDom:IPR005838"
FT                   /inference="protein motif:FPrintScan:IPR005838"
FT                   /inference="protein motif:HMMPfam:IPR005838"
FT                   /inference="protein motif:HMMTigr:IPR005773"
FT                   /inference="protein motif:ScanRegExp:IPR005838"
FT                   /inference="similar to AA sequence:INSD:AAC43945.1"
FT                   /protein_id="ABX20036.1"
FT                   /translation="MGNDISLIALLAFSTLLPFIIASGTCFVKFSIVFVMVRNALGLQQ
FT                   IPSNMTLNGIALLLSMFVMWPIMHDAYVYFEDEDVTFNDISSLSKHVDEGLDGYRDYLI
FT                   KYSDRELVQFFENAQLKRQYGEETEAVKRDKDEIEKPSIFALLPAYALSEIKSAFKIGF
FT                   YLYLPFVVVDLVVSSVLLALGMMMMSPVTISTPIKLVLFVALDGWTLLSKGLILQYMDI
FT                   AT"
FT   gene            81343..81603
FT                   /locus_tag="SARI_00084"
FT   CDS_pept        81343..81603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00084"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4794 Type III secretory pathway, component
FT                   EscS"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00084"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20037"
FT                   /db_xref="GOA:A9MF85"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF85"
FT                   /inference="protein motif:FPrintScan:IPR002191"
FT                   /inference="protein motif:HMMPfam:IPR002191"
FT                   /inference="protein motif:HMMTigr:IPR006306"
FT                   /inference="similar to AA sequence:INSD:AAO70352.1"
FT                   /protein_id="ABX20037.1"
FT                   /translation="MDDLVFAGNKALYLVLILSGWPTIVATIIGLLVGLFQTVTQLQEQ
FT                   TLPFGIKLLGVCLCLFLLSGWYGEVLLSYGRQVIFLALAKG"
FT   gene            81607..82398
FT                   /locus_tag="SARI_00085"
FT   CDS_pept        81607..82398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00085"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4791 Type III secretory pathway, component
FT                   EscT; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20038"
FT                   /db_xref="GOA:A9MF86"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF86"
FT                   /inference="protein motif:FPrintScan:IPR002010"
FT                   /inference="protein motif:HMMPfam:IPR002010"
FT                   /inference="protein motif:HMMTigr:IPR006304"
FT                   /inference="similar to AA sequence:INSD:CAA51926.1"
FT                   /protein_id="ABX20038.1"
FT                   /translation="MFYALYFEIHNLVASAAMGFARVAPIFFFLPFLNSGVLSGAPRNA
FT                   IIVLVAMGVWPHELSEAPPFLSVAMIPLVLQEAAVGVMLGCLLSWPFWVMHALGCIIDN
FT                   QRGATLSSSIDPANGIDTSEMANFLNMFAAVVYLQNGGLVTMVDVLNKSYQLCDPMNEC
FT                   TPSLPPLLTFINQVAQHALVMASPVVLVLLLSEVFLGLLSRFAPQMNAFAISLTVKSGI
FT                   AILIMLLYFSPVLPDNVLRLSFQATGLSSWFYERGATHVLE"
FT   gene            82385..83455
FT                   /locus_tag="SARI_00086"
FT   CDS_pept        82385..83455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00086"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1377 Flagellar biosynthesis pathway,
FT                   component FlhB; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20039"
FT                   /db_xref="GOA:A9MF87"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF87"
FT                   /inference="protein motif:FPrintScan:IPR006135"
FT                   /inference="protein motif:HMMPfam:IPR006135"
FT                   /inference="protein motif:HMMTigr:IPR006307"
FT                   /inference="similar to AA sequence:INSD:CAA51927.1"
FT                   /protein_id="ABX20039.1"
FT                   /translation="MSSNKTEKPTKKRLEDSAKKGQSFKSKDLIIACLTLGGIAYLVSY
FT                   GSFNEFMGIIKIIIAENFEQSMADYSLAVLGVGLKYLIPFMLLCLVCSALPTLLQTGFV
FT                   LATEALKLNLSALNPVEGAKKLFSMRTVKDTVKTLLYLSSFVVAAIICWKKYKVEIFSQ
FT                   LNGNVMGIAVIWRELLLALVLTCLACALIVLLLDAIAEYFLTMKDMKMDKEEVKREMKE
FT                   QEGNPEVKSKRREVHMEILSEQVKSDIENSRLIVANPTHITIGIYFKPELMPFPMISVY
FT                   ETNQRALAVRSYAEKVGVPVIVDIKLARSLFKTHRRYDLVSLEEIDEVLRLLVWLEEVE
FT                   NAGKDVIQPQENEVRH"
FT   gene            83593..84090
FT                   /locus_tag="SARI_00087"
FT   CDS_pept        83593..84090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00087"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00087"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20040"
FT                   /db_xref="InterPro:IPR005415"
FT                   /db_xref="InterPro:IPR011716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016379"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF88"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="protein motif:HMMPfam:IPR011716"
FT                   /inference="protein motif:HMMTigr:IPR005415"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX20040.1"
FT                   /translation="MDYQNNVSEERVAEMIWDAVSEGATLKDVHGIPQDMMDGLYAHAY
FT                   EFYNQGRLDEAETFFRFLCIYDFYNPDYTMGLAAVCQLKKQFQKACDLYAVAFTLLKND
FT                   YRPVFFTGQCQLLMRKAAKARQCFELVNERTEDESLRAKALVYLEALKTAETEQHNEQE
FT                   KE"
FT   gene            84093..85877
FT                   /locus_tag="SARI_00088"
FT   CDS_pept        84093..85877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_3134 0.0057 ATP-dependent protease La
FT                   K01338; COG: NOG06175 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20041"
FT                   /db_xref="GOA:A9MF89"
FT                   /db_xref="InterPro:IPR003895"
FT                   /db_xref="InterPro:IPR006972"
FT                   /db_xref="InterPro:IPR032391"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF89"
FT                   /inference="protein motif:HMMPfam:IPR003895"
FT                   /inference="similar to AA sequence:INSD:AAO70348.1"
FT                   /protein_id="ABX20041.1"
FT                   /translation="MVNDTSSVSRSGYTQNPRLAEAAFEGVRKNTDFLKAADKAFKDVV
FT                   ATKAGDLKAGTKSGETTFNTVGLTPPTDAAREKLSSEGQLTLLLGKLMTLLGDVSLSQL
FT                   ESRLAVWQAMIESQKAMGLQVSKEFQAALGEAEKATDIYEESIKKMDTAKSVYDTAAKK
FT                   LTQAQNKLQSMDPSDPGYAKAEAAEGQARKEAKDAKTAFDKAKKAADLAGTDAKTKTEQ
FT                   ADNILTKFQGTTNVVASQTEVAKGEKDNLSNVARLTMLMAMFIEIVGKNNEEGLQNDLA
FT                   LFNALQEGRQAEMEKKSAEFQEETRKAEETNRIMGCIGKVLGALLTIVSVVAAVFTGGA
FT                   SLALAAVGLAVMVADEIVKAATGVSFIQQALNPIMEHVLKPLMELIGKAITKALEGLGV
FT                   DKKTAEMAGSIVGAIVAAIAMVAVIVVVAVVGKGAAAKLGNALSKMMGETIKKLVPNVL
FT                   KQLAQNGSKLFTQGMQRITSGLGNVGSKMGLQTNALSKELVGNTLNKVALGMEVTNTAA
FT                   QSAGGVAEGVFIKNASEAIADFTLARFAMDQIQQWLKQSVEIFGENQKVTAELQKVMSS
FT                   AVQQNADASRFILRQSRA"
FT   gene            85904..87133
FT                   /locus_tag="SARI_00089"
FT   CDS_pept        85904..87133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00089"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG10023 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20042"
FT                   /db_xref="GOA:A9MF90"
FT                   /db_xref="InterPro:IPR005427"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF90"
FT                   /inference="protein motif:HMMTigr:IPR005427"
FT                   /inference="similar to AA sequence:SwissProt:Q56020"
FT                   /protein_id="ABX20042.1"
FT                   /translation="MLINNAGINPATYLNNHSVENTPQPGSQSVSVKDILSSIGITVSK
FT                   VSDLGLSPTLTAPAPGVLTQTPGTVTSFLKTSIQNADMNQDLNALANNFSNKANELVQT
FT                   HLREQQAEVGKFFDISGMSSNAVALLAAANVLMLTLNQADTQLSSKLSLVSFDAAKTTA
FT                   SSMMREGMNALSGSISQSALQMGITTVGAKLEYKGLQNERGALKHNAAKIDKLTTESHS
FT                   IKNVLNGQNSVKLGSEGVDSLKSLNMKKTGADATKNLNDVTLKSNAGTSATESLGIKDS
FT                   NKQISPEHQAILSKRLESVESDIRLEQNTMDMTRIDARKMQMTGDLIMKNSVTVGGIAG
FT                   ASGQYAAIQERSEQQISQVNNRVASTASEETRESSRKSTSLIQEMLKAMESINQSKASA
FT                   FAAIAGNIRA"
FT   gene            87204..88226
FT                   /locus_tag="SARI_00090"
FT   CDS_pept        87204..88226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00090"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06173 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20043"
FT                   /db_xref="GOA:A9MF91"
FT                   /db_xref="InterPro:IPR009483"
FT                   /db_xref="InterPro:IPR036708"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF91"
FT                   /inference="protein motif:HMMPfam:IPR009483"
FT                   /inference="protein motif:HMMTigr:IPR013386"
FT                   /inference="similar to AA sequence:INSD:CAD05990.1"
FT                   /protein_id="ABX20043.1"
FT                   /translation="MLNIQNYSASPRPGLVAERPQTTSASEHVEITAAPATTEHRGADI
FT                   ITLSQAATKAQQAQQTLRSTLPVSEENNDERTLARQQLTSSLHALTKSGVSLSAEQNEG
FT                   LRSAFSAPAVALFSTAPMAQPRVTISDAEIWDMVSQNISAIGDNYLGVYENVVAVYTDF
FT                   YQAFSDILSKMGTWLAPGKDGNTVKLNVDALKSEIRSLVNKYNQVTKNTILFPSQTGSG
FT                   VTTATKAEAEQWIKELNLPGSCLKASGSGYVVLVDTGPLNKMVSDLNGIGSGSALELDN
FT                   AKYQAWQAGFKAQEENLKTTLQTLTQKYSNANSLYDNLVKVLSSTISSSLETAKSFLQG
FT                   "
FT   gene            88279..90261
FT                   /locus_tag="SARI_00091"
FT   CDS_pept        88279..90261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00091"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB0184245 5.8e-05 hypothetical protein
FT                   K03654; COG: NOG06172 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20044"
FT                   /db_xref="InterPro:IPR015138"
FT                   /db_xref="InterPro:IPR023224"
FT                   /db_xref="InterPro:IPR023225"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF92"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217801.1"
FT                   /protein_id="ABX20044.1"
FT                   /translation="MMTGLQNEIKAQATNLAANISAVNGNAAKTLSGEIKGPQLEDFPA
FT                   LVKQSSLEALFKCGKDADALKEIFTSSSNVGAKRAVTEFAELFHSALKATSDSPAAKEL
FT                   LMKVGKEYTEQIMNDGLKEKSAFGPWTPKTDKAEAKLEILHNKLLDIIKNNIGGDLGNL
FT                   STQFVMHEVMPYITNCIEHQFGCTLDPLTRSNIAQLVDKAAKKAVDALDMCHQKLTQEQ
FT                   GTSVGREARHLEMKALIPMLLRNVFAQIPADKLPDPKIPEPAAGPVPDGGKKPESAGIN
FT                   ININIDSSKHSVDNSKHINNSRSHVDNSQHHNDNSNHDNSQRHYESHYSNTSSSVNHSH
FT                   SRVDANTHQTETAHSASKGILDQGIMGKIDVTAHATAEAVTNASAESSGGKVVTSEKGT
FT                   TGETASFDEVDGGDNKVIIGKPMQATVHGVAGNKEQIQTADTVNVKTLASQLPDVEDVK
FT                   IHTLQPETTVNTGNKAGTTDNDNSQADKAGQFSGLKFKQNGFLSAIPSVTNMRSMHFDA
FT                   RETFLGVIRKALEPDTSTPFPVRRAFDGLRAEILSNDSIKSAALKAQCSDINKHPELKV
FT                   KIDTLKEAITLHPQREKLAEVALQFAREAGLTKLKGETDYLLSTMLDGIIGDVSWRNGP
FT                   SFESYLNKPGVDRVITTVDGLHMQS"
FT   gene            90280..90528
FT                   /locus_tag="SARI_00092"
FT   CDS_pept        90280..90528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C1220 3.6e-08 acpP; acyl carrier
FT                   protein K02078; COG: COG0236 Acyl carrier protein; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20045"
FT                   /db_xref="GOA:A9MF93"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF93"
FT                   /inference="protein motif:BlastProDom:IPR003231"
FT                   /inference="protein motif:Gene3D:IPR009081"
FT                   /inference="protein motif:HMMPfam:IPR006163"
FT                   /inference="protein motif:superfamily:IPR009081"
FT                   /inference="similar to AA sequence:INSD:AAO70344.1"
FT                   /protein_id="ABX20045.1"
FT                   /translation="MDMDIESRVKKVITSCIAVEINSINGQTNLVEDLYADSLDLIDIV
FT                   FGLSEEFDISCNENDLPDMTTITDICRVVEKSLQSRG"
FT   gene            90572..90823
FT                   /locus_tag="SARI_00093"
FT   CDS_pept        90572..90823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00093"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG30285 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20046"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF94"
FT                   /inference="similar to AA sequence:REFSEQ:NP_806483.1"
FT                   /protein_id="ABX20046.1"
FT                   /translation="MKIITHVVPGSDMAEIYDDIADNSRLIIKSKLRHVENDPKELLIC
FT                   VPTRSEWLFYWIKGDKHCARRRAYKNIKHYVSKIKPKN"
FT   gene            90858..91250
FT                   /locus_tag="SARI_00094"
FT   CDS_pept        90858..91250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00094"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG23656 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20047"
FT                   /db_xref="GOA:A9MF95"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF95"
FT                   /inference="protein motif:HMMPfam:IPR010261"
FT                   /inference="similar to AA sequence:PDB:1JYO"
FT                   /protein_id="ABX20047.1"
FT                   /translation="MRTHHDIIADIGEELGLPLTFDDNNQCLLLLDTDIFMAIEAKDDI
FT                   WLLNGMIIPLSPVCGDSVWRQIMMINGELATKNEGTLAYIDTAETLLFIKAITELANMY
FT                   HIISQLESFVNQQEALKKRLQEYAKV"
FT   gene            91300..92142
FT                   /locus_tag="SARI_00095"
FT   CDS_pept        91300..92142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00095"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG11499 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20048"
FT                   /db_xref="GOA:A9MF96"
FT                   /db_xref="InterPro:IPR003537"
FT                   /db_xref="InterPro:IPR011070"
FT                   /db_xref="InterPro:IPR014773"
FT                   /db_xref="InterPro:IPR015203"
FT                   /db_xref="InterPro:IPR037168"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF96"
FT                   /inference="protein motif:HMMPfam:IPR003537"
FT                   /inference="protein motif:superfamily:IPR011070"
FT                   /inference="similar to AA sequence:INSD:CAD05985.1"
FT                   /protein_id="ABX20048.1"
FT                   /translation="MTSNTRLYIAKENTNEAHVAPEKFASKVLTWLGRVPLFKNIDAVQ
FT                   KHMENTRVQNQKTLQVFLKALTEKYDEKSVNAITLMAGLNDSIKPFTPVRLQQITQMVK
FT                   DAEESFSKDIRSKQNASLPKVFSLVAKGVETKVTEQNGDFGTGMTQLLLDIALNGVKRA
FT                   IPQLEKVDGNSLRKNFREMASGNGPLRTLMTNLQNLSLVPEVKQLNDYAINLKNIQVGT
FT                   APFSQWGTCGGEVARWIDKASDQELTLAAKKIQVIVEKLKYVATELENIKAGAPMSQR"
FT   gene            complement(92471..92953)
FT                   /locus_tag="SARI_00096"
FT   CDS_pept        complement(92471..92953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00096"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bba:Bd1285 1.8e-07 soluble lytic murein
FT                   transglycosylase K01238; COG: COG0741 Soluble lytic murein
FT                   transglycosylase and related regulatory proteins (some
FT                   contain LysM/invasin domains)"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20049"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF97"
FT                   /inference="protein motif:HMMPfam:IPR008258"
FT                   /inference="similar to AA sequence:SwissProt:P43018"
FT                   /protein_id="ABX20049.1"
FT                   /translation="MRYFFSIVIWLISINTAWADCWLQAEKMFNIESELLYAIAQQESA
FT                   MKPGAIGHNRDGSTDIGLMQINSSHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMK
FT                   IYGYSWEAVGAYNAGTSPQRADIRKRYAKKIWENYKKLKEMPAEEKNKKLSIALNK"
FT   gene            complement(92971..94632)
FT                   /locus_tag="SARI_00097"
FT   CDS_pept        complement(92971..94632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00097"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:RL2429 8.1e-16 cya; putative adenylate
FT                   cyclase K01768; COG: COG3710 DNA-binding winged-HTH
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20050"
FT                   /db_xref="GOA:A9MF98"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF98"
FT                   /inference="protein motif:BlastProDom:IPR001867"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR001867"
FT                   /inference="protein motif:HMMPfam:IPR013105"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461797.1"
FT                   /protein_id="ABX20050.1"
FT                   /translation="MLHFNSVPVSNKKFVFDDFILNMDGSLLRADKKVNIPPKEYAVLV
FT                   ILLEAAGEIVSKNTLLDQVWGDAEVNEESLTRCIYALRRILSEDKEHRYIETLYGQGYR
FT                   FNRPVVVVSPPAPQPTTHTLAILPFQMQDQIQSESLHYSIVKGLSQYAPFGLSVLPVTI
FT                   TKNCRSVKDILELMDQLRPDYYISGQMIPDGNDNVVQIEIVRVKGYNLLHQESIKLVEN
FT                   QPASLLQNKIANLLLRCIPGLRWDTKQVSELNSIDSTMVYLRGKHELNQYTPYSLQQAL
FT                   KLLTQCVNMSPNSIAPYCALAECYLSMAQMGIFDKQNAMIKAKEYAIKATELDHSNPQA
FT                   LGFLGLINTIHSEYIVGSLLFKQANLLSPVSADIKYYYGWNLFMAGQLEEALQTINECL
FT                   KLEPTRAAAGITKLWITYYHAGIDDAIRLGDELRSQHLQDNPILLSMQVMFLSLKGKHE
FT                   LARKLAKEISKHEITGLIAVNLLYAEYCQNSERALPAIREFLESEQNTDNNPGLLPLVL
FT                   VAHGEVIAEKMWNKFKKEDNIWFKRWKQDPRLVKLR"
FT   gene            complement(95733..96662)
FT                   /locus_tag="SARI_00098"
FT   CDS_pept        complement(95733..96662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00098"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bli:BL05281 0.0021 adaA;
FT                   methylphosphotriester-DNA alkyltransferase and
FT                   transcriptional regulator (AraC/XylS family) K00567; COG:
FT                   COG2207 AraC-type DNA-binding domain-containing proteins;
FT                   Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00098"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20051"
FT                   /db_xref="GOA:A9MF99"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF99"
FT                   /inference="protein motif:FPrintScan:IPR000005"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR000005"
FT                   /inference="protein motif:HMMSmart:IPR000005"
FT                   /inference="protein motif:ScanRegExp:IPR000005"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:INSD:AAX66713.1"
FT                   /protein_id="ABX20051.1"
FT                   /translation="MENVTFVSNSHQRPAADNLQKLKSLLTNTQQQIKSQTQQITIKNL
FT                   YVSSFTLVCFRSGKVTISNNHDTIYCEEPGMLVLKKEQVVNVTLEEVNGHMDFDILEIP
FT                   TQRLGDLYALIPNEQQTKMVKPVEKVQKIFYTPDFPARREVFEHLKTAFSCTMDTNKSC
FT                   NSCNNQSCIENEELIPYFLLFLLTAFLRLPESYEIILSSAQITLKERVYNIISSSPGRQ
FT                   WKLPDIADNIFMSTSTLKRKLAEEGTSFSDIYLSARMNQAAKLLRIGNHNVNSVALKCG
FT                   YDSTSYFIQCFKKYFKTTPSTFIKMANH"
FT   gene            96978..98156
FT                   /locus_tag="SARI_00099"
FT   CDS_pept        96978..98156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00099"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG07990 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20052"
FT                   /db_xref="GOA:A9MFA0"
FT                   /db_xref="InterPro:IPR013387"
FT                   /db_xref="InterPro:IPR019029"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFA0"
FT                   /inference="protein motif:HMMTigr:IPR013387"
FT                   /inference="similar to AA sequence:REFSEQ:YP_151901.1"
FT                   /protein_id="ABX20052.1"
FT                   /translation="METSKEKTITSPGPYIVRLLNSSLNGCEFPLLTGRTLFVVGHSDA
FT                   LTASGQLPDIPADSFFIPLDHGGVNFEIQVDTDAAEIILHELKEGKAESRPVQLNTPIQ
FT                   VGELLILIRPESEPWAPEQPKSLEASAKKIEPRFKNGIVAALAGLFILGLGTVGTLWIL
FT                   NSPQRQAAELDSLLGQEKERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARV
FT                   INENEENKRISTWLDTYYPQLAYYRLHFDEPRKPVFWLSRQRNNMSKKEIEVLSQKLRT
FT                   LMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRAR
FT                   QFVDSYYRTWGGRYVQFAIELKDDWLKGRSFQYGAEGYIKMSPGHWYFPSPL"
FT   gene            98180..98419
FT                   /locus_tag="SARI_00100"
FT   CDS_pept        98180..98419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00100"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13860 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20053"
FT                   /db_xref="GOA:A9MFA1"
FT                   /db_xref="InterPro:IPR011841"
FT                   /db_xref="InterPro:IPR021123"
FT                   /db_xref="InterPro:IPR037203"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFA1"
FT                   /inference="protein motif:HMMTigr:IPR011841"
FT                   /inference="protein motif:superfamily:IPR010978"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457267.1"
FT                   /protein_id="ABX20053.1"
FT                   /translation="MADWSGYLDEVSAKFDKGVDDLQEQVTKALDQLAAKPSDPALLAA
FT                   YQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR"
FT   gene            98438..98743
FT                   /locus_tag="SARI_00101"
FT   CDS_pept        98438..98743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00101"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG19625 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20054"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFA2"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457266.1"
FT                   /protein_id="ABX20054.1"
FT                   /translation="MPIATIVPTNAVIGQAVNIRPMETDIVSLDDRLLQAFSGSAIATA
FT                   VDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS"
FT   gene            98740..99498
FT                   /locus_tag="SARI_00102"
FT   CDS_pept        98740..99498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00102"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4669 Type III secretory pathway, lipoprotein
FT                   EscJ"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20055"
FT                   /db_xref="GOA:A9MFA3"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFA3"
FT                   /inference="protein motif:HMMPfam:IPR006182"
FT                   /inference="protein motif:HMMTigr:IPR003282"
FT                   /inference="similar to AA sequence:SwissProt:P41786"
FT                   /protein_id="ABX20055.1"
FT                   /translation="MIRRYLYTFLLVMTLAGCKDKDLLKGLDQEQANEVIAVLQMHNIE
FT                   ANKIDSGKLGYSITVAEPDFTAAVYWIKTYQLPPRPRVEIAQMFPADSLVSSPRAEKAR
FT                   LYSAIEQRLEQSLQTMEGVLSARVHISYDIDAGENGRPPKPVHLSALAVYERGSPLAHQ
FT                   ISDIKRFLKNSFADVDYDNISVVLSERSDAQLQAPGTPVKRDSFATSWIVLIILLSAML
FT                   AGFGIWYYKNHYARNKKGITADDKAKSSNE"
FT   gene            99491..100069
FT                   /locus_tag="SARI_00103"
FT   CDS_pept        99491..100069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00103"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG14693 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20056"
FT                   /db_xref="GOA:A9MFA4"
FT                   /db_xref="InterPro:IPR013388"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFA4"
FT                   /inference="protein motif:HMMTigr:IPR013388"
FT                   /inference="similar to AA sequence:INSD:AAL21750.1"
FT                   /protein_id="ABX20056.1"
FT                   /translation="MNRQPLSVIWQKVIFDPLSYIHPQRLQITSEMIDRPAARAAANEL
FT                   ILAACQLKTGEKENIQNSLTQLWLRQWHRLPQIAYLLGCYKLRADLARQGALLGLPDWA
FT                   QAFLAMNQGTSLSVCDKAPNHRFLLSVGYAQLNALSEFLPESLAQRFPLLFPPFIEEAS
FT                   KQDAVEMSILLLALQYAQKYPNSVPAFAC"
FT   gene            100026..100697
FT                   /locus_tag="SARI_00104"
FT   CDS_pept        100026..100697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00104"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG14128 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20057"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFA5"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217788.1"
FT                   /protein_id="ABX20057.1"
FT                   /translation="MLKNIPIPSPLSPVEGILIKRKTLERYFSIERLEQQAHQRAKRIL
FT                   REAEEEARTLRMYAYQEGYEQGMVDALQQVAAYLTDSQTMAWKWMEKIQIYARELFSAA
FT                   VDHPETLLTVLDEWLRDFDKPEGQLFLTLPVNAKKDHQKLMVLLMENWPGTFNLKYHQE
FT                   QRFIMSCGDQIAEFSPEQFVETAVGVIKHHLDELPQDCRTISDNAINSLIDEWQTKTQT
FT                   S"
FT   gene            100712..101170
FT                   /locus_tag="SARI_00105"
FT   CDS_pept        100712..101170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00105"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG23015 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20058"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFA6"
FT                   /inference="similar to AA sequence:REFSEQ:YP_151895.1"
FT                   /protein_id="ABX20058.1"
FT                   /translation="MIPGTISTSYLDPTVSTEATSNSVVSLNARAVTLNNANNAHLSNG
FT                   SNVDLYDAFYQTLLSLPELVSSEALKDTIYQEMNAFKDPKNGEPAFVSFEQQTAMLQNI
FT                   IGKVEPDTHLYEALNGVLVGTMNAQSQMTSWMQEVILSGGENNESIDW"
FT   gene            101533..102405
FT                   /locus_tag="SARI_00106"
FT   CDS_pept        101533..102405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00106"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2207 AraC-type DNA-binding domain-containing
FT                   proteins; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20059"
FT                   /db_xref="GOA:A9MFA7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFA7"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR000005"
FT                   /inference="protein motif:HMMSmart:IPR000005"
FT                   /inference="protein motif:ScanRegExp:IPR000005"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217786.1"
FT                   /protein_id="ABX20059.1"
FT                   /translation="MNKSVGAISNNYLQQSSKASLINGLADVRGYYVANCLLIKLNKGS
FT                   LRIENEFGEFIEQSAPCLFLLEKDQTITFSMSEIEGHIDFSSLEVSYDLMQKFYKVFYS
FT                   TINYNDRELSLKTKPKHFFHAELLPGMSDTFDSILNGVTCPRVCSNVSIDDHDYSYYSL
FT                   MYLISAFVRKPGGFDFLERAIKITTKEKVYNIIISDITRKWSQAEVAGKLFMSVSSLKR
FT                   KLAAEDVSFSKIYLDARMNQAIKLLRMGAGNISQVATMCGYDTPSYFIAIFKRHFKITP
FT                   LSFMRTINH"
FT   gene            102786..103541
FT                   /locus_tag="SARI_00107"
FT   CDS_pept        102786..103541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00107"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG25264 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20060"
FT                   /db_xref="GOA:A9MFA8"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFA8"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="similar to AA sequence:INSD:CAD05973.1"
FT                   /protein_id="ABX20060.1"
FT                   /translation="MKNVIIYGINWTNCYALESIFKQKYPEKRVKTCNSLTALLHSISA
FT                   MPDAGLILSLNPHEHVYLFHALQSRLQSRKVLVVADRLYYIDRCVLQYFGVMDYVLKDE
FT                   LSCIIRPDREKPRLPEAWLRFCHRPHRKTVATTYAFNVNETPEEVLFNINQYAWWNLPP
FT                   GVTQAKYALLILLSSGHPAIELAKKFGLGTKTVSIYRKKMMHRLGMDSSPLSLFRGLKL
FT                   DAHLQRTTVAHNRSVQDDNCPLPVAVGMN"
FT   gene            complement(103823..104671)
FT                   /locus_tag="SARI_00108"
FT   CDS_pept        complement(103823..104671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00108"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1108 ABC-type Mn2+/Zn2+ transport systems,
FT                   permease components; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20061"
FT                   /db_xref="GOA:A9MFA9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFA9"
FT                   /inference="protein motif:HMMPfam:IPR001626"
FT                   /inference="similar to AA sequence:INSD:AAL21744.1"
FT                   /protein_id="ABX20061.1"
FT                   /translation="MFLTTLLEPFQFDFMVNALMVSVIVSIPCALLSVFLVLKGWALMG
FT                   DAMSHAVFPGVVLAYIVGIPLAIGAFIAGLFCAIATGYLDENSRIKRDTVMGIVFSGMF
FT                   GAGLVLYVSIQSEVHLDHILFGDMLGVSLGDIMQTAIIALGIALIIGLKWKDLLLYAFD
FT                   PHQAKACGLNTTLLHYGLLCMIALTIVATLKSVGIILSISLLIAPGAIAILLTRRFARA
FT                   LGLAVSLSVITAFAGVYLSFYFDSAPAPTIVVLFAIVFIAAFIYSTWRDRRNEVVPEAH
FT                   G"
FT   gene            complement(104662..105522)
FT                   /locus_tag="SARI_00109"
FT   CDS_pept        complement(104662..105522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00109"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1108 ABC-type Mn2+/Zn2+ transport systems,
FT                   permease components; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20062"
FT                   /db_xref="GOA:A9MFB0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFB0"
FT                   /inference="protein motif:HMMPfam:IPR001626"
FT                   /inference="similar to AA sequence:INSD:AAV78578.1"
FT                   /protein_id="ABX20062.1"
FT                   /translation="MNWLVEPFGYQYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDA
FT                   LSHSIVPGVAGAWMLGLPFSLGAFLSGGLAAGSMLFLNQRSRLKEDAIIGLIFSSFFGV
FT                   GLFMVSLNPMSVNIQTIILGNVLAIAPADIVQLAIIGVVSLTILLLKWKDLMVVFFDET
FT                   HARSIGLNPGLLKLLFFTLLSVSTVAALQTVGAFLVICLVVTPGATAWLLTDRFPRLLV
FT                   IAVMIGSLTSFLGAWLSYWLDGATGGIIVVMQTLLFITAFIFAPKHGLLANRRRARLHK
FT                   EPSCS"
FT   gene            complement(105519..106340)
FT                   /locus_tag="SARI_00110"
FT   CDS_pept        complement(105519..106340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00110"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A2894 2.6e-85 ABC transporter
FT                   component K02074; COG: COG1121 ABC-type Mn/Zn transport
FT                   systems, ATPase component; Psort location: Cytoplasmic,
FT                   score:9.12"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20063"
FT                   /db_xref="GOA:A9MFB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFB1"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="similar to AA sequence:INSD:AAL21742.1"
FT                   /protein_id="ABX20063.1"
FT                   /translation="MSQSAITVDQVTVTYRNGHTALRDATFQVPGGTIAALVGVNGSGK
FT                   STLFKALMGFVHLAQGDITILQQSVNTALKKNLIAYVPQSEEVDWSFPVLVEDVVMMGR
FT                   YGHMGWLRRPTAHDHACVDAALARVDMQEYRHRQIGELSGGQKKRVFLARAIAQDGQVI
FT                   LLDEPFTGVDVKTEARIIDLLRELRDEGRTMLVSTHNLGSVTEFCDYTVMIKGTVLASG
FT                   PTETTFTAANLEQAFSGVLRHIALSGGEEHIITDDERPFISRRVASGGKSS"
FT   gene            complement(106337..107254)
FT                   /locus_tag="SARI_00111"
FT   CDS_pept        complement(106337..107254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00111"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0803 ABC-type metal ion transport system,
FT                   periplasmic component/surface adhesin; Psort location:
FT                   CytoplasmicMembrane, score:8.60"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20064"
FT                   /db_xref="GOA:A9MFV6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFV6"
FT                   /inference="protein motif:HMMPfam:IPR006127"
FT                   /inference="similar to AA sequence:INSD:AAL21741.1"
FT                   /protein_id="ABX20064.1"
FT                   /translation="MTNLRRLKTLLIVGIVAMLALSSAYAKEKFKVITTFTVIADMAKN
FT                   VAGDAAEVSSITKPGAEIHEYQPTPGDIKRAQGAQLILANGLNLERWFARFYQHLSGVP
FT                   EVVVSTGVKPMGITEGPYNGKPNPHAWMSAENALIYVDNIRDALVKYDPDNAEIYKQNA
FT                   ERYKAKIRQLADPLRAELEKIPADQRWLVTSEGAFSYLARDNNMKELYLWPINADQQGT
FT                   PKQVRKVIDTIKKHHIPAIFSESTVSDKPARQVAREAGAHYGGVLYVDSLSAADGPVPT
FT                   YLDLLRVTTETIVKGINDGLRSQQ"
FT   gene            107436..107780
FT                   /locus_tag="SARI_00112"
FT   CDS_pept        107436..107780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00112"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG16835 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20065"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFV7"
FT                   /inference="similar to AA sequence:INSD:AAL21740.1"
FT                   /protein_id="ABX20065.1"
FT                   /translation="MSGNRIAREKLTIKKMIALYASRCPQASNDEAHYDALFSYAQKRL
FT                   DKCVFGEDKPACKQCPVHCYQPTRREEMKQIMRWAGPRMLWRHPVLTVRHFIDDKRPVP
FT                   ELPEKYQRKK"
FT   gene            complement(107856..109919)
FT                   /locus_tag="SARI_00113"
FT   CDS_pept        complement(107856..109919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3094 0. fhlA; formate hydrogenlyase
FT                   transcriptional activator K01768; COG: COG3604
FT                   Transcriptional regulator containing GAF, AAA-type ATPase,
FT                   and DNA binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20066"
FT                   /db_xref="GOA:A9MFV8"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFV8"
FT                   /inference="protein motif:FPrintScan:IPR002197"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR002078"
FT                   /inference="protein motif:HMMPfam:IPR002197"
FT                   /inference="protein motif:HMMPfam:IPR003018"
FT                   /inference="protein motif:HMMSmart:IPR003018"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR002078"
FT                   /protein_id="ABX20066.1"
FT                   /translation="MSDLGQQGLFDITRTLLQQPDLASLSEALSQLVKRSALADSAGIV
FT                   LWQAQSQRAQYYATRENGRPVEYEDETVLAHGPVRRILSRPDALHCNFHEFTETWPQLA
FT                   TSGLYPEFGHYCLLPLAAEGRIFGGCEFIRQEDRPWSEKEYDRLHTFTQIVGVVAEQIQ
FT                   NRVNNNVDYDLLCRERDNFRILVAITNAVLSRLDIDELVSEVAKEIHHYFNIDAISIVL
FT                   RSHRKNKLNIYSTHYLDERHPAHEQSEVDEAGTLTERVFKSKEMLLINLNERDPLAPYE
FT                   RMLFDTWGNQIQTLCLLPLMSGNTMLGVLKLAQCEEKVFTTANLKLLRQIAERVAIAVD
FT                   NALAYQEIHRLKERLVDENLALTEQLNNVDSEFGEIIGRSEAMYNVLKQVEMVAQSDST
FT                   VLILGETGTGKELIARAIHNLSGRSGRRMVKMNCAAMPAGLLESDLFGHERGAFTGASA
FT                   QRIGRFELADKSSLFLDEVGDMPLELQPKLLRVLQEQEFERLGSNKLIQTDVRLIAATN
FT                   RDLKKMVADREFRNDLYYRLNVFPIQLPPLRERPEDIPLLVKAFTFKIARRMGRNIDSI
FT                   PAETLRTLSGMEWPGNVRELENVVERAVLLTRGNVLQLSLPDIAAVTPDTPPVATEIAK
FT                   EGEDEYQLIVRVLKETNGVVAGPKGAAQRLGLKRTTLLSRMKRLGIDKDALA"
FT   unsure          109580..109591
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            complement(110081..111091)
FT                   /locus_tag="SARI_00114"
FT   CDS_pept        complement(110081..111091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_0556 1.7e-81 hypE; hydrogenase
FT                   expression/formation protein HypE K04655; COG: COG0309
FT                   Hydrogenase maturation factor; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00114"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20067"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFV9"
FT                   /inference="protein motif:HMMPfam:IPR000728"
FT                   /inference="protein motif:HMMPfam:IPR010918"
FT                   /inference="protein motif:HMMPIR:IPR011854"
FT                   /inference="protein motif:HMMTigr:IPR011854"
FT                   /inference="similar to AA sequence:INSD:AAX66697.1"
FT                   /protein_id="ABX20067.1"
FT                   /translation="MNNIQLAHGSGGQAMQQLINSLFMEAFANPWLAEQEDQARLDLAP
FT                   LTAEGDRLAFSTDSYVIDPLFFPGGNIGKLAICGTANDVAVSGAIPRYLSCGFILEEGL
FT                   PMETLKNVVNSMAATAREAGIAIVTGDTKVVQRGAADKLFINTAGMGAIPADIRWGAQT
FT                   LSAGDVLLVSGTLGDHGATILNLREQLGLDGELASDCAVLTPLIQTLRHINGVKALRDA
FT                   TRGGVNAVAHEFAAACGFGIELSESALPLKPAVRGVCELLGLDALNFANEGKLVIAVER
FT                   QAAEQALAALRAHPLGSDAALIGEVVERKGVRLAGLYGVKRTLDLPHAEPLPRIC"
FT   gene            complement(111088..112209)
FT                   /locus_tag="SARI_00115"
FT   CDS_pept        complement(111088..112209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00115"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0409 Hydrogenase maturation factor; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20068"
FT                   /db_xref="GOA:A9MFW0"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFW0"
FT                   /inference="protein motif:HMMPfam:IPR002780"
FT                   /inference="protein motif:HMMPIR:IPR002780"
FT                   /inference="protein motif:HMMTigr:IPR002780"
FT                   /inference="similar to AA sequence:INSD:AAX66696.1"
FT                   /protein_id="ABX20068.1"
FT                   /translation="MRFVDEYRAPEQVMQLIERLRKRAAHLPYTAERPLRIMEVCGGHT
FT                   HAIFKFGLDQLLPENVEFIHGPGCPVCVLPMGRIDSCVEIASHPEVIFCTFGDAMRVPG
FT                   KQGSLLQAKARGADVRIVYSPMDALKLAQDNPTRKVVFFGLGFETTMPTTAITLQQAKQ
FT                   RDVRNFYFFCQHITLIPTLRSLLEQPDNGIDAFLAPGHVSMVIGTEAYQFIAADFNRPL
FT                   VVAGFEPLDLLQGVMMLVEQKIAALSQVENQYRRVVPDAGNMLAQQAIADVFCVNGDSE
FT                   WRGLGVIESSGVHLTPEYQRFDAEAHFRPAPQQVYDDPRARCGEVLTGRCKPHQCPLFG
FT                   KTCNPETAFGALMVSSEGACAAWYQYRQQECEV"
FT   gene            complement(112209..112481)
FT                   /locus_tag="SARI_00116"
FT   CDS_pept        complement(112209..112481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00116"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0298 Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20069"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFW1"
FT                   /inference="protein motif:BlastProDom:IPR001109"
FT                   /inference="protein motif:FPrintScan:IPR001109"
FT                   /inference="protein motif:HMMPfam:IPR001109"
FT                   /inference="protein motif:HMMPIR:IPR001109"
FT                   /inference="protein motif:HMMTigr:IPR001109"
FT                   /inference="protein motif:ScanRegExp:IPR001109"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /inference="similar to AA sequence:INSD:CAD05963.1"
FT                   /protein_id="ABX20069.1"
FT                   /translation="MCIGVPGQIRAIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRLG
FT                   QWVLVHVGFAMSVINEAEARDTLDALQNMFDVEPDVGALLYGEER"
FT   gene            complement(112472..113344)
FT                   /locus_tag="SARI_00117"
FT   CDS_pept        complement(112472..113344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A1087 8.3e-15 ureG; UreA
FT                   amidohydrolase (urease) regulatory and maturation protein
FT                   UreG; COG: COG0378 Ni2+-binding GTPase involved in
FT                   regulation of expression and maturation of urease and
FT                   hydrogenase; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00117"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20070"
FT                   /db_xref="GOA:A9MFW2"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFW2"
FT                   /inference="protein motif:HMMPfam:IPR003495"
FT                   /inference="protein motif:HMMPIR:IPR012202"
FT                   /inference="protein motif:HMMTigr:IPR004392"
FT                   /inference="similar to AA sequence:INSD:AAL21735.1"
FT                   /protein_id="ABX20070.1"
FT                   /translation="MCTTCGCAEGNLYIEGDEHNPHSAFRSAPFAPAARPTLKITGIKT
FT                   PDFAPSQTTEGDLHYGHGEAGTHAPGMSQRRMLEVEIDVLDKNNRLAERNRARFAAHQQ
FT                   LVLNLVSSPGSGKTTLLTETLMKLKDRVPCAVIEGDQQTVNDAARIRATGTPAIQVNTG
FT                   KGCHLDAQMIADAAPRLPLDDRGILFIENVGNLVCPASFDLGEKHKVAVLSVTEGEDKP
FT                   LKYPHMFAAASLMLLNKVDLLPYLNFDVEKCIASAREVNPEIEIILISATSGEGMDQWL
FT                   AWLEAQRCA"
FT   gene            complement(113451..113822)
FT                   /locus_tag="SARI_00118"
FT   CDS_pept        complement(113451..113822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00118"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0375 Zn finger protein HypA/HybF (possibly
FT                   regulating hydrogenase expression); Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20071"
FT                   /db_xref="GOA:A9MFW3"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFW3"
FT                   /inference="protein motif:BlastProDom:IPR000688"
FT                   /inference="protein motif:HMMPfam:IPR000688"
FT                   /inference="protein motif:HMMPIR:IPR000688"
FT                   /inference="protein motif:HMMTigr:IPR000688"
FT                   /inference="protein motif:ScanRegExp:IPR000688"
FT                   /inference="similar to AA sequence:INSD:CAD05961.1"
FT                   /protein_id="ABX20071.1"
FT                   /translation="MHEITLCQRALELIEQQASAYGAKHVTAIWLKIGAFSCVETSALS
FT                   FCFDLVCRGTIAEGCKLHLEEQEAECWCEHCQQYVTLLTHRVRRCPQCHSDTLRIVADD
FT                   GLQIRRIEIDETPAPDGNA"
FT   gene            114033..114500
FT                   /locus_tag="SARI_00119"
FT   CDS_pept        114033..114500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00119"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG08679 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20072"
FT                   /db_xref="InterPro:IPR021285"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFW4"
FT                   /inference="similar to AA sequence:REFSEQ:YP_151880.1"
FT                   /protein_id="ABX20072.1"
FT                   /translation="MTIWEISEKADYIAQRHRRLQDQWHIYCNSLVQGITLSKARLHHA
FT                   MSCAPEKDLCFVLFEHFRIYVALADGFNSHTIEYYVETKDGEDKQLIAQAQLDIDGKVD
FT                   ERVNNRDREQVLEHYLEKIASVYDSLYAAVETNSPINLRQLVKGHSPAVQA"
FT   gene            114739..115248
FT                   /locus_tag="SARI_00120"
FT   CDS_pept        114739..115248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3087 5.8e-88 hycB; formate
FT                   hydrogenlyase subunit 2; COG: COG1142
FT                   Fe-S-cluster-containing hydrogenase components 2; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20073"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFW5"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457246.1"
FT                   /protein_id="ABX20073.1"
FT                   /translation="MPRLKVMLNEKESAPQLCHHCEDAPCATVCPVNAINRVDGAVQLN
FT                   ESLCVSCKLCGIACPFGAIEFSGSRPLHIPANANTPKAPSAPPAPARVSTLLDWVPGIR
FT                   AIAVKCDLCSFDEQGPACVRMCPTKALHLVDNTDIARASKRKRELTFNTDFGDLTLFQQ
FT                   AQSGDA"
FT   gene            115248..117074
FT                   /locus_tag="SARI_00121"
FT   CDS_pept        115248..117074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3086 2.2e-287 hycC; formate
FT                   hydrogenlyase subunit 3; COG: COG0651 Formate hydrogenlyase
FT                   subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20074"
FT                   /db_xref="GOA:A9MFW6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFW6"
FT                   /inference="protein motif:HMMPfam:IPR001750"
FT                   /protein_id="ABX20074.1"
FT                   /translation="MSSLSLITSGVVWFVAAAVLAFLFSFHKALSGWVAGIGGAVGSLC
FT                   TAGAGFTALTSAVTVSGVMPFTGQMLQITPLNAIWLITLGLCGLFVSLFNIDWHRHPQV
FT                   KANGLLVNLLIAAAVCAVVASNLGTMVVMAEIMALCAVFLTGGSKEGKLWFALGRLGTL
FT                   LLAIACGLAWQRYGTLDMGLLDQRAQQLPLGSDIWLLGVIGFGLLAGIIPLHGWVPQAH
FT                   ANASAPAAALFSTVVMKIGLLGILSLSLIGGNAPLWWGVALLVLGIITAFVGGLYALME
FT                   HNIQRLLAYHTLENIGIILLGLGAGVTGIALNQPALIALGLTGGLYHLVNHSLFKSVLF
FT                   LGAGSIWFCTGHRDIEKLGGIGKRMPVISIAMLVGLMAMAALPPLNGFAGEWVIYQSFF
FT                   RLGNSGAFVGRLLGPLLAVGLAVTGALAVMCMAKVYGVTFLGAPRTKEAENASCAPILM
FT                   GVSVVALAICCVLGGVAAPWLLPMISTAVPLPLETAHTTVSQPMITLLLIACPLLPFII
FT                   MAMFKGNRLPSRSRGAAWVCGYDHERSMVITAHGFAMPVKEAFAPVLKLRQWLNPVSLV
FT                   PGWQSAAAAVLFRRLALIELAVLVVIVVSRGA"
FT   gene            117077..118000
FT                   /locus_tag="SARI_00122"
FT   CDS_pept        117077..118000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3085 1.3e-145 hycD;
FT                   membrane-spanning protein of formate hydrogenase; COG:
FT                   COG0650 Formate hydrogenlyase subunit 4; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20075"
FT                   /db_xref="GOA:A9MFW7"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFW7"
FT                   /inference="protein motif:HMMPanther:IPR001694"
FT                   /inference="protein motif:HMMPfam:IPR001694"
FT                   /inference="protein motif:ScanRegExp:IPR001694"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457244.1"
FT                   /protein_id="ABX20075.1"
FT                   /translation="MSVFYPLIQALVLFAVAPLLSGITRVARARLHNRRGPGVLQEYRD
FT                   IIKLLGRQSIAPADSGWVFRLTPFVMVGVMLTIATALPVVTVGSPLPQLGDLITLIYLF
FT                   AIARFFFSIAGLDTGSPFTAIGASREAMLGVLVEPILLLGLWVAAQVAGSTHISNITDT
FT                   IYHWPVARSIPLILALCACAFATFIEMGKLPFDLAEAEQELQEGPLTEYSGSGFAVLKW
FT                   GISLKQLVVLQMFVGVFLPWGQMETFTAGGLLLALVIAVVKLVVGVLVIALFENSMARL
FT                   RFCATSRVTWAGFGFAFLAFVSLLAA"
FT   gene            118018..119727
FT                   /locus_tag="SARI_00123"
FT   CDS_pept        118018..119727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3084 0. hycE; formate hydrogenlyase
FT                   subunit 5 precursor; COG: COG3261 Ni,Fe-hydrogenase III
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20076"
FT                   /db_xref="GOA:A9MFW8"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFW8"
FT                   /inference="protein motif:BlastProDom:IPR001268"
FT                   /inference="protein motif:HMMPfam:IPR001135"
FT                   /inference="protein motif:HMMPfam:IPR001268"
FT                   /inference="protein motif:HMMPfam:IPR001501"
FT                   /inference="protein motif:ScanRegExp:IPR001135"
FT                   /inference="protein motif:superfamily:IPR008992"
FT                   /protein_id="ABX20076.1"
FT                   /translation="MSEEKLGQQYLAALHQAFPGVVLDEAWQTKDQLTITVKVNYLPEV
FT                   VEFLYYQQGGWLSVLFGNDERQLCGHYAVYYVMSMEQGTRCWVTVRVEVDPNKPEYPSV
FT                   TPRVSAAVWGEREVRDMYGLIPVGLPDERRLVLPDDWPDELYPLRKDSMDYRQRPAPTT
FT                   DAETYEFINELGDKKNNVVPIGPLHVTSDEPGHFRLFVDGENIIDADYRLFYVHRGMEK
FT                   LAETRMGYNEVTFLSDRVCGICGFAHSTAYTTSVENAMGIQVPERAQMIRAILLEVERL
FT                   HSHLLNLGLACHFTGFDSGFMQFFRVRETSMKMAEILTGARKTYGLNLIGGIRRDLLKE
FT                   DMIQTRQLAQQMRRDVQELVDMLLSTPNMEQRTVGIGRLDPEIARDFSNVGPMVRASGH
FT                   ARDTRADHPFVGYGLLPMEVHSEQGCDVISRLKVRINEVYTSLNMIDFGLDNLPGGPLM
FT                   VEGFTYIPHRFALGFAEAPRGDDIHWSMTGDNQKLYRWRCRAATYANWPTLRYMLRGNT
FT                   VSDAPLIIGSLDPCYSCTDRMTVVDVRKKKSKVVPYKELERYSIERKNSPLK"
FT   gene            119737..120279
FT                   /locus_tag="SARI_00124"
FT   CDS_pept        119737..120279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3083 2.8e-95 hycF; formate
FT                   hydrogenlyase subunit 6; COG: COG1143 Formate hydrogenlyase
FT                   subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit
FT                   (chain I); Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20077"
FT                   /db_xref="GOA:A9MFW9"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFW9"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="protein motif:superfamily:IPR009051"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457242.1"
FT                   /protein_id="ABX20077.1"
FT                   /translation="MFTFIKKVIKTGTATSSYPLEPIAVDKNFRGKPEHNPQQCIGCAA
FT                   CVNACPSNALTVETDLATNELAWQFNLGRCIFCGRCEEVCPTAAIKLSQEYELAVWKKE
FT                   DFLQQSRFALCNCRVCNRPFAVQKEIDYAIALLKHNGDSRAEHHRESFETCPDCKRQKC
FT                   LVPSDRIELTRHMKEAS"
FT   gene            120279..121046
FT                   /locus_tag="SARI_00125"
FT   CDS_pept        120279..121046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00125"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3082 1.4e-132 hycG; formate
FT                   hydrogenlyase subunit 7; COG: COG3260 Ni,Fe-hydrogenase III
FT                   small subunit; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20078"
FT                   /db_xref="GOA:A9MFX0"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFX0"
FT                   /inference="protein motif:HMMPfam:IPR006137"
FT                   /inference="protein motif:ScanRegExp:IPR006138"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461768.1"
FT                   /protein_id="ABX20078.1"
FT                   /translation="MSNLLGPRDANGIPVPMTVDESIASMKASLLKNIKRSAYVYRVDC
FT                   GGCNGCEIEIFATLSPLFDAERFGIKVVPSPRHADILLFTGAVTRAMRSPALRAWQSAP
FT                   DPKICISYGACGNSGGIFHDLYCVWGGTDKIVPVDVYIPGCPPTPAATLYGFAMALGLL
FT                   EQKIHARAPGELDDQPAEILHPDMVQPLRVKVDRAARRLAGYRYGRQIADDYLTQLGQG
FT                   EQQVARWLEAENDPRLTEIVTHLNHVVEEARIR"
FT   gene            121043..121453
FT                   /locus_tag="SARI_00126"
FT   CDS_pept        121043..121453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3081 2.2e-63 hycH; formate
FT                   hydrogenlyase maturation protein HycH; COG: NOG09848 non
FT                   supervised orthologous group; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20079"
FT                   /db_xref="InterPro:IPR010005"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFX1"
FT                   /inference="protein motif:HMMPfam:IPR010005"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457240.1"
FT                   /protein_id="ABX20079.1"
FT                   /translation="MSEQVVFSQLSRKFIDENDATPAEAQQVVYYSLAIGHHLGVIDCL
FT                   EAALTCPWDEYLAWIATLEAGSDARRKMEGVPKYGEIVIDFNHVSMLARAFDNARAAQT
FT                   PQQQEWSKLMLSMLHDIHQESAIYLMVRRLRD"
FT   gene            121479..121916
FT                   /locus_tag="SARI_00127"
FT   CDS_pept        121479..121916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2778 7.5e-72 hycI, hycE; protease
FT                   involved in processing C-terminal end of HycE K08315; COG:
FT                   COG0680 Ni,Fe-hydrogenase maturation factor; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20080"
FT                   /db_xref="GOA:A9MFX2"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004420"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFX2"
FT                   /inference="protein motif:Gene3D:IPR000671"
FT                   /inference="protein motif:HMMPfam:IPR000671"
FT                   /inference="protein motif:HMMPIR:IPR000671"
FT                   /inference="protein motif:HMMTigr:IPR000671"
FT                   /inference="protein motif:HMMTigr:IPR004420"
FT                   /inference="protein motif:HMMTigr:IPR006227"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217765.1"
FT                   /protein_id="ABX20080.1"
FT                   /translation="MMGDDGAGPLLAEKCVAQPKGNWVVIDGGSAPENDIVAIRELRPD
FT                   RLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLVDQLKEDVGEVIFLGIQP
FT                   DIVGFYYPMTQPIKDAVDTVYQRLEGWLGHGGFAALEAPEA"
FT   gene            122108..122653
FT                   /locus_tag="SARI_00128"
FT   CDS_pept        122108..122653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3075 1.9e-91 hydN; electron
FT                   transport protein HydN K05796; COG: COG1142
FT                   Fe-S-cluster-containing hydrogenase components 2; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20081"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFX3"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457237.1"
FT                   /protein_id="ABX20081.1"
FT                   /translation="MNRFIIADASKCIGCRTCEVACVVSHQENQDCASLTPETFLPRIH
FT                   VIKGVNVSTATLCRQCEDAPCANVCPNGAISRDKGFVHVMQERCIGCKTCVVACPYGAM
FT                   EVVVRPVVRNSGAGLNVRAEKAEANKCDLCHHREAGPACMAACPTHALICVDRNKLEQL
FT                   SAEKRRRAALDSTASLLF"
FT   gene            122788..125028
FT                   /locus_tag="SARI_00129"
FT   CDS_pept        122788..125028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msu:MS0845 3.5e-06 acyP; acylphosphatases
FT                   K01512; COG: COG0068 Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20082"
FT                   /db_xref="GOA:A9MFX4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFX4"
FT                   /inference="protein motif:BlastProDom:IPR001792"
FT                   /inference="protein motif:BlastProDom:IPR006071"
FT                   /inference="protein motif:HMMPfam:IPR001792"
FT                   /inference="protein motif:HMMPfam:IPR006070"
FT                   /inference="protein motif:HMMPfam:IPR011125"
FT                   /inference="protein motif:HMMPIR:IPR004421"
FT                   /inference="protein motif:HMMTigr:IPR004421"
FT                   /inference="protein motif:ScanRegExp:IPR001792"
FT                   /inference="protein motif:superfamily:IPR011056"
FT                   /protein_id="ABX20082.1"
FT                   /translation="MAIDTPSGVQLRIRGKVQGVGFRPFVWQLAQQLRLHGDVCNDGDG
FT                   VVVRLLEEPSQFIAALYQHCPPLARIDSVEHESLIWERTPTDFAIRQSAGGAMNTQIVP
FT                   DAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPECD
FT                   TEYRDPYDRRFHAQPVACPACGPHLEWLSQCERAEKEAALQAAVAQLNAGGIIAVKGLG
FT                   GFHLVCDARNNSAVAMLRARKHRPAKPLAVMLPTAQTLPTAARSLLTTPAAPIVLVDKQ
FT                   SVPSLCEGIAPGLTEVGVMLPANPLQHLLLQALNYPLVMTSGNLSGRPPAITNEQALDD
FT                   LHDIADGFLLHNRDIVQRMDDSVVRDSGEMLRRSRGYVPDAIALPPGFRDVPPILCLGA
FT                   DLKNTFCLVRGEQAVVSQHLGDLSDDGIQAQWREALRLIQSIYDFTPERIVCDAHPGYV
FT                   SSRWASEMRLPTGAVLHHHAHAAACLAEHGWPLDGGEVIALTVDGIGMGENGALWGGEC
FT                   LRVNYRQCERLGGLPAVALPGGDLAARQPWRNLLAQCLRFVPDWQNYPETAGVQQQSWN
FT                   VLARAIERGVNAPLASSCGRLFDAVAAALRCAPALLSYEGEAACALEALASQCVHVKHP
FT                   VTMPLNGAQLDLAVFWRQWLSWQATPAQRAWAFHDALACGFATLMRQQATARGITTLVF
FT                   SGGVIHNRLLRARLSFYLSDFNLLFPQQFPAGDGGLSLGQGVVAAARWLSEA"
FT   gene            complement(125125..126258)
FT                   /locus_tag="SARI_00130"
FT   CDS_pept        complement(125125..126258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00130"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2841 5.0e-185 ygbD; flavorubredoxin
FT                   reductase K00530; COG: COG0446 Uncharacterized
FT                   NAD(FAD)-dependent dehydrogenases; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20083"
FT                   /db_xref="GOA:A9MFX5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR023961"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MFX5"
FT                   /inference="protein motif:BlastProDom:IPR001327"
FT                   /inference="protein motif:FPrintScan:IPR001100"
FT                   /inference="protein motif:FPrintScan:IPR013027"
FT                   /inference="protein motif:HMMPfam:IPR001327"
FT                   /inference="protein motif:HMMPfam:IPR013027"
FT                   /inference="similar to AA sequence:INSD:AAL21721.1"
FT                   /protein_id="ABX20083.1"
FT                   /translation="MSRGIIIIGSGFAARQLVKNIRKQDAHVPLTLIAADSMDEYNKPD
FT                   LSHVISQSQRADDLTRQLAGEFAEQFNLRLFPHTWVADIDADAHVVKSQDKQWQYDKLV
FT                   LATGAAAFVPPVAGRELMLTLNSQQEYRACETQLRAAQRVLIVGGGLIGSELAMDFCRA
FT                   GKTVTLMDNAASLLASLMPPEVSSRLQHRLTDMGVHLQLKSQLQELEKSEAGIRATLAS
FT                   QRRIEVDAAIAATGLRPETALARRAGLVINHGVCVDSYLQTSHPDIYAIGDCAEINGQV
FT                   LPFLQPIQLSAMYLAKNLLGGKAPLKLPAMLVKVKTPELPLYLAGETQRRDLSWHITAE
FT                   SDGMIAKGMSGEGQLRAFVASEDRMKEAFALLKMLPV"
FT   gene            complement(126255..127694)
FT                   /locus_tag="SARI_00131"
FT   CDS_pept        complement(126255..127694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3072 4.9e-249 norV; anaerobic
FT                   nitric oxide reductase flavorubredoxin; COG: COG0426
FT                   Uncharacterized flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20084"
FT                   /db_xref="GOA:A9MFX6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR023957"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MFX6"
FT                   /inference="protein motif:BlastProDom:IPR004039"
FT                   /inference="protein motif:HMMPfam:IPR001279"
FT                   /inference="protein motif:HMMPfam:IPR004039"
FT                   /inference="protein motif:HMMPfam:IPR008254"
FT                   /inference="similar to AA sequence:INSD:AAV78555.1"
FT                   /protein_id="ABX20084.1"
FT                   /translation="MSILVKNNIHWVGQRDWEVRDFHGTEYKTLRGSSYNSYLIREEKN
FT                   VLIDTVDHKFSREFVQNLRSEIDLADIDYIIINHAEEDHAGALTELMAQIPDAPIYCTA
FT                   NAIDSINGHHHHPEWNFKVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYMTGDAVLF
FT                   SNDAFGQHYCDERLFNDEVDQTELFEQCQRYYANILTPFSRLVTPKITEILGFNLPVDM
FT                   IATSHGVVWRDNPTQIVELYLKWAADYQEDRITIFYDTMSNNTRIMADAIAQGINEVDP
FT                   NVAVKIFNVARSDKNEILTNVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLRFRNKRA
FT                   SAFGSHGWSGGAVDRLSTRLQDAGFEMSLSLKAKWRPDLDALELCRQHGRDIARQWALA
FT                   PLPETTQKTTPAEEITTCAAADLGPKMQCSVCQWIYDPALGEPLQDVAPGTPWSDVPDN
FT                   FLCPECSLGKDVFDVLATEAK"
FT   gene            127850..129400
FT                   /locus_tag="SARI_00132"
FT   CDS_pept        127850..129400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B2325 3.6e-111 norR2; nitric oxide
FT                   reductase regulator (NorR2) K01529; COG: COG3604
FT                   Transcriptional regulator containing GAF, AAA-type ATPase,
FT                   and DNA binding domains; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20085"
FT                   /db_xref="GOA:A9MFX7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023944"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MFX7"
FT                   /inference="protein motif:HMMPfam:IPR002078"
FT                   /inference="protein motif:HMMPfam:IPR003018"
FT                   /inference="protein motif:HMMSmart:IPR003018"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR002078"
FT                   /inference="protein motif:superfamily:IPR008931"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461760.1"
FT                   /protein_id="ABX20085.1"
FT                   /translation="MHCQNDNEVAMSFSVEVLAGIAIELQRGIGHQDRFQRLITTLRQV
FT                   LACDASALLRYESGQFIPLAIDGLAQDVLGRRFTLEGHPRLEAIARAGDVVRFPADSDL
FT                   PDPYDGLIPGQESLKVHACVGLPLFAGQNLIGALTFDAMTPAQFEVFSDEELRLIAALA
FT                   AGALSNALLIEQLESQNMLPRSSAAFEPIKETHMIGLSPAMTQLKKEIEIVASSDLNVL
FT                   IGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPESVAESELFGHVKGAFTGAISNR
FT                   SGKFEMADNGTLFLDEIGELSLALQAKLLRVLQYGDIQRVGDDRSLRVDVRVLAATNRD
FT                   LREEVLAGRFRADLFHRLSVFPLFVPPLRERGNDVVLLAGYFCEQCRLRLGLSRVVLSP
FT                   GARRHLLNYGWPGNVRELEHAIHRAVVLARATRAGDEVILEAQHFALSEDVLPAPPAES
FT                   FLALPNCRNLRESTENFQRELIRQALAQNHHNWAASARALETDVANLHRLAKRLGLKD"
FT   gene            complement(129397..130362)
FT                   /locus_tag="SARI_00133"
FT   CDS_pept        complement(129397..130362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3070 1.9e-153 gutQ; GutQ protein
FT                   K02467; COG: COG0794 Predicted sugar phosphate isomerase
FT                   involved in capsule formation; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20086"
FT                   /db_xref="GOA:A9MFX8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFX8"
FT                   /inference="protein motif:HMMPfam:IPR000644"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="protein motif:HMMTigr:IPR004800"
FT                   /inference="similar to AA sequence:INSD:AAO70301.1"
FT                   /protein_id="ABX20086.1"
FT                   /translation="MSDALLHAGRQTLMLELQEASRLPERLGDDFVRAANIIIHCEGKV
FT                   IVSGIGKSGHIGKKIAATLASTGTPAFFVHPAEALHGDLGMIESRDVMLFISYSGGAKE
FT                   LDLIIPRLEDKSVALLAMTGKPHSPLGRAAKAVLDISVEREACPMHLAPTSSTVNTLMM
FT                   GDALAMAVMQARGFNEEDFARSHPAGALGARLLNNVHHLMRQGDAIPQVMLATSVMDAM
FT                   LELSRTGLGLVAVCDEQHVVKGVFTDGDLRRWLVSGGALTTPVSEAMTPNGITLQAQSR
FT                   AIDAKELLMKRKITAAPVVDENGKLTGAINLQDFYQAGII"
FT   gene            complement(130355..131128)
FT                   /locus_tag="SARI_00134"
FT   CDS_pept        complement(130355..131128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00134"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1349 Transcriptional regulators of sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20087"
FT                   /db_xref="GOA:A9MFX9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFX9"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR001034"
FT                   /inference="protein motif:HMMSmart:IPR001034"
FT                   /inference="protein motif:ScanRegExp:IPR001034"
FT                   /inference="similar to AA sequence:REFSEQ:NP_806440.1"
FT                   /protein_id="ABX20087.1"
FT                   /translation="MKPRQRQAAILEHLQKQGKCSVEELAQYFDTTGTTIRKDLVILEN
FT                   AGTVIRTYGGVVLNKEESDPPIDHKTLINTHKKALIAATAVKYIHDGDSIILDAGSTVL
FT                   QMVPLLSRFSNITVMTNSLHIVNSLSELDNEQTILMPGGTFRKKSASFHGQLAENAFEQ
FT                   FSFDKLFMGTDGIDLNAGVTTFNEVYTVSKAMCNAAREVILMADSSKFGRKSPNVVCSL
FT                   ESVDKLITDAGIDPAFRQALEEKGITVIITGESNE"
FT   gene            131149..131586
FT                   /locus_tag="SARI_00135"
FT   CDS_pept        131149..131586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20088"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFY0"
FT                   /protein_id="ABX20088.1"
FT                   /translation="MYALRNDNFASYSHSQRNYPCFSLSANDSAFCASESWGKITSGCN
FT                   SCKCFPCIAAILTGLANTVRPFINKVSVTRCCSSSATATTTRGLKRPPERPTPTRPCWL
FT                   SLSNARLKREICQPPSASCAHQAITATVIRVETIMCSCCFA"
FT   gene            complement(131202..131561)
FT                   /locus_tag="SARI_00136"
FT   CDS_pept        complement(131202..131561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00136"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4578 Glucitol operon activator"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20089"
FT                   /db_xref="InterPro:IPR009693"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFY1"
FT                   /inference="protein motif:HMMPfam:IPR009693"
FT                   /inference="similar to AA sequence:INSD:AAX66675.1"
FT                   /protein_id="ABX20089.1"
FT                   /translation="MVSTLITVAVIAWCAQLALGGWQISRFNRAFDKLSQQGRVGVGRS
FT                   GGRFKPRVVVAVALDEQQRVTDTLLMKGLTVFARPVKIAAMQGKHLHELQPDVIFPHDS
FT                   LAQNALSLALKLKHG"
FT   gene            complement(131638..132417)
FT                   /locus_tag="SARI_00137"
FT   CDS_pept        complement(131638..132417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA2693 2.0e-133 srlD;
FT                   sorbitol-6-phosphate 2-dehydrogenase (glucitol-6-phosphate
FT                   dehydrogenase) K00068; COG: COG1028 Dehydrogenases with
FT                   different specificities (related to short-chain alcohol
FT                   dehydrogenases); Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00137"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20090"
FT                   /db_xref="GOA:A9MFY2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFY2"
FT                   /inference="protein motif:HMMPanther:IPR002347"
FT                   /inference="protein motif:HMMPfam:IPR002198"
FT                   /inference="protein motif:ScanRegExp:IPR002198"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461756.1"
FT                   /protein_id="ABX20090.1"
FT                   /translation="MNQVAVVIGGGQTLGAFLCRGLAEEGYRVAVVDIQSDKAANVARE
FT                   INADFGEGMAYGFGADATSEQSVLALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGD
FT                   FDRSLQVNLVGYFLCAREFSRLMIRDGIQGRIIQINSKSGKVGSKHNSGYSAAKFGGVG
FT                   LTQSLALDLAEYGITVHSLMLGNLLKSPMFQSLLPQYATKLGIKPDEVEQYYIDKVPLK
FT                   RGCDYQDVLNMLLFYASPKASYCTGQSINVTGGQVMF"
FT   gene            complement(132428..132790)
FT                   /locus_tag="SARI_00138"
FT   CDS_pept        complement(132428..132790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA2692 2.5e-57 srlB;
FT                   glucitol/sorbitol-specific IIA component of PTS system
FT                   K02781; COG: COG3731 Phosphotransferase system
FT                   sorbitol-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20091"
FT                   /db_xref="GOA:A9MFY3"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFY3"
FT                   /inference="protein motif:BlastProDom:IPR004716"
FT                   /inference="protein motif:HMMPfam:IPR004716"
FT                   /inference="protein motif:HMMPIR:IPR004716"
FT                   /inference="similar to AA sequence:INSD:AAV78549.1"
FT                   /protein_id="ABX20091.1"
FT                   /translation="MSVIYQTTITRIGQSAAEALGEQMLITFREGAPADIEEFCFIHCH
FT                   GELTGELQPGARFELGQHCYPVTAVGSVAGQNLRELGHITLRFDGLREAEFPGTVHVAG
FT                   LVPDDIAPGCILKFIA"
FT   gene            complement(132802..133773)
FT                   /locus_tag="SARI_00139"
FT   CDS_pept        complement(132802..133773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2954 7.6e-166 srlE; PTS system,
FT                   glucitol/sorbitol-specific IIBC component K02782:K02783;
FT                   COG: COG3732 Phosphotransferase system sorbitol-specific
FT                   component IIBC; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00139"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20092"
FT                   /db_xref="GOA:A9MFY4"
FT                   /db_xref="InterPro:IPR004702"
FT                   /db_xref="InterPro:IPR011618"
FT                   /db_xref="InterPro:IPR011638"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFY4"
FT                   /inference="protein motif:HMMPfam:IPR011618"
FT                   /inference="protein motif:HMMPfam:IPR011638"
FT                   /inference="protein motif:HMMTigr:IPR004702"
FT                   /inference="protein motif:ScanRegExp:IPR000719"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX20092.1"
FT                   /translation="MTRVRIEKGAGGWGGPLELNVTSGKKIVYITAGTRPAIVDKLAQL
FT                   TGWQAVDGFKEGEPPEAEIGAAIIDCGGTLRCGIYPKRRIPTINIHSTGKSGPLAQYIV
FT                   EDIYVSGVKEENLTLVGETSASPQPAAATAGRDYDTSKKITEQSDGLLAKVGMGMGSAV
FT                   AVLFQSGRDTIDTVLKTILPFMAFVSALIGIIMASGLGDWIAHGLAPLASHPLGLVTLA
FT                   LICSFPLLSPFLGPGAVIAQVIGVLIGVQIGLGNIPPHLALPALFAINAQAACDFIPVG
FT                   LSLAEAKQDTVRVGVPSVLVGRFLTGAPTVLIAWFVSGFIYQ"
FT   gene            complement(133770..134390)
FT                   /locus_tag="SARI_00140"
FT   CDS_pept        complement(133770..134390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00140"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2765 1.0e-97 srlA; PTS family,
FT                   glucitol/sorbitol-specific enzyme IIC component,one of two
FT                   IIC components K02782:K02783; COG: COG3730
FT                   Phosphotransferase system sorbitol-specific component IIC;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20093"
FT                   /db_xref="GOA:A9MFY5"
FT                   /db_xref="InterPro:IPR004699"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFY5"
FT                   /inference="protein motif:HMMPfam:IPR004699"
FT                   /inference="protein motif:HMMTigr:IPR004699"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217752.1"
FT                   /protein_id="ABX20093.1"
FT                   /translation="MIKMNRKLVRKLKTLQERTMIETITHGAEWFIGLFQKGGEVFTGM
FT                   VTGILPLLISLLVIMNALINFIGQQRIERFAQRCAGNPLSRYLLLPCIGTFVFCNPMTL
FT                   SLGRFMPEKYKPSYYAAASYSCHSMNGLFPHINPGELFVYLGIASGLTTLGLPLGPLAV
FT                   SYLLVGLVTNFFRGWVTDLTTAIFEKKMGIQLDQKVHLTGAAS"
FT   gene            134736..135668
FT                   /locus_tag="SARI_00141"
FT   CDS_pept        134736..135668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA2689 6.6e-167 mltB; membrane-bound
FT                   lytic transglycosylase B precursor K08305; COG: COG2951
FT                   Membrane-bound lytic murein transglycosylase B"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20094"
FT                   /db_xref="InterPro:IPR011757"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFY6"
FT                   /inference="protein motif:HMMTigr:IPR011757"
FT                   /inference="similar to AA sequence:INSD:AAV78546.1"
FT                   /protein_id="ABX20094.1"
FT                   /translation="MGGDFANNPNAQQFIDKMVSKHGFDRQQLQEILSQSKKLDYVLRL
FT                   MDRQAPTTQPPAGPNGAWLRYRKQFITPDNVQNGVAFWNQYEDALNRAWQVYGVPPEII
FT                   VGIIGVETRWGRIMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARNEQDDPLNLK
FT                   GSFAGAMGYGQFMPSSYKEYAVDFNGDNHINLWDPVDAIGSVANYFKAHGWVKGDVVAI
FT                   PANGQAPGLANGFKTKYSVSQLAAAGLTPQQSLGNHQEASLLRLDVGTDYQYWYGLPNF
FT                   YAITRYNHSTHYAMAVWQLGQAVALARVR"
FT   gene            135851..136351
FT                   /locus_tag="SARI_00142"
FT   CDS_pept        135851..136351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00142"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1546 Uncharacterized protein (competence-
FT                   and mitomycin-induced)"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20095"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFY7"
FT                   /inference="protein motif:HMMPfam:IPR008136"
FT                   /inference="protein motif:HMMPIR:IPR012244"
FT                   /inference="protein motif:HMMTigr:IPR008136"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461751.1"
FT                   /protein_id="ABX20095.1"
FT                   /translation="MMTDSELMRLSEQVGLALKTRGAIVTTAESCTGGWLAKAITDVAG
FT                   SSAWFERGFVTYSNEAKAQMIGVREETLAQHGAVSEPVVVEMAIGALKAARADFAIAIS
FT                   GIAGPDGGSEEKPVGTVWFAFASVSGEGITRRECFSGNRESVRRQATTYALQNLWQQFL
FT                   QNT"
FT   gene            136421..137497
FT                   /locus_tag="SARI_00143"
FT   CDS_pept        136421..137497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3061 1.5e-178 recA; RecA protein
FT                   K03553; COG: COG0468 RecA/RadA recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20096"
FT                   /db_xref="GOA:A9MFY8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFY8"
FT                   /inference="protein motif:BlastProDom:IPR001553"
FT                   /inference="protein motif:HMMPfam:IPR013765"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR001553"
FT                   /inference="protein motif:ScanRegExp:IPR001553"
FT                   /inference="similar to AA sequence:INSD:AAO70291.1"
FT                   /protein_id="ABX20096.1"
FT                   /translation="MTGVIMAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVET
FT                   ISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHA
FT                   LDPVYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEG
FT                   EIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALK
FT                   FYASVRLDIRRIGAVKEGDNVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELV
FT                   DLGVKEKLIEKAGAWYSYNGEKIGQGKANATTWLKENPATAKEIEKKVRELLLSNQNSS
FT                   PDFAVDDSEGVAETNEDF"
FT   gene            137614..138114
FT                   /locus_tag="SARI_00144"
FT   CDS_pept        137614..138114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00144"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2137 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20097"
FT                   /db_xref="GOA:A9MFY9"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MFY9"
FT                   /inference="protein motif:HMMPfam:IPR003783"
FT                   /inference="similar to AA sequence:SwissProt:Q8Z4D4"
FT                   /protein_id="ABX20097.1"
FT                   /translation="MSEPTPRRPAYARLLDRAVRILAVRDHSEQELRRKLSAPVMGKNG
FT                   PEEIDATPDDYERVISWCHEHHYLDDNRFVIRFIASRSRKGYGPARIRQELNQKGIARE
FT                   STEKAMRECDIDWSEMAREQAVRKYGEPLPSTFSEKVKVQRFLLYRGYLMDDIQEIWRN
FT                   FAD"
FT   gene            complement(138240..138623)
FT                   /locus_tag="SARI_00145"
FT   CDS_pept        complement(138240..138623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20098"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFZ0"
FT                   /inference="similar to AA sequence:INSD:AAG57802.1"
FT                   /protein_id="ABX20098.1"
FT                   /translation="MVTCSVSDVFQIVVFPPRAYTALGSGCTGIITLIKPKENILELVH
FT                   PGIGKQQRGVIVGHQGTAGNYLMSFTMEKVEKRLTDLSGALAHNYPEIKLHVLLQAFSA
FT                   LAANSPVANFDMFPRLTYRLDAA"
FT   gene            138636..140990
FT                   /locus_tag="SARI_00146"
FT   CDS_pept        138636..140990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2827 0. alaS; alanyl-tRNA synthetase
FT                   K01872; COG: COG0013 Alanyl-tRNA synthetase; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20099"
FT                   /db_xref="GOA:A9MFZ1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MFZ1"
FT                   /inference="protein motif:FPrintScan:IPR002318"
FT                   /inference="protein motif:HMMPfam:IPR002318"
FT                   /inference="protein motif:HMMPfam:IPR003156"
FT                   /inference="protein motif:HMMPfam:IPR012947"
FT                   /inference="protein motif:HMMTigr:IPR002318"
FT                   /protein_id="ABX20099.1"
FT                   /translation="MLGNFSFGDYFKHDAIQFAWELLTGENWFALPKERLWVTVYETDD
FT                   EAYGIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPCTEIFYDHGDHIWGG
FT                   PPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLERIAAVLQHVNSNY
FT                   EIDLFRTLIEAVAKVTGATDLSNKSLRVIADHIRSCAFLVADGVLPSNENRGYVLRRII
FT                   RRAVRHGNMLGAKETFFYKLVGPLIEVMGSAGEELKRQQAQVEQVLKTEEEQFARTLER
FT                   GLALLDEELAKLQGDTLDGETAFRLYDTYGFPVDLTADVCRERDIKVDEAGFETAMEEQ
FT                   RRRAREASGFGADYNAMIRVDSASEFKGYDHLELNGKVTALFVNGKAVEAINAGQEAVV
FT                   VLDQTPFYAESGGQVGDKGELKGVGFTFAVNDTQKYGQAIGHLGKLSAGALKVGDVVQA
FT                   DVDEARRARIRLNHSATHLMHAALRQVLGAHVAQKGSLVSDKVLRFDFSHNEAMKPSEI
FT                   REVEDLVNAQIRRNLPIETHIMELEAAKAKGAMALFGEKYDERVRVLSMGDFSTELCGG
FT                   THARRTGDIGLFRIISESGTAAGVRRIEAVTGEGAMATVHAQSDRLNDIAHLLKGDSQN
FT                   LGDKVRAVLERSRQLEKELQQLKDQAAAQESASLSSKAVDLNGVKLLVSELAGVEPKML
FT                   RTMVDDLKNQLGSTVIVLATVVEGKVSLIAGVSKDVTGRVKAGELIGMVAQQVGGKGGG
FT                   RPDMAQAGGTDAAALPAALASVQDWVSAKLQ"
FT   gene            141225..141410
FT                   /locus_tag="SARI_00147"
FT   CDS_pept        141225..141410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00147"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1551 Carbon storage regulator (could also
FT                   regulate swarming and quorum sensing)"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20100"
FT                   /db_xref="GOA:A9MFZ2"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MFZ2"
FT                   /inference="protein motif:BlastProDom:IPR003751"
FT                   /inference="protein motif:HMMPfam:IPR003751"
FT                   /inference="protein motif:HMMTigr:IPR003751"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /inference="similar to AA sequence:INSD:AAN44211.1"
FT                   /protein_id="ABX20100.1"
FT                   /translation="MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHRE
FT                   EIYQRIQAEKSQQSSY"
FT   unsure          141579..141805
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            141724..141813
FT                   /locus_tag="SARI_00148"
FT   tRNA            141724..141813
FT                   /locus_tag="SARI_00148"
FT                   /product="tRNA-Ser"
FT   gene            141821..141894
FT                   /locus_tag="SARI_00149"
FT   tRNA            141821..141894
FT                   /locus_tag="SARI_00149"
FT                   /product="tRNA-Arg"
FT   gene            141957..142030
FT                   /locus_tag="SARI_00150"
FT   tRNA            141957..142030
FT                   /locus_tag="SARI_00150"
FT                   /product="tRNA-Arg"
FT   gene            142096..142169
FT                   /locus_tag="SARI_00151"
FT   tRNA            142096..142169
FT                   /locus_tag="SARI_00151"
FT                   /product="tRNA-Arg"
FT   gene            142235..142308
FT                   /locus_tag="SARI_00152"
FT   tRNA            142235..142308
FT                   /locus_tag="SARI_00152"
FT                   /product="tRNA-Arg"
FT   gene            142560..143126
FT                   /locus_tag="SARI_00153"
FT   CDS_pept        142560..143126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3052 1.2e-87 yqaB; putative
FT                   phosphatase K01091; COG: COG0637 Predicted
FT                   phosphatase/phosphohexomutase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00153"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20101"
FT                   /db_xref="GOA:A9MFZ3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFZ3"
FT                   /inference="protein motif:FPrintScan:IPR005833"
FT                   /inference="protein motif:HMMPfam:IPR005834"
FT                   /inference="protein motif:HMMTigr:IPR006402"
FT                   /inference="protein motif:HMMTigr:IPR010976"
FT                   /inference="similar to AA sequence:INSD:AAL21705.1"
FT                   /protein_id="ABX20101.1"
FT                   /translation="MYARYAGLIFDMDGTLLDTEPTHRKAWREVLGRYGLRFDKQAMVA
FT                   LNGSPTWRIAQSIIELNHADLDPRSLAREKTDTVKSILLDCVEPLPLVEVVKAWYGRRP
FT                   LSVGTGSESAIAEALLAHLGLRRYFDAVVAADHVQHHKPAPDTFLLCAQRMGVMPAQCV
FT                   VFEDADFGLQAARAAGMDAVDVRLL"
FT   gene            143123..143548
FT                   /locus_tag="SARI_00154"
FT   CDS_pept        143123..143548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00154"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1238 Predicted membrane protein; Psort
FT                   location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20102"
FT                   /db_xref="GOA:A9MFZ4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFZ4"
FT                   /inference="similar to AA sequence:INSD:AAL21704.1"
FT                   /protein_id="ABX20102.1"
FT                   /translation="MSDGLSLLSLFASSFLSATLLPGNSEVVLVAMMVSGVSHPWILVL
FT                   TATMGNSLGGVTNVILGRFFPLRKTSRWQEKAAGWLKRYGAATLLLSWMPIIGDLLCLL
FT                   AGWMRIPWGRTIFFLCLGKALRYVALAAATIQGMMWW"
FT   gene            143626..145182
FT                   /locus_tag="SARI_00155"
FT   CDS_pept        143626..145182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2753 2.2e-278 gshA;
FT                   gamma-glutamate-cysteine ligase K01919; COG: COG2918
FT                   Gamma-glutamylcysteine synthetase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20103"
FT                   /db_xref="GOA:A9MFZ5"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MFZ5"
FT                   /inference="protein motif:HMMPfam:IPR007370"
FT                   /inference="protein motif:HMMTigr:IPR006334"
FT                   /inference="similar to AA sequence:INSD:AAL21703.1"
FT                   /protein_id="ABX20103.1"
FT                   /translation="MIPDVSQALAWLEKHPQALKGIQRGLERETLRVNADGTLATTGHP
FT                   EALGSALTHKWITTDFAEALLEFITPVDGDIQHMLTFMRDLHRYTARKLGDERMWPLSM
FT                   PCYIAEGQDIELAQYGTSNTGRFKTLYREGLKNRYGALMQTISGVHYNFSLPMAFWQAK
FT                   CGVTEGDAAKEKISAGYFRLIRNYYRFGWVIPYLFGASPAICSSFLQGKPTTLPFEKTD
FT                   CGMYYLPYATSLRLSDLGYTNKSQSNLGITFNDLHEYVAGLKRAIKTPSEEYVQIGLEK
FT                   DGKRLQINSNVLQIENELYAPIRPKRVTRSGESPSDALLRGGIEYIEVRSLDINPFSPI
FT                   GVDEQQVRFLDLFMVWCVLADAPEMSSSELLCTRANWNRVILEGRKPGLTLGIGCETAQ
FT                   FPLPKVGKDLFRDLRRVAQTLDSIHGGEDYQKVCDELVACFDNPELTFSARILRSMIDT
FT                   GIGGTGKAFGEAYRNLLREEPLEILQEEEFIAERDASVRRQQEIEAADTEPFAAWLAKH
FT                   D"
FT   gene            complement(145190..145265)
FT                   /locus_tag="SARI_00156"
FT   misc_RNA        complement(145190..145265)
FT                   /locus_tag="SARI_00156"
FT                   /product="SraD RNA"
FT                   /note="Rfam score 80.82"
FT                   /inference="nucleotide motif:Rfam:RF00078"
FT   gene            145332..145847
FT                   /locus_tag="SARI_00157"
FT   CDS_pept        145332..145847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2752 4.7e-86 luxS; quorum sensing
FT                   protein, produces autoinducer - acyl-homoserine
FT                   lactone-signaling molecules; COG: COG1854 LuxS protein
FT                   involved in autoinducer AI2 synthesis; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20104"
FT                   /db_xref="GOA:A9MFZ6"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MFZ6"
FT                   /inference="protein motif:BlastProDom:IPR003815"
FT                   /inference="protein motif:HMMPfam:IPR003815"
FT                   /inference="protein motif:HMMPIR:IPR003815"
FT                   /inference="similar to AA sequence:INSD:AAR88507.1"
FT                   /protein_id="ABX20104.1"
FT                   /translation="MPLLDSFAVDHTRMQAPAVRVAKTMNTPHGDTITVFDLRFCVPNK
FT                   EVMPEKGIHTLEHLFAGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAW
FT                   KAAMADVLKVQDQNQIPELNVYQCGTWQMHSLNEAQEIARHILDCDIRVNNNTELALPK
FT                   EKLQELHI"
FT   gene            complement(145977..147515)
FT                   /locus_tag="SARI_00158"
FT   CDS_pept        complement(145977..147515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgl:SG1466 5.5e-07 dethiobiotin synthase
FT                   K01935; COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20105"
FT                   /db_xref="GOA:A9MFZ7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFZ7"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="protein motif:HMMTigr:IPR004638"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461741.1"
FT                   /protein_id="ABX20105.1"
FT                   /translation="MQQQKPLEGAQLVIMTIALSLATFMQVLDSTIANVAIPTIAGNLG
FT                   SSLSQGTWVITSFGVANAISIPLTGWLAKRFGEVKLFMWSTVAFAAASWACGVSSSLNM
FT                   LIFFRVVQGVVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISD
FT                   NYHWGWIFFINVPIGVAVVLMTLQTLRGRETRTERRRIDAIGLALLVIGIGSLQIMLDR
FT                   GKELDWFSSQEIIILTVVAVIAISFLIVWELTDDHPIVDLSLFKSRNFTIGCLCISLAY
FT                   MLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFS
FT                   FIMYAVCFYWRAWTFEPGMDFGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAAS
FT                   SLSNFTRTLAGSIGTSITTTMWTDRESLHHAQLTESVTAYNPNAQAMYDKLEGLGMTRQ
FT                   QASGWIAQQITNQGLIISANEIFWMSAGIFLVLLGLVWFAKPPFGAGGGGGGAH"
FT   gene            complement(147532..148731)
FT                   /locus_tag="SARI_00159"
FT   CDS_pept        complement(147532..148731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00159"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1566 Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20106"
FT                   /db_xref="GOA:A9MFZ8"
FT                   /db_xref="InterPro:IPR005694"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFZ8"
FT                   /inference="protein motif:HMMPfam:IPR006143"
FT                   /inference="protein motif:HMMTigr:IPR005694"
FT                   /inference="protein motif:superfamily:IPR011053"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217735.1"
FT                   /protein_id="ABX20106.1"
FT                   /translation="MNNKIVENNMSANAEIQTPQQSAKKKGKRKTALLLLTLLFIIIAV
FT                   AYGIYWFLVLRHIEETDDAYVAGNQVQIMAQVSGSVTKVWADNTDFVKEGDVLVTLDQT
FT                   DARQAFERAKTALASSVRQTHQLMINSKQLQANIDVQKTALAQAQSDFNRRVPLGNANL
FT                   IGREELQHARDAVASAQAKLDAAIQQYNANQAMILNSKLEDQPAVQQAATEVRNAWLAL
FT                   ERTRIVSPMTGYVSRRAVQPGAQISPTTPLMAVVPATDLWVDANFKETQLANMRIGQPV
FT                   TIITDIYGDDVKYTGKVVGLDMGTGSAFSLLPAQNATGNWIKVVQRLPVRVELDARQLE
FT                   QHPLRIGLSTLVTVDTANRDGQVLASQVRTKPVAESNAREINLAPVNKLIDDIVQANAG
FT                   "
FT   gene            complement(148831..149361)
FT                   /locus_tag="SARI_00160"
FT   CDS_pept        complement(148831..149361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00160"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1846 Transcriptional regulators; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20107"
FT                   /db_xref="GOA:A9MFZ9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFZ9"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000835"
FT                   /inference="protein motif:HMMSmart:IPR000835"
FT                   /inference="protein motif:ScanRegExp:IPR000835"
FT                   /inference="similar to AA sequence:INSD:AAX66653.1"
FT                   /protein_id="ABX20107.1"
FT                   /translation="MDSSFTPIEQMLKFRASRHEDFPYQEILLTRLCMHMQGKLLENRN
FT                   KMLKAQGINETLFMALITLESQENHSIQPSELSCALGSSRTNATRIADELEKRGWIERR
FT                   ESDNDRRCLHLQLTEKGQAFLQEVLPPQHHCLHQLWSSLSTAEKDQLEHITRKLLTRLD
FT                   QMEQEGTVLEALR"
FT   gene            complement(149858..151042)
FT                   /locus_tag="SARI_00161"
FT   CDS_pept        complement(149858..151042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_1692 6.3e-17 Xaa-His dipeptidase
FT                   K01270; COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20108"
FT                   /db_xref="GOA:A9MG00"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG00"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:REFSEQ:YP_151845.1"
FT                   /protein_id="ABX20108.1"
FT                   /translation="MTKPTHGLSPALIVLMSVATGLAVASNYYAQPLLDTIAHHFSLSA
FT                   SSAGFIVTAAQLGYAAGLLFLVPLGDMFERRTLIVSMTLLAAGGMLITASSQSLSMMIL
FT                   GTALTGLFSVVAQILVPLAATLATPATRGKVVGTIMSGLLLGILLARTVAGLLANLGGW
FT                   RTVFWLASALMALMAVALWRGLPKLKSDTHLNYPQLLGSVFSLFIHDKLLRTRALLGCL
FT                   TFANFSILWTSMAFLLAAPPFNYSEGMIGLFGLAGAAGALGARPAGGFVDKGKSHLTTT
FT                   VGLLLLLLSWLAIWLGHTSVLALIIGILVLDLTVQGVHITNQTVIYRLHPDARNRLTAG
FT                   YMTSYFIGGAAGSLISASAWQHAGWIGVCLAGVTVALFNLLIWWRGFHRQEAVN"
FT   gene            complement(151207..152202)
FT                   /locus_tag="SARI_00162"
FT   CDS_pept        complement(151207..152202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00162"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2113 ABC-type proline/glycine betaine
FT                   transport systems, periplasmic components; Psort location:
FT                   Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20109"
FT                   /db_xref="GOA:A9MG01"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG01"
FT                   /inference="protein motif:HMMPfam:IPR007210"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX20109.1"
FT                   /translation="MRHTVIFASAFATLVTASAWASDLPGKGITVHPIQSTISEESFQT
FT                   LLVSRALEKLGYTVNKPSEVDYNVGYTSIASGDATFTAVNWQPLHDDMYAAAGGDKKFY
FT                   REGVFVSGAAQGYLIDKKTADQYNITNIAQLKDPKIAKIFDTNGDGKADMMGCSPGWGC
FT                   EAVINHQNKAFELQKTVEVSHGNYAAMMADTITRFKEGKPVLYYTWTPYWVSDVMKPGK
FT                   DVVWLQVPFSSLPGEQKNINTKLPNGANYGFPVNTMHIVANKAWAEKNPAAAKLFAIMK
FT                   LPLADINAQNAMMHAGKSSEADVQGHVDGWINAHQQQFDGWVKEALAAQK"
FT   gene            complement(152272..153336)
FT                   /locus_tag="SARI_00163"
FT   CDS_pept        complement(152272..153336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_A0449 1.6e-62 glycine
FT                   betaine/L-proline ABC transporter, permease protein K02001;
FT                   COG: COG4176 ABC-type proline/glycine betaine transport
FT                   system, permease component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20110"
FT                   /db_xref="GOA:A9MG02"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG02"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="similar to AA sequence:REFSEQ:NP_806413.1"
FT                   /protein_id="ABX20110.1"
FT                   /translation="MADQTNPWDTAQVADTTAQTADAWGTPAGVATDGGSTDWLNNGPA
FT                   PAPEHFSLLDPFHKTLIPLDSWVTEGIDWVVTHFRPLFQGIRVPVDYILNGFQQLLLGM
FT                   PAPVAIILFALIAWQVSGVGMGIAALISLIAIGAIGAWSQAMITLALVLTALLFCVVIG
FT                   LPMGIWLARSPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPI
FT                   IRLTILGINQVPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVI
FT                   ASMIAVGGLGQMVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSRSRGNRRWY
FT                   TTGPVGLITRPFVK"
FT   gene            complement(153329..154531)
FT                   /locus_tag="SARI_00164"
FT   CDS_pept        complement(153329..154531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2809 8.5e-206 proV; ABC superfamily
FT                   (atp_bind), glycine/betaine/proline transport protein
FT                   K02000; COG: COG4175 ABC-type proline/glycine betaine
FT                   transport system, ATPase component; Psort location:
FT                   Cytoplasmic, score:9.12"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20111"
FT                   /db_xref="GOA:A9MG03"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG03"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR000644"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR005892"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="similar to AA sequence:SwissProt:P17328"
FT                   /protein_id="ABX20111.1"
FT                   /translation="MAIKLEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVK
FT                   DASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVR
FT                   RKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHAYPD
FT                   ELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFIS
FT                   HDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIAR
FT                   RSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKFVGVVSIDSLKAALSQAQGIE
FT                   AALIDDPLVVDAQTPLSELLSHVGQAPCAVPVVDEEHQYVGIISKRMLLQALDREGGNN
FT                   G"
FT   gene            complement(154886..155845)
FT                   /locus_tag="SARI_00165"
FT   CDS_pept        complement(154886..155845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2808 2.3e-164 nrdF;
FT                   ribonucleoside-diphosphate reductase 2, beta subunit
FT                   K00526; COG: COG0208 Ribonucleotide reductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20112"
FT                   /db_xref="GOA:A9MG04"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG04"
FT                   /inference="protein motif:Gene3D:IPR012348"
FT                   /inference="protein motif:HMMPfam:IPR000358"
FT                   /inference="protein motif:ScanRegExp:IPR000358"
FT                   /inference="protein motif:superfamily:IPR009078"
FT                   /inference="similar to AA sequence:PDB:2BQ1"
FT                   /protein_id="ABX20112.1"
FT                   /translation="MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAW
FT                   QTLNAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARS
FT                   YSSIFSTLCQSKDVDAAYAWSEENPQLQRKAQIMMTHYVSDEPLKKKIASVFLESFLFY
FT                   SGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKQSAIEREELKLFA
FT                   LDLLMELYDNETRYTEALYAETDWVDDVKAFLCYNANKALMNLGYEALFPPEMADVNPA
FT                   ILAALSPNADENHDFFSGSGSSYVMGKAVETEDEDWNF"
FT   gene            complement(155856..157973)
FT                   /locus_tag="SARI_00166"
FT   CDS_pept        complement(155856..157973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00166"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2741 0. nrdE; ribonucleoside diphosphate
FT                   reductase 2, alpha subunit K00525; COG: COG0209
FT                   Ribonucleotide reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20113"
FT                   /db_xref="GOA:A9MG05"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG05"
FT                   /inference="protein motif:FPrintScan:IPR000788"
FT                   /inference="protein motif:HMMPanther:IPR000788"
FT                   /inference="protein motif:HMMPfam:IPR000788"
FT                   /inference="protein motif:HMMPfam:IPR013509"
FT                   /inference="protein motif:HMMPfam:IPR013554"
FT                   /inference="protein motif:HMMTigr:IPR013346"
FT                   /inference="protein motif:ScanRegExp:IPR000788"
FT                   /inference="protein motif:superfamily:IPR008926"
FT                   /protein_id="ABX20113.1"
FT                   /translation="MQETMDYHALNAMLNLYDKAGHIQFDKDQQAVDAFFAAHVRPHSV
FT                   TFASQDERLDTLVREGYYDDAILARYDRAFVLSLFGHAHASGFRFQTFLGAWKFYTSYT
FT                   LKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQR
FT                   GELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIQNQSSGV
FT                   IPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGV
FT                   VIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELLADSHVRKTYINARD
FT                   FFQTLAEIQFESGYPYIMFEDTVNRANPIAGRINMSNLCSEILQVNSASRYDDNLDYIH
FT                   IGHDISCNLGSLNIAHVMDSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAI
FT                   GLGQMNLHGYLAREGIAYGSPEALDFTNFYFYTITWHALHTSMRLARERGKTFAGFAQS
FT                   RYASGDYFTQYLQDDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQA
FT                   VPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMYQDAYEIGPE
FT                   KIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEG
FT                   TEIEGCVSCAL"
FT   gene            complement(157973..158383)
FT                   /locus_tag="SARI_00167"
FT   CDS_pept        complement(157973..158383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ayw:AYWB_025 0.00034 nrdA;
FT                   ribonucleoside-diphosphate reductase alpha chain K00525;
FT                   COG: COG1780 Protein involved in ribonucleotide reduction"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20114"
FT                   /db_xref="GOA:A9MG06"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MG06"
FT                   /inference="protein motif:HMMPfam:IPR004465"
FT                   /inference="protein motif:HMMTigr:IPR004465"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457205.1"
FT                   /protein_id="ABX20114.1"
FT                   /translation="MSALVYFSSSSENTHRFMQRLGLPATRIPLNERERIRVDEPYILV
FT                   VPSYGGGGMAGAVPRQVIRFLNDEHNRARIRGVIASGNRNFGDAWGCAGDVIAQKCGVP
FT                   WLYRFELMGTQRDIDHVRKGVNEFWRQQTRSA"
FT   gene            complement(158380..158640)
FT                   /locus_tag="SARI_00168"
FT   CDS_pept        complement(158380..158640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VFA1040 0.00024 glutaredoxin K00435; COG:
FT                   COG0695 Glutaredoxin and related proteins; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20115"
FT                   /db_xref="GOA:A9MG07"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG07"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR002109"
FT                   /inference="protein motif:HMMTigr:IPR011909"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:AAX66645.1"
FT                   /protein_id="ABX20115.1"
FT                   /translation="MEIRIMSITIYTRNNCVQCHATKRAMESRGFEFEMVNVDLVPDAA
FT                   DTLRAQGFRQLPVVMAGDLSWSGFRPDMINRLHPAPHAASA"
FT   gene            complement(158899..159237)
FT                   /locus_tag="SARI_00169"
FT   CDS_pept        complement(158899..159237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00169"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4575 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20116"
FT                   /db_xref="GOA:A9MG08"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG08"
FT                   /inference="protein motif:HMMPfam:IPR010279"
FT                   /inference="similar to AA sequence:INSD:AAL21687.1"
FT                   /protein_id="ABX20116.1"
FT                   /translation="MEDHMLNKPNRNDVDDGVQDIQNDVNRLADSLEDVLKSWGSDAKD
FT                   EAETARRKAQALLKETRARMHGRTRVKQAACDAMGCADTFVREKPWCSVGTAAAVGIFI
FT                   GALLSLRR"
FT   gene            159387..159737
FT                   /locus_tag="SARI_00170"
FT   CDS_pept        159387..159737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00170"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09772 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20117"
FT                   /db_xref="InterPro:IPR018994"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG09"
FT                   /inference="similar to AA sequence:INSD:CAD05911.1"
FT                   /protein_id="ABX20117.1"
FT                   /translation="MYLRPDEVARVLEKAGFVVDVVTNKTYGYRRGENYVYVNREARMG
FT                   RTALIIHPRLKDRSSSLAEPASDIKTCAHYQNFPLYLGGGTHEHYGIPHGFSSRIALER
FT                   YLNGLFGDVTPD"
FT   gene            complement(159772..160143)
FT                   /locus_tag="SARI_00171"
FT   CDS_pept        complement(159772..160143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00171"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG11269 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20118"
FT                   /db_xref="GOA:A9MG10"
FT                   /db_xref="InterPro:IPR010574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MG10"
FT                   /inference="protein motif:HMMPfam:IPR010574"
FT                   /inference="similar to AA sequence:INSD:AAL21685.1"
FT                   /protein_id="ABX20118.1"
FT                   /translation="MLIEIFLSGMSVEQSLSSRLVAIPVNILIAWPYGVYRDLIMRVAR
FT                   KASPAGWAKNLADVLAYVTFQSPVYIIILLTVGADWHQIMAAVSSNIVVSMLMGAVYGY
FT                   FLDYCRRLFKVSNYHQAKA"
FT   gene            complement(160436..160633)
FT                   /locus_tag="SARI_00172"
FT   CDS_pept        complement(160436..160633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20119"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG11"
FT                   /protein_id="ABX20119.1"
FT                   /translation="MIHHNNRLNIQRSLTDFYAKKDAEFALIMLKKRQERFSTRLYAVT
FT                   DDIQNIAENLQKTIYYNTLI"
FT   gene            160909..161310
FT                   /locus_tag="SARI_00173"
FT   CDS_pept        160909..161310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00173"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2916 DNA-binding protein H-NS; Psort
FT                   location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20120"
FT                   /db_xref="GOA:A9MG12"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR027454"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG12"
FT                   /inference="protein motif:BlastProDom:IPR001801"
FT                   /inference="protein motif:HMMPfam:IPR001801"
FT                   /inference="protein motif:HMMSmart:IPR001801"
FT                   /inference="similar to AA sequence:INSD:AAO70263.1"
FT                   /protein_id="ABX20120.1"
FT                   /translation="MNLMLQKLNNIRTLRAMAREFSIDILEEMLEKFRVVTKERREEEE
FT                   LQQRQLAEKQEKINTFLELMKADGINPEELFAINSAMPRSAKKRQPRPAKYRFTDFNGE
FT                   EKTWTGQGRTPKPIAQALAAGKSLDDFLI"
FT   gene            complement(161414..161593)
FT                   /locus_tag="SARI_00174"
FT   CDS_pept        complement(161414..161593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00174"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG35541 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20121"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG13"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217718.1"
FT                   /protein_id="ABX20121.1"
FT                   /translation="MFTPGDFVQPRIGGPKLKVIEVNEDHIVAVRVDDEQGEKLTLKAA
FT                   DVTPYSEGGDFGLC"
FT   gene            complement(161672..162199)
FT                   /locus_tag="SARI_00175"
FT   CDS_pept        complement(161672..162199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A0333 7.1e-12 rhodanese-related
FT                   sulfurtransferase; COG: COG0607 Rhodanese-related
FT                   sulfurtransferase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20122"
FT                   /db_xref="GOA:A9MG14"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG14"
FT                   /inference="protein motif:HMMPfam:IPR001763"
FT                   /inference="protein motif:HMMSmart:IPR001763"
FT                   /inference="similar to AA sequence:INSD:CAD05907.1"
FT                   /protein_id="ABX20122.1"
FT                   /translation="MSIGIVSPREAQALIAQGAKLIDVRDADEYLREHIPHAQLAPLSQ
FT                   LEQGALPANLRAEQIIFHCQSGKRTSSNAAKLQAVAAPAQVSLLEGGIDGWKAAGLPVT
FT                   EDKSQPLPLMRQVQIAAGGLTLLGVILGYTIHGGFFLISGFVGAGLMLAGLTGFCGMAR
FT                   LLEKMPWNTRTH"
FT   gene            complement(162209..162508)
FT                   /locus_tag="SARI_00176"
FT   CDS_pept        complement(162209..162508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A2208 2.8e-06 rhodanese-like:
FT                   transcriptional regulator, ArsR family; COG: COG0640
FT                   Predicted transcriptional regulators; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00176"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20123"
FT                   /db_xref="GOA:A9MG15"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG15"
FT                   /inference="protein motif:FPrintScan:IPR001845"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR001845"
FT                   /inference="protein motif:HMMSmart:IPR001845"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217716.1"
FT                   /protein_id="ABX20123.1"
FT                   /translation="MTALKQLQASAEQAAALLKAMSHPKRLLILCMLCGSPKTSAGELA
FT                   RITGLSPSATSQHLARMREEGLIDSQRDAQRIHYFIKNEAVNMLIATLKNLYCP"
FT   gene            162697..162855
FT                   /locus_tag="SARI_00177"
FT   CDS_pept        162697..162855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00177"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0401 Uncharacterized homolog of Blt101"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20124"
FT                   /db_xref="GOA:A9MG16"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG16"
FT                   /inference="protein motif:HMMPanther:IPR000612"
FT                   /inference="protein motif:HMMPfam:IPR000612"
FT                   /inference="protein motif:ScanRegExp:IPR000612"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457194.1"
FT                   /protein_id="ABX20124.1"
FT                   /translation="MGFWRIVFTIILPPLGVFLGKGFGWAFILNILLTLLGYIPGLIHA
FT                   FWVQMRH"
FT   gene            162955..163404
FT                   /locus_tag="SARI_00178"
FT   CDS_pept        162955..163404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00178"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1652 Uncharacterized protein containing LysM
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20125"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG17"
FT                   /inference="protein motif:HMMPfam:IPR002482"
FT                   /inference="protein motif:HMMPfam:IPR007055"
FT                   /inference="protein motif:HMMSmart:IPR002482"
FT                   /inference="protein motif:HMMSmart:IPR014004"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217714.1"
FT                   /protein_id="ABX20125.1"
FT                   /translation="MGLFNFVKDAGEKLWDAVTANHDKDEQAKKVQEHLNKTGIPDADK
FT                   VNVQIADGKATVTGDGLSQEAKEKILVAVGNIAGISSVDDQVKTTTPAAESQFYTVKSG
FT                   DTLSAISKQVYGNANLYNKIFEANKPMLKSPEKIYPGQVLRIPEE"
FT   gene            complement(163411..164142)
FT                   /locus_tag="SARI_00179"
FT   CDS_pept        complement(163411..164142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_3400 4.1e-06 glutamyl-tRNA(Gln)
FT                   amidotransferase subunit A K01957; COG: COG1802
FT                   Transcriptional regulators; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20126"
FT                   /db_xref="GOA:A9MG18"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG18"
FT                   /inference="protein motif:Gene3D:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR011711"
FT                   /inference="protein motif:HMMSmart:IPR000524"
FT                   /inference="similar to AA sequence:INSD:AAX66632.1"
FT                   /protein_id="ABX20126.1"
FT                   /translation="MPGASRDASQEKKMTALSQPTAIDGYRWLKNDIIRGTYQPDEKLR
FT                   MSLLTSRYALGVGPLREALSQLVAERLVTVVNQKGYRVASMSEMELLDIFDARANMEAM
FT                   LVRLAIERGDDAWEAEILARAHMLSKLEASDASEHMLDEWDQRHQAFHSAIVAGCGSHY
FT                   LLQMRERLFDLAARYRFIWLRETVLSVEMLEDKHIQHHTLTEAILAREAARASELMRQH
FT                   LLTPIPIIRQAMTGKMKPGAA"
FT   gene            complement(164147..165487)
FT                   /locus_tag="SARI_00180"
FT   CDS_pept        complement(164147..165487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00180"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0120 1.3e-69 aroP; aromatic amino
FT                   acid transport protein AroP K03293; COG: COG1113
FT                   Gamma-aminobutyrate permease and related permeases; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20127"
FT                   /db_xref="GOA:A9MG19"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG19"
FT                   /inference="protein motif:HMMPanther:IPR002293"
FT                   /inference="protein motif:HMMPfam:IPR004841"
FT                   /inference="protein motif:HMMTigr:IPR011265"
FT                   /inference="protein motif:ScanRegExp:IPR004840"
FT                   /inference="similar to AA sequence:INSD:AAX66631.1"
FT                   /protein_id="ABX20127.1"
FT                   /translation="MLSIAGVIGASLFVGSSVAIAEAGPAVLLAYLFAGLLVVMIMRML
FT                   AEMAVATPDTGSFSTYADKAIGPWAGYTIGWLYWWFWVLVIPLEANIAAIILNSWISGI
FT                   PVWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIALGAAAISGFYPYAEV
FT                   SGISRLWAHGGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPDKHIVRATNSVI
FT                   WRISIFYLCSIFVVVALIPWNMPGLKSAGSYRSVLELLHIPHAKFIMDCVILLSVTSCL
FT                   NSALYTASRMLYSLSRRGDAPAVMGKTNRSKTPWVAVLLSTGAAFLTVIVNYYAPAKVF
FT                   KFLIDSSGAIALLVYLVIAVSQLRMRKILLAQGGEIKLKMWLYPWLTWLVIGFICFVLV
FT                   VMLFRPAQQLEVISTGLLGLGIICTVPIMSRWKKRIRWPKAPLQNLR"
FT   gene            complement(165677..166960)
FT                   /locus_tag="SARI_00181"
FT   CDS_pept        complement(165677..166960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2792 3.2e-222 gabT; 4-aminobutyrate
FT                   aminotransferase K00823:K07250; COG: COG0160
FT                   4-aminobutyrate aminotransferase and related
FT                   aminotransferases; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20128"
FT                   /db_xref="GOA:A9MG20"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG20"
FT                   /inference="protein motif:HMMPanther:IPR005814"
FT                   /inference="protein motif:HMMPfam:IPR005814"
FT                   /inference="protein motif:HMMTigr:IPR004632"
FT                   /inference="protein motif:ScanRegExp:IPR005814"
FT                   /inference="similar to AA sequence:INSD:AAL21677.1"
FT                   /protein_id="ABX20128.1"
FT                   /translation="MNTNKALMQRRHNAVPRGVGQIHPIFAERAENCRVWDVEGREYLD
FT                   FAGGIAVLNTGHLHPGIVSAVEAQLKKLSHTCFQVLAYEPYLALCERMNQKVPGDFAKK
FT                   TLLVTTGSEAVENAVKIARAATKRSGAIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMP
FT                   GHVYRALYPCPLHGISDDDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFM
FT                   QRLRALCDQHGIMLIADEVQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTG
FT                   RAEVMDAIAPGGLGGTYAGNPIACAAALAVLDIFEHENLLQKANTLGKTLRDGLMEIAE
FT                   THREIGDVRGLGAMIAIELFENGDPSKPNATLTADIVARARDKGLILLSCGPYYNILRI
FT                   LVPLTIDASQIRQGLEIIAQCFDEAKQA"
FT   gene            complement(166975..168423)
FT                   /locus_tag="SARI_00182"
FT   CDS_pept        complement(166975..168423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2791 9.0e-250 gabD;
FT                   succinate-semialdehyde dehydrogenase I K00135; COG: COG1012
FT                   NAD-dependent aldehyde dehydrogenases; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00182"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20129"
FT                   /db_xref="GOA:A9MG21"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG21"
FT                   /inference="protein motif:HMMPfam:IPR002086"
FT                   /inference="protein motif:HMMPIR:IPR012303"
FT                   /inference="protein motif:HMMTigr:IPR010102"
FT                   /inference="protein motif:ScanRegExp:IPR002086"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461717.1"
FT                   /protein_id="ABX20129.1"
FT                   /translation="MQLNDSTLFRQQAFIDGDWRDARGGDVITVSNPANGKPLGNVPKM
FT                   GAQETRDAIDAASRALPAWRALTAKERATILRRWFNLMMEHQDDLARLMTLEQGKPLAE
FT                   AKGEISYAASFIEWFAEEGKRIYGDTIPGHQADKRLLVIKQPIGVTAAITPWNFPSAMI
FT                   TRKAGPALAAGCTMVLKPASQTPFSALALAELAQRAGIPAGVFNVVTGSAGDIGGEMTS
FT                   NPLVRKLSFTGSTEIGRQLMEQCAKDIKKVSLELGGNAPFIVFDDADLDKAVEGALASK
FT                   FRNAGQTCVCANRLYVQDSVYDRFAEKLQQAVEKLRIGDGLQSDVAIGPLIDEKAVAKV
FT                   QEHIADALEKGARIITGGEAHKLGGNFFQPTILADVPDNAKVAKEETFGPLAPLFRFSD
FT                   ETEVIRQANDTEFGLAAYFYARDLSRVFRIGEALEYGIVGINTGIISNEVAPFGGIKAS
FT                   GLGREGSKYGIEDYLEIKYMCIGL"
FT   gene            complement(168445..169713)
FT                   /locus_tag="SARI_00183"
FT   CDS_pept        complement(168445..169713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3015 4.3e-195 ygaF; hypothetical
FT                   protein YgaF K00137; COG: COG0579 Predicted dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20130"
FT                   /db_xref="GOA:A9MG22"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR030862"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG22"
FT                   /inference="protein motif:HMMPfam:IPR006076"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457189.1"
FT                   /protein_id="ABX20130.1"
FT                   /translation="MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESAPACHQTGH
FT                   NSGVIHAGVYYTPGSLKARFCLAGNQATKTFCDQNNICYDTCGKMLVATSELEMTRMRA
FT                   LWERTAANGLEREWLSAAELREREPNIIGLGGIFVPSSGIVRYRDIATAMANRFQAKGG
FT                   EIIYHADVSALTEHAAGVIIRTSRGQEIETATLIGCAGLMADRLVKMLGVDPGFIICPF
FT                   RGEYFRLAPEHNRIVNHLIYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRK
FT                   RDISFADTLEILRSPGIRRVLQNHLLSGLNEMKNSLCKSGYLRRVQKYCPSLTANDLQP
FT                   WPAGVRAQAVSPDGKLIDDFLFVATPRSIHTCNAPSPAATSAIPIGAHIVSKVQALRES
FT                   QINPGRTLRAARSVDVLHAAFTR"
FT   gene            complement(169739..170725)
FT                   /locus_tag="SARI_00184"
FT   CDS_pept        complement(169739..170725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00184"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG05999 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20131"
FT                   /db_xref="GOA:A9MG23"
FT                   /db_xref="InterPro:IPR015038"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG23"
FT                   /inference="similar to AA sequence:INSD:AAL21674.1"
FT                   /protein_id="ABX20131.1"
FT                   /translation="MILMNALTAVKANTDDLAQRHAGFTLAPSAQSPRLLALTFTADTT
FT                   TQFLHQVAQWPVQALEYKSFLRFKIGKILDDLCGNQLQPLLIKTLLNRAEGALLINAEG
FT                   IDDVAQAEEMVKLATAVAHLIGRSNYDAMSGQYYARFVVKNVDNSDSYLRQPHRVMELH
FT                   NDGTYVEEATDYVLMMKIDEQHMEGGNSLLLHLDDWEHLESFFTHPLARRVMRWAAPPS
FT                   KNVSHDAWHPVFDVDQQGRPVMRYIDQFVQPKDFEEGVWLSELSDALETSKNILSVPVP
FT                   VGKFLLINNLFWLHGRDRFTPHPDLRRELMRQRGYFAYAASHYQTHQ"
FT   gene            complement(170742..170888)
FT                   /locus_tag="SARI_00185"
FT   CDS_pept        complement(170742..170888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20132"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG24"
FT                   /protein_id="ABX20132.1"
FT                   /translation="MLNHTFHNVKNLLFLITTIKQNRLFHTRSWKMSIFLIYGYEMSIA
FT                   MSP"
FT   gene            complement(170881..171066)
FT                   /locus_tag="SARI_00186"
FT   CDS_pept        complement(170881..171066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20133"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG25"
FT                   /protein_id="ABX20133.1"
FT                   /translation="MTPVNLRLKNVALVRPTRSYARPDKPRQHHLPLLSLSHQPYYHHN
FT                   QLILKFFIKMTGYFFA"
FT   gene            complement(171053..172567)
FT                   /locus_tag="SARI_00187"
FT   CDS_pept        complement(171053..172567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_3121 0.0014 nuoN; NADH-quinone
FT                   oxidoreductase, N subunit K00343; COG: COG3333
FT                   Uncharacterized protein conserved in bacteria; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00187"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20134"
FT                   /db_xref="GOA:A9MG26"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG26"
FT                   /inference="protein motif:HMMPfam:IPR002823"
FT                   /inference="similar to AA sequence:INSD:AAL21673.1"
FT                   /protein_id="ABX20134.1"
FT                   /translation="MDTWIYLSQGFAVAMTPENLVIALIGCFVGTIVGLLPGLGPINGV
FT                   AILLPLAFALHLPAESALILLATVYIGCEYGGRISSILLNVPGDAAAIMTALDGYPMAQ
FT                   QGKGGVALSISAVSSFFGSLIAIGGIILFAPALAQWSLAFGPAEYFALMVFAIACLGSM
FT                   MAQNPLKSFLAALIGLGLATVGVDANTGVYRFTFDSVHLSDGVQFIVVVIGLFSVSEIL
FT                   LMLEHTSSGQTLVRKTGRMLFNLKEGAQCIGTTLRSSVIGFFVGVLPGAGATIASAITY
FT                   MTEKKLSGNSDSFGKGDIRGVAAPEAANNASACGSFIPMLTLGVPGSGTTAVMMGALTL
FT                   YNITPGPAMFTEQPDIVWGLIAALLIANVMLLIMNIPLIGLFTRMLTIPLWFLVPAIAA
FT                   VSAVGVYAVHSTTFDLVLMVALGVLGYILRKMHFPMSPLILGFVLGEMLEQNLRRALSI
FT                   SNGNMAILWQSGVAKALLIMAIMVVVVPPVLRLIRKHSRKPQVDAG"
FT   gene            complement(172578..173012)
FT                   /locus_tag="SARI_00188"
FT   CDS_pept        complement(172578..173012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00188"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG11450 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00188"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20135"
FT                   /db_xref="GOA:A9MG27"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG27"
FT                   /inference="similar to AA sequence:INSD:AAL21672.1"
FT                   /protein_id="ABX20135.1"
FT                   /translation="MMSDRIFAGIWLLLCIAGLFIAWQIQSEYSYEPVGPRPFPLGILG
FT                   LMALCALALLLRHPDTVSWPRRLVLQKLVTMVIILLMYAWGFEWLGFPIATALLTMVIG
FT                   MLFGATTPAAGISGAVLGILLWYAFDRLLDVTLPLGAWLS"
FT   gene            complement(173024..174001)
FT                   /locus_tag="SARI_00189"
FT   CDS_pept        complement(173024..174001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00189"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3181 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20136"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG28"
FT                   /inference="protein motif:HMMPfam:IPR005064"
FT                   /inference="similar to AA sequence:INSD:AAL21671.1"
FT                   /protein_id="ABX20136.1"
FT                   /translation="MKKQLLRTLTASILLLSTSVLAQQAPSRTECIAPAKPGGGFDLTC
FT                   KLIQVSLLETGAIEKPMRVTYMPGGVGAVAYNAIVAQRPGEPGTVVAFSGGSLLNLSQG
FT                   KFGRYGVDDVRWLASVGTDYGMIAVRADSPWKTLKDLMTAMENDPNSVVIGAGASIGSQ
FT                   DWMKSALLAQKANVDPRKMRYVAFEGGGEPVTALMGNHVQVVSGDLSEMVPYLDGDKIR
FT                   VLAVFSENRLPGQLADVPTAKEQGYDLVWPIIRGFYVGPKVSDADYQWWVDTFKKLQQT
FT                   DEFKKQRDLRGLFAFDMTGQQLDDYVKKQVTDYREQAKAFGLAK"
FT   gene            174156..174830
FT                   /locus_tag="SARI_00190"
FT   CDS_pept        174156..174830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05622 6.2e-36 response regulator
FT                   (protein-glutamate methylesterase) K07669; COG: COG0745
FT                   Response regulators consisting of a CheY-like receiver
FT                   domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20137"
FT                   /db_xref="GOA:A9MG29"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG29"
FT                   /inference="protein motif:BlastProDom:IPR001789"
FT                   /inference="protein motif:BlastProDom:IPR001867"
FT                   /inference="protein motif:HMMPfam:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR001867"
FT                   /inference="protein motif:HMMSmart:IPR001789"
FT                   /inference="protein motif:ScanRegExp:IPR005829"
FT                   /inference="protein motif:superfamily:IPR011006"
FT                   /inference="similar to AA sequence:INSD:AAL21670.1"
FT                   /protein_id="ABX20137.1"
FT                   /translation="MRLLLAEDNRELAHWLEKALVQNGFAVDCVFDGLAADHLLHSETY
FT                   ALAVLDINMPGIDGLEVVQRLRKRGLTLPVLLLTARSAVADRVKGLNVGADDYLPKPFE
FT                   LEELDARLRALLRRSAGQVHEVQRLGELIFHDEGYFLLQEQPLALTPREQALLTVLMYR
FT                   RTRPVSRQQLFEQVFSLNDEVSPESIELYIHRLRKKLQGSDVRITTLRGLGYVLERGDE
FT                   VG"
FT   gene            174817..176232
FT                   /locus_tag="SARI_00191"
FT   CDS_pept        174817..176232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2784 1.7e-241 tctE; tricarboxylic
FT                   transport: regulatory protein K07649; COG: COG0642 Signal
FT                   transduction histidine kinase; Psort location:
FT                   CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20138"
FT                   /db_xref="GOA:A9MG30"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG30"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMPfam:IPR003661"
FT                   /inference="protein motif:HMMPfam:IPR013727"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR003660"
FT                   /inference="protein motif:HMMSmart:IPR003661"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="protein motif:superfamily:IPR009082"
FT                   /inference="similar to AA sequence:INSD:AAL21669.1"
FT                   /protein_id="ABX20138.1"
FT                   /translation="MKWVKPQSLYLQLLLFLGLPLILLWGLSTFNSYVNALQAATQAYD
FT                   RTLLSSARTVSERLVVRNSHLEVNVPWVVLDSFELNMNDRLYYKVVAPSGKVISGYADL
FT                   PAMPPATPRTRLYPALAWFYHTEYRGEAIRVARLLQPVNEGGIIGMAEIYVAETLQSRR
FT                   YLAGQLLFSSWISQGLLVLLTLVLVGWLLRRILRPMRQLSSLMVRREPGLLTPLPELLP
FT                   WSETRLLIVAFNRYIDRLRGILSRQERFSADASHQLKTPLAVLKTQAAVALASQQPRHW
FT                   YESLEAMSVTLDSTIQLTERLLQLSAVKHKEQGERRFSPVNLYDVVQNGCFTRLAQARS
FT                   KHTDLGYEGEQEAVWIDGDEVLLGELCGNLLDNALKYTPEQGIVTVRLERDGDVITLVV
FT                   EDSGPGIDDEHIHLALQPFHRLDNVGNVAGAGIGLALVNDIARLHRTHPHFSRSETLGG
FT                   LYVRIRFLSIVPQ"
FT   gene            176365..177378
FT                   /locus_tag="SARI_00192"
FT   CDS_pept        176365..177378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00192"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3376 High-affinity nickel permease; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20139"
FT                   /db_xref="GOA:A9MG31"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG31"
FT                   /inference="protein motif:HMMPfam:IPR011541"
FT                   /inference="protein motif:HMMTigr:IPR004688"
FT                   /inference="similar to AA sequence:INSD:AAL21668.1"
FT                   /protein_id="ABX20139.1"
FT                   /translation="MNNHTKRRGIALTAFLVSVNILAWIWAFFVFHHHAVMLSAALLAY
FT                   SFGLRHAVDADHIAAIDTVTRKLMQQGKTSLGVGAFFSLGHSTIVVVACLAIVVTSMAF
FT                   RDRIDILHQYGSLIGTAVSAFFLLAMALLNLFILFSVWRQFRSVTRGEPARAHDETLPG
FT                   GLMTRIFQRTFRLVTSSWHMYFVGFLFGLGFDTATEVGLLGISASAANQGLSLWSMMIF
FT                   PVLFTAGMALVDSLDNFVMVGAYGWAFSHPLRKLYYNMTITAASVFVALAIGGLEALGL
FT                   IDDALQLSGTFWQTVSTLNDHMGNVGFWVVAAFVLFWLLSLLNYRWRGYDKITLKT"
FT   gene            complement(178098..178994)
FT                   /locus_tag="SARI_00193"
FT   CDS_pept        complement(178098..178994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00193"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG11449 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20140"
FT                   /db_xref="InterPro:IPR009977"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG32"
FT                   /inference="protein motif:HMMPfam:IPR009977"
FT                   /inference="similar to AA sequence:INSD:AAO70247.1"
FT                   /protein_id="ABX20140.1"
FT                   /translation="MKIQEVKRILTRWELSSFSLYREAFTQYGGSINMHPDIVDYFMRR
FT                   HNWHFKFFHYKEDNAIKGAYFICNDQNIGILTRRTFPLSSDEILIPMAPELRCFLPDRT
FT                   NRLSVLHQPQILNAIWKITRKKQNCLVKETFSSKFEKRRRNEYQKFLRNGGSVRTVDEL
FT                   STEELAHTFITLFQSRFGDTLSGYPIENLIDFFTQLRHLLFGNILYIEGTPCAFDIVLK
FT                   SESRLNIYFDVPNSGVKSEYMKLSPGSILMWLNINRARHYCQERQKRLIFSLGILKPEW
FT                   EYKRLWSTPYFTGKSIC"
FT   gene            complement(179299..180234)
FT                   /locus_tag="SARI_00194"
FT   CDS_pept        complement(179299..180234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00194"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2990 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20141"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG33"
FT                   /inference="protein motif:HMMPfam:IPR007488"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217699.1"
FT                   /protein_id="ABX20141.1"
FT                   /translation="MTMHQSDMDMERYNPLLMLKEVMAQTPYRHKRWGERKFRYKFVLR
FT                   CLINPVTTIKYFNELCNLNQPRTLITHRPLLPAKIQRPYLYTGLSIRCRARAILEHYQF
FT                   VQSFAENKIKKILLSEEPTLLAHLEGKNGALVDIYCGPCGYDREGELTLTLCFNDTPLA
FT                   RLSFSFIHHEGKQIALVAGLQGPSKHVGPQVIRNATKDCYGLFPKRMLYEAFATFIQAC
FT                   NVAEIFAVSENNHVYRQLRYLFQKKKTFVASYSEFWESLNGVKEGALYHLPSQVMRKSP
FT                   ESIPSKKRAEYRNRYHILDKIVQQVKSLSH"
FT   gene            180310..180492
FT                   /locus_tag="SARI_00195"
FT   CDS_pept        180310..180492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20142"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG34"
FT                   /protein_id="ABX20142.1"
FT                   /translation="MPAETMLLNGLSMAAIKRIKHPFYRFSGKGGSHELSIKTNITFII
FT                   LSNVISRYIYFVGIM"
FT   gene            180671..181726
FT                   /locus_tag="SARI_00196"
FT   CDS_pept        180671..181726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr3268 4.1e-09 serine/threonine kinase
FT                   K08884; COG: COG1357 Uncharacterized low-complexity
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00196"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20143"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG35"
FT                   /inference="protein motif:HMMPfam:IPR001646"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217697.1"
FT                   /protein_id="ABX20143.1"
FT                   /translation="MERSPDSLAGMAASAFGTGTYAAMRQATSLQSFLEFIINFFTCGG
FT                   VQRRNKRQYQELIEAMAETLRNSMCDRRNAPLPENIILDSVGGFCVEFNLPGANNDTGN
FT                   VIVRVCKDGNTETREVPMETFEKVCRVLLFRCEYSLPQDSIILTAQGGMYLKDALLTGA
FT                   NLTAENLCGADLSGANLEGAVLFMADCEGANFKGANLSGASLGDSNFKNACLEDSIMCG
FT                   ATLDHANLTGANLQHASLLGCSMIDSNLCGANMERANVSGAILTGANMCDTILKGTNMM
FT                   ATNMEGAILTRANLQKANLTSANLEGADLSQADLKNTNIKDCTLTHSRTEETRMSASTQ
FT                   MLFNEFYSDDF"
FT   gene            complement(181698..181946)
FT                   /locus_tag="SARI_00197"
FT   CDS_pept        complement(181698..181946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20144"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG36"
FT                   /protein_id="ABX20144.1"
FT                   /translation="MKVLLKKIESHSDIWIVVYSCNNKRYCKLFTLSHYFSKESGLLLI
FT                   PLAHVFSDNTLFRYLFLRFLYVSLTLNRTKNHHYKIR"
FT   gene            182301..182456
FT                   /locus_tag="SARI_00198"
FT   CDS_pept        182301..182456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20145"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG37"
FT                   /protein_id="ABX20145.1"
FT                   /translation="MQYKGMLRNSRAIIIAAGPDIDRQFSVCKAPDEYHQAFCISAPGH
FT                   SWSYIE"
FT   gene            complement(182341..182478)
FT                   /locus_tag="SARI_00199"
FT   CDS_pept        complement(182341..182478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00199"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2801 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20146"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG38"
FT                   /protein_id="ABX20146.1"
FT                   /translation="MISDAIVVIRYMTMNGLELKYKTPDDIHQALYRQKTVCLYQDQPR
FT                   "
FT   gene            182900..185086
FT                   /locus_tag="SARI_00200"
FT   CDS_pept        182900..185086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3063 4.4e-06
FT                   phosphatidylglycerophosphatase K01094; COG: COG4771 Outer
FT                   membrane receptor for ferrienterochelin and colicins; Psort
FT                   location: OuterMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20147"
FT                   /db_xref="GOA:A9MG39"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG39"
FT                   /inference="protein motif:HMMPfam:IPR000531"
FT                   /inference="protein motif:HMMPfam:IPR012910"
FT                   /inference="protein motif:HMMTigr:IPR010105"
FT                   /inference="protein motif:ScanRegExp:IPR000568"
FT                   /protein_id="ABX20147.1"
FT                   /translation="MGMRVNKILWLITVVFSGVNSPLSAAEYSEGNGETMVVESTAEQV
FT                   LKQQPGVSIITRDDIQKNPPVNDLSDIIRKMPGVNLTGNSASGTRGNNRQIDIRGMGPE
FT                   NTLVLIDGVPVTSRNSVRYSWRGERDTRGDTNWVPPELVERIEVIRGPAAARYGSGAAG
FT                   GVVNIITKRPTNDWHGSLSLYTNQPENSKEGDTRRGNFSLSGPLAGDALTMRLYGNLNR
FT                   TDADSWDINSSAGTKNAAGREGVTNKDINSVFSWKMTSQQILDFEAGYSRQGNIYAGDT
FT                   QNSTSNAVTKSLAQSGRETNRLYRQNYGITHHGIWDWGQSRLGFYYEKTNNTRMNEGLS
FT                   GGGEGRITNDQTFTTNRLTSYRTSGEVNVPVIWLFEQTLTVGAEWNRDALEDPSSTGLT
FT                   VNDNNIAGISGSAAHRSSKNKSQISALYVEDNIEPMAGTNIIPGLRFDYLSESGSNFSP
FT                   SLNLSQELGEYVKMKAGIARAFKAPNLYQTSEGYLLYSKGNGCPKDLPSGRAGCYLVGN
FT                   KNLDPEISINKEIGLEFTVEDYHASVTYFRNDYQNKIVAGDKIIGKSSSGAYVLQWQNG
FT                   GKALVEGIEASMVVPLMPDRLNWNTNATYMITSEQKDTGNPLSIIPKYTVNTSLDWTIT
FT                   SALSAGVNWTLYGKQKPRTHAESRSEETKGLSGKALGAYSLVGTNVNYDINKNLRLNVG
FT                   ISNIFDKQIYRSAEGANTYNEPGRAYYAGVTASF"
FT   gene            complement(185128..186075)
FT                   /locus_tag="SARI_00201"
FT   CDS_pept        complement(185128..186075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_3479 6.3e-20 possible esterase;
FT                   COG: COG2819 Predicted hydrolase of the alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20148"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG40"
FT                   /inference="protein motif:HMMPfam:IPR000801"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217694.1"
FT                   /protein_id="ABX20148.1"
FT                   /translation="MYGREYRHKRYRITLFLASFCFPLVYSKLSYTKPDMQPLGPNIAD
FT                   KGSEYYNFRVNDFQSADSARHYRVWTAIPYKPAPPLGYPVLYMLDGNAVMDRLSEALLK
FT                   QLADHSPPVIVAIGYQTNLPFDLNGRAYDYTPVLGTGSEDNENNPRFHRKTGGGPAFRQ
FT                   LLETHIAPQVEQGIAINPERRGVWGHSYGGLFVLDSWLSSSFFYMYYSASPSLNRDNFA
FT                   LLKRIMAVTPPPFCHKKLIIMEGSASSGDSRQSQMAGLLQKVQKTVITLENNGVNAALQ
FT                   DYPGQGHGPMFNVSFRNALLDISREQAGQKSRCN"
FT   gene            complement(186109..187353)
FT                   /locus_tag="SARI_00203"
FT   CDS_pept        complement(186109..187353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_2470 2.0e-07 probable esterase
FT                   K07214; COG: COG2382 Enterochelin esterase and related
FT                   enzymes; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00203"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20150"
FT                   /db_xref="GOA:A9MG41"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR021764"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG41"
FT                   /inference="protein motif:HMMPfam:IPR000801"
FT                   /inference="similar to AA sequence:INSD:AAK33131.1"
FT                   /protein_id="ABX20150.1"
FT                   /translation="MRLSPPGDPVAMQTAARLRRQLAAGSQVDVFHFWQEANSLALPLV
FT                   TAIDGTDDEREVTFLWRAAYPLQGVYVRLNRVTDKDNVTKGMMTQLPTTDIWHLTLRLP
FT                   ASYYGSYTMTEIPQETPDETVLQLGSRFATLVGQADPLNRTPGINVRGNAQESILALDN
FT                   APAQEEWSGRRAYAGQLFTAEHRLAGQPRCVRLYLPEVPVIQPLGLLVLTDGETWFDHL
FT                   GVSAAIDAAINSGRIAPVAVLGIDNVDEHERVAILGGRRELVLDIAERLLPTIRAEHPE
FT                   RRWADRRQTVLAGQSLGGVTALMAARHVPESFGLVLSHSPSMWWTPDNRSRPDHFSGED
FT                   RSWISEHVLSAPSPAVRTHLCVGSLEGSTVPQVKQLHEKLRASGVESHCDVYTGGHDYA
FT                   WWRGALIDGLSLLPR"
FT   gene            187249..187458
FT                   /locus_tag="SARI_00202"
FT   CDS_pept        187249..187458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00202"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20149"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG42"
FT                   /protein_id="ABX20149.1"
FT                   /translation="MPEVENVNLASGGELAAKARGSLHRDGISGWAQSHYRYSISLIFW
FT                   SVSIAKRLLQEQPLAGFLLRKSCR"
FT   gene            complement(187462..191094)
FT                   /locus_tag="SARI_00204"
FT   CDS_pept        complement(187462..191094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1741 1.9e-201 putative ABC
FT                   transporter ATP-binding protein; COG: COG1132 ABC-type
FT                   multidrug transport system, ATPase and permease components;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20151"
FT                   /db_xref="GOA:A9MG43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG43"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR001140"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /protein_id="ABX20151.1"
FT                   /translation="MPARAWIVRLARVCWERKTLSTIVIVASVSTILLAALTPLITRQA
FT                   VNDAIAGDATRLPLLTCGLLLIALFDFIGNYVRRGYAGELSLWVQHTLRSRAFDSIQKL
FT                   DGAAQDALRTGQVISRTNSDLQQVHTLLQMCPVPLAVLTYYIAGIAVMLWMSPSMTLIV
FT                   VGVLAALAITALHARRRVFAQTGLASDRLAQITEHMREVLEQILVVKSCVAELRETRWL
FT                   DSQSRQMVRVRIGAAISQAMPGATMLALPVLGQIILLCYGGWSVMNGHIDLGTFVAFAS
FT                   FLAMLTGPTRVLASFLVIAQRTQASVERVFALIDTRSLMEDGTESVGGQIIGLDVEKMS
FT                   FHYGNDNRILNETSFSIHAGETVAVVGASGSGKSTLLMLLARFYDPTSGGVWLNTTRGQ
FT                   QNIRDLKLTALRRHVGVVFEDAFLFAGTVAENIAYGHPQATQDDIRRAADAAGASGFIN
FT                   ALPQGFNTRLTERGANLSGGQRQRIALARALITAPELLILDDTTSAVDAGTEAEINTAL
FT                   GRYADSEHMLLVIARRRSTLQLADRIVVLDKGRVVDIGTQAELDARCPTFRSLMRGDGD
FT                   FLALSPTEQHELWPTTQSAKSDDAHQCQTPAGKGFVDRMTRVPERAVQMALAGHGRQVS
FT                   SLLTPVAWMFVIAALLIALDSAAGVGVLVLLQRGIDSGVAVGNMSTIGISALLALCLVA
FT                   ISWCCYALQTIFAARAAESVQHTVRLRSFGHLLRLSLPWHEKNIDSRLTRMTVDVDSLA
FT                   RFLQNGLASAATSIVTMVAIAAAMFWLDPILALTALSAVPVVMLATWIYRRLSSPAYAQ
FT                   ARLEIGKVNSTLQEKVSGLRVVQSHGQQEQEAARLRALSNNFRTTRVRAQKYLAVYFPF
FT                   LTFCTEAAYAAVLLIGASQVAGGEMTPGVLAAFFLLQGQFYGPVQQLSGIVDSWQQATA
FT                   SGKHINALLATEETENIAPSSITPSTGALRLEALTFRYPEETQPALDNISLTIPQGTIV
FT                   AVVGRSGAGKSTLIKLLAGLYSPTSGRIRIGERVIDTASLTDYRRQTGLVSQDVALFSG
FT                   DIAENIRYSRPASSNTEVEIAARRAGLLETVQHLPQGFRTPVNNGGSDLSAGQRQLIAL
FT                   ARAQLAQAHILLLDEATARIDRSAEERLMTSLTRVTHTEKRIALIVAHRLTTARRCDVI
FT                   VVIDKGCIAEYGSHEQLIATHGLYARLWRDSVCQTRDTQEEVMG"
FT   gene            complement(191190..192296)
FT                   /locus_tag="SARI_00205"
FT   CDS_pept        complement(191190..192296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C1122 2.5e-174 iroB; putative
FT                   glucosyltransferase K00754; COG: COG1819 Glycosyl
FT                   transferases, related to UDP-glucuronosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20152"
FT                   /db_xref="InterPro:IPR010610"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG44"
FT                   /inference="protein motif:HMMPanther:IPR002213"
FT                   /inference="protein motif:HMMPfam:IPR010610"
FT                   /inference="similar to AA sequence:INSD:AAK33129.1"
FT                   /protein_id="ABX20152.1"
FT                   /translation="MRILFVGPPLYGLLYPVLSLAQAFRVNGHEVLIASGGKFAQKAAE
FT                   AGLVVFDAAPGFDSEAGYRRQEALRKENNIGTKMGNFSFFSEEMTDPLVAFAGQWRPDL
FT                   IVYPPLGVVGPLIAAKYGIPVVMQTVGFGHTPWHIKGVTKSLSNAYRRHGVSAPPRDLA
FT                   WIDVTPPSMSILQNDGEPVISMQYVPYNGGAVWEEWWERTPDRKRLLVSLGTVKPMVDG
FT                   LDLISWVMDSAGEVDAEIILHLPANARSDLRSLPPNVRLVDWLPMGVFLNGADGFIHHG
FT                   GAGNTLTALHAGIPQIVFGQGADRPVNARAVVERGCGIIPGKSGLTSSMINTFLGNSAL
FT                   REASLEVAAEMAAQPCPTEVAKKLIAML"
FT   gene            complement(192790..192954)
FT                   /locus_tag="SARI_00206"
FT   CDS_pept        complement(192790..192954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00206"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20153"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG45"
FT                   /protein_id="ABX20153.1"
FT                   /translation="MMPVTRYFCIFIKLGFQETINLVADTLQKSQNSDNIPDKALFVRN
FT                   IRIMMSKRV"
FT   gene            192982..193251
FT                   /locus_tag="SARI_00207"
FT   CDS_pept        192982..193251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00207"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1961 Site-specific recombinases, DNA
FT                   invertase Pin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20154"
FT                   /db_xref="GOA:A9MG46"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG46"
FT                   /inference="protein motif:HMMPfam:IPR006119"
FT                   /inference="similar to AA sequence:REFSEQ:YP_407274.1"
FT                   /protein_id="ABX20154.1"
FT                   /translation="MLIGYVSVSTNDQNTDLQRNTLNCAECELIFEDKISGTKPDRLGL
FT                   KKLFRTLSAGDTLVVWTLENWGAACGILSYWLKNCVSVVLIFAA"
FT   gene            193383..193526
FT                   /locus_tag="SARI_00208"
FT   CDS_pept        193383..193526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20155"
FT                   /db_xref="GOA:A9MG47"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG47"
FT                   /protein_id="ABX20155.1"
FT                   /translation="MKVIPKFLLFSAEKTASFLIQFTFFHIIKAKSVIFLFFFINIAKT
FT                   KK"
FT   gene            complement(193516..194115)
FT                   /locus_tag="SARI_00209"
FT   CDS_pept        complement(193516..194115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00209"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG26268 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00209"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20156"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="InterPro:IPR017483"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG48"
FT                   /inference="protein motif:HMMPfam:IPR010351"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01495963.1"
FT                   /protein_id="ABX20156.1"
FT                   /translation="MDDYSASDMRCSDRSESQLKAQFHLTDVSTRANPYTLTKVTSFNQ
FT                   PQPIFHGSRGEGEIIRQQCAAILFDELRALSGLFAMSGPYKPLIKQMIPHIQKANGAPF
FT                   RYMLLDRALKDHILSDSTPNSSRLRLAGLLKNILTRNISITRQRIKMNCENRFFEGNSP
FT                   LTDKGKINWRLKNIDVLKEKYDIPKPSSSGYFTVIF"
FT   gene            194213..194431
FT                   /locus_tag="SARI_00210"
FT   CDS_pept        194213..194431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00210"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG04673 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20157"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG49"
FT                   /inference="similar to AA sequence:REFSEQ:YP_540438.1"
FT                   /protein_id="ABX20157.1"
FT                   /translation="MCNQFNEITSMPARHVCQNFFRDALAPLHKYRQNALLDATIALIN
FT                   GASLTLTSIGRYLPGTAQVKNKIKRVD"
FT   gene            194492..195436
FT                   /locus_tag="SARI_00211"
FT   CDS_pept        194492..195436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00211"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG04673 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20158"
FT                   /db_xref="GOA:A9MG50"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG50"
FT                   /inference="protein motif:HMMPfam:IPR002559"
FT                   /inference="protein motif:superfamily:IPR012337"
FT                   /inference="similar to AA sequence:REFSEQ:YP_540438.1"
FT                   /protein_id="ABX20158.1"
FT                   /translation="MLTSQLSLCVIAVDWSGYPSQEHHVLRASLICDGRSIPLLRWIVP
FT                   SEKQQNAKVQQAFLNTLAEAVNPEARVIIVTDAGFQNAWFRHIESLGWDFIGRIRGNIQ
FT                   MRLEAKGEYWFRRQELQASSKPEYLGPGTLARSEYARCDGHFYLHKKEPKGRKNKRSRC
FT                   GIARPSQLKDASPAAKEPWLIFSSTDDFKPRVIMKLYSRRMQIEQHFRDEKSERFGFGL
FT                   RASYSRSAGRVLALSLLATLSTIVLWLVGYHAENKGLHLRYQANSVRTRRVITYLTLAE
FT                   NVLRQSPLILKRTVLRTVLNHLARTYQNMVLVY"
FT   gene            195665..197701
FT                   /locus_tag="SARI_00212"
FT   CDS_pept        195665..197701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00212"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ehi:68.t00029 3.5e-07 protein phosphatase with
FT                   leucine-rich repeats K01768; COG: COG4886 Leucine-rich
FT                   repeat (LRR) protein; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20159"
FT                   /db_xref="GOA:A9MG51"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR029487"
FT                   /db_xref="InterPro:IPR032674"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG51"
FT                   /inference="similar to AA sequence:INSD:AAD40326.1"
FT                   /protein_id="ABX20159.1"
FT                   /translation="MSSWEKCKEFFCSTHQTEALECIRTICHPPAGTTREDVVSRFEQL
FT                   RTLAYAGCEENIHSGLHGENHFCIMDEDNQEILSVTLDDAGNYTVNCQGYSETHHFTMA
FT                   TEPGVERTEHAEGASGTSCLPATTAPQTAAEYDAVWSAWQRAAPKGEARGRAAVVQEMR
FT                   DCLKNGNPVLNVGGAGLTTLPDHLPPHITKLIIPRNNYLTRLSRLPPGLRELSVDGNLL
FT                   ASLPALPPGLQSLSVPGNQLPSLPDLPSGLRKLWASGNRLTSLSALPSGLRELIISSNR
FT                   LTSLPALPSELRELSVSHNLLPSLPELPSGLQELSVSHNRLTRLPESIISLPSYARVNL
FT                   DGNPLSERTLRTLRNLTSAPGYSGPRIRFDMAGPSVPREARALHLAVADWLMPAREGEP
FT                   DPADRWHASGQEDNAAAFSLFLDRLSETENFEKDAGFKAQISSWLALLAEDDVLRAKTF
FT                   AMATEATSSCEDRVTFALHQMKNVQLVHNAEKGVYDNNLPGLVSTGREMFRMEMLERIA
FT                   LEKVRTLAFVDEIEVCLAYQNKLKESLELTSVTAEMRFFGASGVTTSDLRSAERQVKAA
FT                   ENSEFSEWLLQWGPLHSVLERKEPERFNALREKQISDYEHTYQMLSDTELKPSGLVGNT
FT                   DAERTIGVRAMESAKKEFLNGLRPLVEEMLGSYLKVKARRRLN"
FT   gene            198452..199297
FT                   /locus_tag="SARI_00213"
FT   CDS_pept        198452..199297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00213"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20160"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGP9"
FT                   /inference="similar to AA sequence:REFSEQ:NP_311541.1"
FT                   /protein_id="ABX20160.1"
FT                   /translation="MNNWSPEHTKDIKSWFKIDTYRKFEDLSLIQFYHEIWARNLFFKE
FT                   YREEFESRTLMGYFSKIFSGNPFLIEEGQLGYMTPANKLFQPPHFFLTTLDRLAETSII
FT                   AMQRGGFLWHEGDNYSINAELREESLSDIMPDQFTRTVMFEIDLASGTDEEIAESLKAA
FT                   LPQWRKVKGIDENPLESVRFGYGTIKKLISYRVIPMLDILVWAAVKKIRVSDDRLSRLL
FT                   YTDDDEESEMRQSSQIKDTDRPLALKSCTTDFIRQFHYFMNKNSHLKQMKVSDVMKLSD
FT                   "
FT   gene            199577..199783
FT                   /locus_tag="SARI_00214"
FT   CDS_pept        199577..199783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00214"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3311 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20161"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ0"
FT                   /inference="protein motif:HMMPfam:IPR010260"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001177620.1"
FT                   /protein_id="ABX20161.1"
FT                   /translation="MNNQATRLIRLPEVLERTGYGKAWIYRLISEGRFPAPVKIGVRAV
FT                   AFVESEVDEWIQSVIETSRIKVA"
FT   gene            199805..200119
FT                   /locus_tag="SARI_00215"
FT   CDS_pept        199805..200119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00215"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20162"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ1"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001005310.1"
FT                   /protein_id="ABX20162.1"
FT                   /translation="MNIEEFMSEENHMCNLGEDLFGKIFEPGAIYDLPDNEFNRKIVYW
FT                   LSQYLVGNLRDPLDAIFELNIFDQFYVYETWFSLIKCPVEMKSLSKRIIQYHIGLKTLL
FT                   "
FT   gene            200549..201604
FT                   /locus_tag="SARI_00216"
FT   CDS_pept        200549..201604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00216"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00216"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20163"
FT                   /db_xref="GOA:A9MGQ2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ2"
FT                   /inference="protein motif:Gene3D:IPR013762"
FT                   /inference="protein motif:HMMPfam:IPR002104"
FT                   /inference="protein motif:superfamily:IPR011010"
FT                   /inference="similar to AA sequence:INSD:ABP61567.1"
FT                   /protein_id="ABX20163.1"
FT                   /translation="MKVIAGSISLLYRFFMRKEINIDERIQKRIFLANHEIDDLIEFTS
FT                   FNFKNGGENDFGVSNVKKPTKYFRITTIANYLEWLCKILLSHTGQKDTIKEILVFINNI
FT                   KRKKPRNNDKYIMDIEKSLNKAQLDSLFSILSPGSNLNPFTETVQKRNNLIFLLLHCFG
FT                   MRAGELLNLRIGDIDFAESTIAIRRRANDKTDPRVYQPLVKTCERKLIADANLIYEISD
FT                   YILNDRRKVKNANKHDFLFITYKEGKTQGQPLSFSSYHKIVSVVRQSSSLLSGLTGHKL
FT                   RHTWNYEFSKAIDNSKNISDEKEQQIRSYLMGWVPGSDTSIIYNRRHIFELSKKTALEQ
FT                   QEQLFKGGFDE"
FT   gene            201597..202907
FT                   /locus_tag="SARI_00217"
FT   CDS_pept        201597..202907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00217"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0582 Integrase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00217"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20164"
FT                   /db_xref="GOA:A9MGQ3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ3"
FT                   /inference="protein motif:Gene3D:IPR013762"
FT                   /inference="protein motif:HMMPfam:IPR002104"
FT                   /inference="protein motif:superfamily:IPR011010"
FT                   /inference="similar to AA sequence:INSD:ABP61566.1"
FT                   /protein_id="ABX20164.1"
FT                   /translation="MNNLIKHSSDKMSIHEHKIVTSIESHGINIRDLICVMNKSLVCGF
FT                   VNTLQYYFCSKSHLYVKTIVKNMKNFINNVSPNYIDDKVIIQYQNMQSANKPSYFRGLR
FT                   PFFTKWFESGYPGIDASAIEIAKHFDLKIKKAGQPILQDDPTVGPLTKEEHTSLIKAMS
FT                   HAYSIGELSLSDYAISLLISLTGRRPQQLVMLEYKDLLQKNLDTGKVEYLISVPRVKQR
FT                   GKQLQYRELPIISEVASIVQLQANHSVRLVEQTLGKTLDDHDKGKVPVFLNEDKLLDLA
FT                   IIDFNFLESNKIYAKPTIANRALKNIVNTVNLISNRTGSLLNATPRRLRYTIATMLARE
FT                   GHNANTIAELLDHSSTSSTGIYIKNLAESVERIDSAVSEQLSFVADAFMNGIKSKEKIH
FT                   LKFCSSRKCQSQNLNVSFPCNECAFFMPVDIGEVNPR"
FT   gene            202904..204778
FT                   /locus_tag="SARI_00218"
FT   CDS_pept        202904..204778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00218"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4688 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20165"
FT                   /db_xref="GOA:A9MGQ4"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ4"
FT                   /inference="protein motif:Gene3D:IPR013762"
FT                   /inference="protein motif:superfamily:IPR011010"
FT                   /protein_id="ABX20165.1"
FT                   /translation="MNNIILFKSKKKLTVENNYNEFISFCRYKLSGLTQTQDWEQYVWK
FT                   GYVTFRKIGVRYKAFNSKDAMHEDFLDFAKAYIRYQHSLKPLKNYGATMMALRCLEQAL
FT                   LQVLNSGLIYNVTAVVFDEAIQIGSKYFEGNVLAKCGIQLEKLSKFLCEHNLVKSGYIS
FT                   WKNHVKQKVKKNYLPEIEDYDRNDKLPDEVALLAIADIFSKNDELLSPRDKFTSSVFAL
FT                   LLCCPSRISEILALPADCEITQKDEKGIERYGLRFYSVKGYGPNIKWIPQVMIPVAKKA
FT                   IKRLLSLSQNARAFAQWCEKYPDKFYQHELCPKVDEKSKLTVIEVCHALGYPLHDHKSC
FT                   VLKIKKTSLDGGKSFLNPNDYNYSLSELWEMIISGFSRDFPWYDEEKSIRFSNALCLLN
FT                   PRQFTLSQIIDIYSFHKPTKGFFFNDIQNKKRHEHGFKNIFARHGYYDIEGQPLLIRSH
FT                   QPRHLLNTIAHYGEMSELDIAKWSGRVNVNQNRVYNHVSEEDMLDKIKAIKLNRSNYCQ
FT                   RESIPTNELAIDFDSLNQGAIHLTEFGYCVHNYLVRPCTKINQFVECNNETLNMKSVDR
FT                   IRLQSVREKVIQLINITQIAFENGDYGADKWLQHHEKNLERINKLLNN"
FT   gene            204775..205179
FT                   /locus_tag="SARI_00219"
FT   CDS_pept        204775..205179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00219"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG17703 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20166"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ5"
FT                   /inference="similar to AA sequence:INSD:ABP61564.1"
FT                   /protein_id="ABX20166.1"
FT                   /translation="MKQEMHMAKHLNRSEIKAITHMILTWDGKITWSDLCESVYKNLNR
FT                   TITRQSLSAHDEVVEAYRTKKNLSNLKKSGLKKPANLTIAAQQILNLKAENEMLKKQNN
FT                   RYKEQFSYWQYNAYRHGLTMEQLNRPFNKK"
FT   gene            205267..205701
FT                   /locus_tag="SARI_00220"
FT   CDS_pept        205267..205701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20167"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ6"
FT                   /inference="similar to AA sequence:INSD:ABP61563.1"
FT                   /protein_id="ABX20167.1"
FT                   /translation="MHFMDKNIINSEFTLEEQLIIIIDKYISKRYQPGDKSFSYQLYLI
FT                   FVGYHLKYFYPKRIYSKSNRNIDNIMAMFSSVYKSLTSNLLQRLNNKEGVLRELNSLVN
FT                   YIDNNQEKAEEIYATVRAQYEMKVIEGELTHEVRVRTVRL"
FT   gene            complement(205755..206069)
FT                   /locus_tag="SARI_00221"
FT   CDS_pept        complement(205755..206069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20168"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ7"
FT                   /inference="similar to AA sequence:REFSEQ:YP_049171.1"
FT                   /protein_id="ABX20168.1"
FT                   /translation="MKIYSILTVILTTCLLTACNSEPSQDDIYNAFKIVVDRSNASMKA
FT                   LNSSIPEKDLLRIDYVKKVSCTEEANNVYNCIVDASISNMKQTKPVKLVKADGVWKEVQ
FT                   "
FT   gene            complement(206088..206474)
FT                   /locus_tag="SARI_00222"
FT   CDS_pept        complement(206088..206474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00222"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG23803 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20169"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ8"
FT                   /inference="protein motif:superfamily:IPR012338"
FT                   /inference="similar to AA sequence:REFSEQ:NP_311533.1"
FT                   /protein_id="ABX20169.1"
FT                   /translation="MNRFITSSFFIIVFLLSGCSTSGNQNLKNETPQSLQSKIIKNKTT
FT                   KSELLTKLGEPDTRTTLDDGNEQWKYFMSNNQFSATTFIPVVGLFTGGSQTQSKTLEID
FT                   FKGETVSKWTFSSDNNNTKTGILN"
FT   gene            206504..206602
FT                   /locus_tag="SARI_00223"
FT   CDS_pept        206504..206602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20170"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ9"
FT                   /protein_id="ABX20170.1"
FT                   /translation="MKLISPYKNNSVCIRSFDFIDKNNDAYEKRKD"
FT   gene            complement(206516..206788)
FT                   /locus_tag="SARI_00224"
FT   CDS_pept        complement(206516..206788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20171"
FT                   /db_xref="GOA:A9MGR0"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR0"
FT                   /protein_id="ABX20171.1"
FT                   /translation="MKNETIKCPFCFTQSPHGVRICIGCHAKVAYGESPLSVAFLFQFV
FT                   AFGLAWLAFLWTGSTLVSVLTFFISIIILIYKIKRTYADRVVFIR"
FT   gene            complement(207012..208169)
FT                   /locus_tag="SARI_00225"
FT   CDS_pept        complement(207012..208169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00225"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG10802 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20172"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR1"
FT                   /inference="protein motif:HMMPfam:IPR005094"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001177613.1"
FT                   /protein_id="ABX20172.1"
FT                   /translation="MQKIKRGKSFAGVVQYALKPGSHHKSNPIVIGGNMLGDSASEVIA
FT                   EFDGTKQLRPDVQKAVWHNSLRLPSGESLTAEQWSSIADDYMKRMGFSDTHLRCYVLHD
FT                   DQAGQHVHIIASRIDLNGGKLYLGKNENLISTRIISELETRYGLIETAQHKKPRQVKRR
FT                   KISRNEEMLSRRTGIPSPKEALQQILDKSLADTPDLLTFIKRLQEAEVSWKANIASTGK
FT                   MNGFSFEYTGIAFKASQLGKGYSWANLQKQLNYNPDHLEALQTGIQTKEALPAHIPMPV
FT                   PVPVPVPVEQVARDTVRSESIGEKIAEIEMRLREDKRNEIVGKILQKNAVQRQKHLRFV
FT                   EWLASIKHYIELLRSFGKTILHKTHTTFSNIYAMKPSKKARKIRL"
FT   gene            complement(208147..208398)
FT                   /locus_tag="SARI_00226"
FT   CDS_pept        complement(208147..208398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00226"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20173"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR2"
FT                   /inference="similar to AA sequence:REFSEQ:YP_049173.1"
FT                   /protein_id="ABX20173.1"
FT                   /translation="MASLHKLPTIVPPVNIDTWKTLGEINQKLNRIALHIDSKSKDSQL
FT                   THTELFVVKRQLEELRQQLLNADIWSKSYEGYAEDQKG"
FT   gene            complement(208585..208752)
FT                   /locus_tag="SARI_00227"
FT   CDS_pept        complement(208585..208752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20174"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR3"
FT                   /protein_id="ABX20174.1"
FT                   /translation="MTQLIKNSNINKNSLIRILIKFQFNYFVFFKASQPPLNTIMTLTL
FT                   KLNMLIKTII"
FT   gene            208828..211734
FT                   /locus_tag="SARI_00228"
FT   CDS_pept        208828..211734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00228"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nph:NP0492A 8.9e-35 mer3_1; ATP-dependent DNA
FT                   helicase 1 K03726; COG: COG1204 Superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20175"
FT                   /db_xref="GOA:A9MGR4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR4"
FT                   /inference="protein motif:HMMPfam:IPR001650"
FT                   /inference="protein motif:HMMPfam:IPR011545"
FT                   /inference="protein motif:HMMSmart:IPR001650"
FT                   /inference="protein motif:HMMSmart:IPR014001"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01462331.1"
FT                   /protein_id="ABX20175.1"
FT                   /translation="MKYGLPVNCGIDEDVSSPLFYKENDEFCLTDVQYESLDRGVGKGK
FT                   SVLVVSPTSTGKTLVGTVALTQGIQEGKNAVFLVTHRALARQKFEDFKKQLLKDFLDND
FT                   PSALVLATGDIIEDAFGNTVPSPLNAKLMVATYEKYLGILSASGVPKSMKSTVFVCDEI
FT                   QLIGDENRGQQVEILLTLIKRAGWAQLVGLSAVLEHRDALKLSQWLEIELIYTSTREKH
FT                   LTYQCHAHNGEVYSCSTKSPEEITSIKSKQPTSSIARTIKNYLEKNKELTPIIVFCMTK
FT                   KETYTLAQSLVSEYKSPFNTQMDFDFDGVPETLANNMLKEFVQYRVACHSADLIDEERE
FT                   IIERKILDKEIDVVFATSTLAAGVNFPLGTAFFASWQRWNSDLRKNIPIGSSEFHNMAG
FT                   RVGRMGSDHSEGNIIYFSNNNADLTSALKYLKFSDMPPLKSRIEPKGFNRLILQLVASG
FT                   LSNNIIDLKDIVFNTLSGIVEQDTNLKSFNTWDGCLDTSLDMLTAEGLLIKTAAGDLHA
FT                   TSFGKAVSLAGFNPESGVNLLKYFAKYSNWFSQCIFDIESNGNYKKLIISIFYACFSCP
FT                   EFISYQGKRPTRYLPYMFTRAVLLDPSKLDIPLYENIWQANLPSINAAKLAFEWIEGEQ
FT                   LRKLEDTFEALTAGMLNDLYRNLAWLLKGVSTIVMACADTRIASDLRPSFLNDEVVNDL
FT                   RLLPRFINRLAFRVNTGLTDKALWLTTLNKIYPERGFKLTRIEMLNISSSEYYKPEYLS
FT                   QGEQEAEEFRLELFKNIKPTPHKKSNWLRDAAKVWKINQRSLAAERHVLKSKKIGFEKQ
FT                   FKTYYDARGIEYEQAFEVLLSLAEINYIKLDDGKRTGAPDYLLSFTNSPDIVVELKTKL
FT                   GENLVDFNGATDVLRASELYGYGDNFCVTLCHPGVDPSVLPIIEKCGRLSIVEGHDLGE
FT                   ALLRLLSGNLTQEQLWQWLSIPGAASAEDLPMKEYSFN"
FT   gene            211866..212681
FT                   /locus_tag="SARI_00229"
FT   CDS_pept        211866..212681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20176"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR5"
FT                   /protein_id="ABX20176.1"
FT                   /translation="MLNITDRRIIYCLPSIFCQETIKLGNLLIRPLSEAVKDNDNCAKL
FT                   LMDFPFNRASSVIETLTFKSGDFFTQLNDLEIRDSLEILKFSYFFEFPSSLLDINGFVG
FT                   NETFECYPVIELNSELTCFGVEHKMPFTNGMSNYLLSLKSYFQYRTVFLENFSLRLTQK
FT                   DFSYYSVFYGLNKKIDTLDLFKMYNKCWGVYSAYDFSDKALYSKITLELLSSRHVANGN
FT                   KVGKTFTLFFEKLRRIIGSIADDELFHVYKEKIDSKIDIVTKRIEDYFF"
FT   gene            212683..213030
FT                   /locus_tag="SARI_00230"
FT   CDS_pept        212683..213030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20177"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR6"
FT                   /protein_id="ABX20177.1"
FT                   /translation="MNIERKNIAHEGKSSHQFINVAPYLVFFPVFLMVLECSDDIQRKD
FT                   IYRFIFLLSLFMYEVDSWQMIDFETFPSKRTHLQSYINFSRCYHKYVKDNKESAKYMLI
FT                   GFENWLKEIDG"
FT   gene            213073..214737
FT                   /locus_tag="SARI_00231"
FT   CDS_pept        213073..214737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN1704 1.3e-07 serine protease; COG:
FT                   COG1752 Predicted esterase of the alpha-beta hydrolase
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20178"
FT                   /db_xref="GOA:A9MGR7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR7"
FT                   /inference="protein motif:HMMPfam:IPR002641"
FT                   /inference="similar to AA sequence:INSD:EDK33637.1"
FT                   /protein_id="ABX20178.1"
FT                   /translation="MKNEKPTIECLAVFEGGGAKGIAFAGALEAAEEQGIKFSGYGGAS
FT                   SGAIIALLSCFGYKGSEIKSKLKRDKIINLLDKKFLILFYWVRFMSRINYFLSLTFLRK
FT                   KIPYANCCIGLLFFIPRVFSFVICYLNPISIFTCFFTLITIGVQKGIFKTDKLVETLRE
FT                   YAFDKVYLEVSNSEDRKEKIRSLTFLELEKITGVKLKVIATDILTGTAVELSSITTPDE
FT                   LVFESVAASSSYPIFFRPSIIKNQILTDGGISCNLPSFLFNPHEFNRLPVYAFDLRTRF
FT                   FMREDAGKIKISIFLKKLTMSMIDASNNIISDVTGGIIVPVIVSPRFGTFSFNLSDEQL
FT                   DKIFNQGKVSAKRFMKRDFFTSSMLPAKEYHMYASLIYGNVDYLLKLIQNEIEILIEGV
FT                   KLQINLYTDITTNQSRIVAFSHSNNFNCKAEYNSYDLVDSDAVCVNAWNNKQIFYSYDE
FT                   SNNRTKIFYPIERSNRFDANYNGLNNKMLALLELEFQAHYLDISFFEDNTIGGAKSIKE
FT                   VDFSEDSATIIDGYCFVIRNSMLGHQAIFHESKNTHH"
FT   gene            214753..214938
FT                   /locus_tag="SARI_00232"
FT   CDS_pept        214753..214938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00232"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20179"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR8"
FT                   /protein_id="ABX20179.1"
FT                   /translation="MKNNDKIVSGSQARDPSKMQFKSNYQNMYTDEGIIVLDAAKERIK
FT                   RRQKEINRSRQLADLD"
FT   gene            complement(215199..216470)
FT                   /locus_tag="SARI_00233"
FT   CDS_pept        complement(215199..216470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00233"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20180"
FT                   /db_xref="GOA:A9MGR9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR9"
FT                   /inference="protein motif:Gene3D:IPR013762"
FT                   /inference="protein motif:HMMPfam:IPR002104"
FT                   /inference="protein motif:superfamily:IPR010998"
FT                   /inference="protein motif:superfamily:IPR011010"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001005326.1"
FT                   /protein_id="ABX20180.1"
FT                   /translation="MGPTKKGPKTEGPKMAKIAKKLTDTEIKSTKPADKEINLFDGDGL
FT                   ILRIAPLSKGGKKNWYFRYAVPVSKKRTKMSLGTYPHLTLARARALRDEYLSLLANGID
FT                   PQVHNNDKANALKNATEHTLQTVARKWLDEKVKTSGISQDHAEDIWRSLERNIFPGLGN
FT                   VPVNEIRPKLLKQHLDPIEQRGVLETLRRIISRLNEIFRYAATEELIEFNPADNLGQRF
FT                   SKPKKQNMPALPPSELPRFLVALNNASIRLETRLLIEWQLLTWVRPGEAVCTRWTDIDT
FT                   DNSMWNIPAEFMKMKKPHKVPLSKEALRVLNSMKAISGHREWVFPSIKAPLNHMHEQTA
FT                   NAAIIRMGFGGELVAHGMRSIARTAAEESGKFRTEVLEAALAHSKKDEIIAAYNRAEYL
FT                   TERVALMQWWSDYVQTQKVKAIAA"
FT   gene            complement(216595..216957)
FT                   /locus_tag="SARI_00234"
FT   tmRNA           complement(216595..216957)
FT                   /locus_tag="SARI_00234"
FT                   /note="Rfam score 245.08"
FT                   /inference="nucleotide motif:Rfam:RF00023"
FT   gene            complement(217029..218219)
FT                   /locus_tag="SARI_00235"
FT   CDS_pept        complement(217029..218219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00235"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0845 Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20181"
FT                   /db_xref="GOA:A9MGS0"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGS0"
FT                   /inference="protein motif:HMMPfam:IPR006143"
FT                   /inference="protein motif:HMMTigr:IPR010129"
FT                   /inference="protein motif:ScanRegExp:IPR006144"
FT                   /inference="protein motif:superfamily:IPR011053"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217682.1"
FT                   /protein_id="ABX20181.1"
FT                   /translation="MKTSQHDAAMDDPDIHREREFSGAGRIVLICSLLFLILGVWAWFG
FT                   RLDEVSTGNGKVIPSSREQVLQSLDGGILAQLTVREGDRVQANQIVARLDPTRLASNVG
FT                   ESAAKYRASLASSARLTAEVSDLPLAFPDELNDWPDLIDAETRLYKSRRAQLADTEVEL
FT                   RDALASVNKELAITQRLEKSGAASHVEVLRLQRQKSDLGLKITDLRSQYYVQAREALSK
FT                   ANAEVDMLSAILKGREDSVTRLTVRSPVRGIVKNIQVTTIGGVIPPNGEMMEIVPVDDR
FT                   LLIETRLSPRDIAFIHPGQRALVKITAYDYAIYGGLEGVVETISPDTIQDKVKPEIFYY
FT                   RVFIRTHQDYLQNKSGRRFSIVPGMIATVDIKTGEKIIVDYLIKPFNRAKEALRER"
FT   gene            complement(218200..220380)
FT                   /locus_tag="SARI_00236"
FT   CDS_pept        complement(218200..220380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0144 1.1e-95 type I toxin efflux
FT                   ATP-binding protein; COG: COG2274 ABC-type
FT                   bacteriocin/lantibiotic exporters, contain an N-terminal
FT                   double-glycine peptidase domain; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00236"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20182"
FT                   /db_xref="GOA:A9MGS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGS1"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR001140"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /protein_id="ABX20182.1"
FT                   /translation="MTRAAPDVEEILSERDLSQWAQAISHVAGHYRVACSPGSIQANAP
FT                   WFRGKSRTTALTHLSRQAGLSFHAPGIDKAAFSQWRLPLVVELRDGQLLVIEHANGEDA
FT                   VDVFMIEEEGQRNRLTFSELLPQIIYVAALRPLSALKDSRVDRYISRFKPDWMRELVLQ
FT                   DIRPYLPVMVAAFLINVLSLAGIVFSMQVYDRVIPAQSYPTLYVLSFGVLVAVLFGFLL
FT                   REARTHIMDVLGKRADMRISDRVFGHALRLRNSAIPRSTGSFISQLRELEQIREMITSS
FT                   TLATIVDLPFFFLFMIVLAVIAPPLAWIAPVSALLMILPGVALQKKLAVLANQAAHEAT
FT                   LRNAVLVESVQGLEDIKLMQAENRFLQQWNSYIRITGESGLRTRKLTQGLISWGMSVQS
FT                   LVYAAVIMFGAPMVIEGSMTTGAVVAASMLGSRMIAPMANLCGVLARWQQVKAAKMGLD
FT                   NIMQLPTETQHDDSLVRRDILHGHYLFENAQFRYHNDDQRIPLRLVRLEIMPGERIAIL
FT                   GRNGAGKSTLLQAMAGGLEMIQGDARLDNLSLSHIDMADLRRNIGFLSQNARLFFGTLR
FT                   ENLTLGAPHASDEQIFDALEVSGGAVFVRRLAKGLDHPIMEGGNGLSGGQRQSLLLARM
FT                   LLRSPNIVLLDEPSASLDEHTEREFIQRLHQWLGNRTLVVATHRVPVLELVERVVVLKE
FT                   GQLVMDAPKAQALNADRIQSHRREWKNENQSA"
FT   gene            complement(220377..221786)
FT                   /locus_tag="SARI_00237"
FT   CDS_pept        complement(220377..221786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00237"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1538 Outer membrane protein; Psort location:
FT                   OuterMembrane, score:9.93"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20183"
FT                   /db_xref="GOA:A9MGS2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGS2"
FT                   /inference="protein motif:HMMPfam:IPR003423"
FT                   /inference="protein motif:HMMTigr:IPR010130"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461619.1"
FT                   /protein_id="ABX20183.1"
FT                   /translation="MGRVTPAAIVLAFALFHHQTRGAEAPPIITSEGLATDQMLPSLDG
FT                   SAAELPLSAAAPGNLTLNDAVNRAVNWHPSIREAVGKLLAQNEQIEVARSKYYPQVSAG
FT                   VNNGYSNTYTDHGYSPSLVLSVSQMLYDFGKVASQVRAETAGAAQQQANVLLSIDTVAH
FT                   ETANAIVQTQSWQQMVEAAEEQLVALDGIGKLTRQRSDEGATSLSDVVQTEARIESARS
FT                   QLAQYQANLDSARASLMSWLGWKSLNSISNDFPAKLARSCEIVTPDDRLVPAVLAAWAQ
FT                   ANVARANLEYANAQMTPTISLEPSVQHYLNDKYPSHEVLDKTQYSTWVKVEMPIYQGGG
FT                   LTARRNAASHAVDAAQSTIQRTRLDVRRRLMEARSQAMSLASALQILRRQQQLSERTRE
FT                   LYQQQYLDLGSRPLLDVLNAEQEVYQARFAELQTESQLHQLQLNCLYNTGALRQAFALN
FT                   HRSIQSVEIQP"
FT   gene            complement(221852..233353)
FT                   /locus_tag="SARI_00238"
FT   CDS_pept        complement(221852..233353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_1906 3.9e-51 CHU large protein,
FT                   possible SAP or adhesin AidA-related K01238; COG: COG5295
FT                   Autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20184"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGS3"
FT                   /inference="protein motif:superfamily:IPR008957"
FT                   /inference="protein motif:superfamily:IPR008964"
FT                   /inference="protein motif:superfamily:IPR008979"
FT                   /inference="protein motif:superfamily:IPR011048"
FT                   /inference="protein motif:superfamily:IPR011049"
FT                   /protein_id="ABX20184.1"
FT                   /translation="MRLLAVVSKLTGVSTTVESSAVTLNAPSIVKLSVARDEISQLTRI
FT                   NQDLMVTLHSGETITIKNFYVTNDLGASQLVLAESDGTLWWVENPQAGLHFEQIADINE
FT                   LLVTSGASHETGGAVWPWVLAGAVAAGGIAAIASSGGGDSHHSDSDNPLPDNTNPGGNP
FT                   PDNTNPDGNPPDNDNPGGTNPDGNNPDSSNPVDTTPPLAPSELLISADGKTVSGQAEAG
FT                   STITIKDPSGNVVGEGKTDSNGKFSIDLTTPHLSGEQLTVTATDDAGNTGPSATIDAPN
FT                   IPFPDTPIITAAIDNADPLTGTLSNNQFTNDSTPTLEGTGSAGAVIHIYANGQEIGTTT
FT                   VDASGNWRFSITNALTDGENRFTAIATNVKGESSESASFTLTIDTLSPDAPIVELITDN
FT                   TGLLTGPLQNNDRTDEAKPLFSGQGEPGNTITIKEGSTIIGSATVDENGRWTFMPTTPL
FT                   SNGEHTFTVEQSDQAGNVSRVTTTPTIIVDTTPPDAAAIDNVAKDGSTVSGTAEAGSTV
FT                   SIYDPAGNYLGSAITGDNNQFNITLNPAQTHGERLEARIQDAVGNIGPVTEFTASDSQY
FT                   PAQPIILTVTDDAGAVTGLLKNGDATDDNRPTLSGTAEPGSTISISDNGFPVPTFPLVV
FT                   ADADGKWSFTPSLALPDGDHVFTATATNDRGTSGQSVSFTIDIDTQPPVLENLAVSDIG
FT                   DKLTGATEAGSTVVIKDSQGNMLGSGTAGDDGTFSISISPAKINGETLSISVIDKAANS
FT                   GPVETLNAPDKTAPAAPNGLIVATDGLSVSGQAEAGSTVTIRDSSNTVLGSAVANGNGQ
FT                   FIVPLNTAQTNGQALIATATDVAKNESAAATVIAPDSTAPEMPKDVVISEDGASISGTA
FT                   EPGSAITITTSDGTPLGSGKVDGEGHFTLPLVPAQTNGEQVTVTATDGANNVSPPATAQ
FT                   APDITAPDKPIISQVLDDVESFTGPLANGQTTNDSRPTLSGTAEAGARVEVFDNGVSLG
FT                   LATLQSNGSWTFTPLQNLSEGAHRLTVIATDAKGNASPAASFDLVVDTQSPQQPVITFI
FT                   TDDAPGMLGSIAHLGLTNDNTPTINGTGEPGSTVHLYQNGARIADIIVGSSGVWSYAYT
FT                   TASPLVDDTYTFTVTASDSNGNTTPFSTDFTITIDTLVPAAPGIISVADGDGNTIDTNQ
FT                   LTQESQPRLSGSGTAGDTIILYDNGNIIGQALVGADGRWQFTPPAALGDGTHLLTARAN
FT                   DPAGNESPESISFTLRVDTQAPDAPQIVSAAIAGGEGEVLLANGSITNQRMPTLSGTGE
FT                   PGAIITLYNNGAVLDTVQVNPQGSWTYPLTSNLSEGLNVLTAIAMDAAGNSSPTSGVFS
FT                   VTLDTLPPAQPDAPLISDNVAPVIGNIGNNGATNDTTPTFSGTGEIGSTIILYNNGSEI
FT                   GRTTVGDNGSWNFTPAALTPGTYIITVTETDVAGNISPPSASVTFAIDITAPANPVITF
FT                   AEDNVGDVQDNVASGATTDDNTPVIHGTGDIGSVITLYNGGNVLGVATVDETGTWTLPV
FT                   TSALPDGTYTLTAIAADAAGNSSGVSNSFTLTVDTVPLQPPVVSEILDDVAPVTGPLTD
FT                   GAFTNDRTLTINGSGENGSTVTIYDNGIEIGTALVSDGTWTFNTPVLSEASHALTFSAT
FT                   DGAGNTTAQTQPIIITIDVTAPPAPSIQTVADDGTRVAGLADPYATVEIRNADDILVGS
FT                   AVANATGEFAVTLSPAQTDGGTLTAIALDRAGNNGPATDFLASDSGLPAVPVITAIEDN
FT                   VGSVQGNIAAGGATDDATPTLRGTTDIGSTVEVFIDGDSAGFATVDASGNWIFEIATPL
FT                   SESAHSVTVQATNAKGQGGLSEPVRITIDLSAPAQPIITSATDDVPGVTGTLDNGALTN
FT                   DSRPTLNGTGEAGATIRILDNGVEIGSATVDQSGNWRFTPNAPLESNTHLFTAVATDPA
FT                   GNSGQPSDGFTLTIDALAPDVPVIISVIDDNNQPSIPVSPGQSTDDRQPILNGTGEPGA
FT                   TITIFDNGTPLGTTQVNESGSWSFPVTSNLSEGSHDLTVSATDPAGNTSAVSTPWTIVV
FT                   DITPPAIPVLTSVVDDRPGITGDLVSGQLTNDATPTLNGRGEAGATITVYLDGNPTPIG
FT                   TTTVNSDGTWSFTPQTPIANGNHTLTLSATDPAGNSSAVSSGFVLTIDATPPAAPVIAS
FT                   VADNTAPVTGIVPNGGSTNETRPTLAGTGEAGSTISIYNGSALVGTAQVQANGSWSFTP
FT                   PTSLSAGVWNLTATATDAAGNTSVASETRTFTIDTTAPAAPVISTVYDGTGPITGNLSP
FT                   GQMTDEVRPVISGTREANTTIRLYDNGTLLAEIPADNSSSWRYTPDASLATGNHVITVI
FT                   AVDAAGNASPVSDSVNFVVDTTPPLAPVITSVSDDQAPGLGTIANGQSTNDPTPTFSGT
FT                   AEAGATITLYENGTVIGTTTAQPDGAWSVSTSTLASGTHVITAVATDAAGNGSPNSTAF
FT                   TLTVDTTAPQTPILTSVVDDVAGGATGNLANGQITNDNRPTLNGTAEAGSVVSIYDGGT
FT                   LLGVTTADAGGAWSFAPTTGLSDGTRTLTVTATDPAGNVSPVTDSFTIVVDTLAPTVPL
FT                   ITSIVDDVPNNTGAIGNGQSTNDTLPTLNGTAEANSTVSIFDNGALVATVTANANGNWS
FT                   WTPTTALGQGSHAYSVSAADAAGNVSAASQPTTIIVDTIAPGAPGNLTINATGNRVTGT
FT                   AEAGSTVTITTDTGVVLGTATADGTGSFSAALTPAQTNGQPLLAFAQDKAGNTGITAGF
FT                   TAPDTRVPEAPIITTVVDDVGIYTGAIANGQVTNDAQPTLNGTAQAGATVSIYNNGALL
FT                   GTTTANASGNWSFTPAGNLTEGSHAFTATATNANGTGSVSTAATVIVDTQAPGTPSGTL
FT                   SADGGSLSGLAEANSTVTVTLAGGITLTTTAGSNGAWSLTLPTKQIEGQLINVTATDAA
FT                   GNASGTLGITAPILPLAARDNITSLDLTSTADTSTQNYSDYGLLLVGALGNVASVLGND
FT                   IAQVEFTIAEGGTGDVTIDAAATGIVLSLLSTQEIVVQRYDTSLGAWTTIVNTAVGDFA
FT                   NLLTLTGSGVTLNLSGLGEGQYRVLTYNTSLLATGSYTSLDVDVHQTSAGIISGPTMST
FT                   GNVMADDTAPTGTTVTAITNANGVSTPVGAGGVDIQGQYGTLHINQDGSYTYTLTNPTA
FT                   GYGHKESFTYTITQNGVGSSSAQLVINLGPAPVPGSVVATDNNASLVFDTHVSYVNNGP
FT                   STQSGVTVLSVGLGNVLNANLLDDMTNPIIFNVEEGATRTMTLQGTVGGVSLASSFDLY
FT                   VYRFNDAIQQYEQFRVQKGWINTLLLAGQSQPLTLTLPGGEYLFVLNTASGISVLTGYT
FT                   LTISQDHTYAVDSITTSTTGNVLTNDVAPADALLTEVNGVAISATGTTNVNGLYGTLTI
FT                   DAKGNYTYTLKNGVGADSIKTPDSFIYTVKAPNGDTDTASLNITPTARALDAINDVSDT
FT                   LSVATLQDTAAWLDSSVGSASWGLLGKSGSGSGTFDVATGTVLKGASLVFDVSTLITLG
FT                   NLNISWAILENGTVIRNGTVPVANITLGGATVTVNLSGLELDAGTYTLNFTGTNTLAGA
FT                   ATITPRVIGTTVDLDNFETSGTHTVLGNIFDGSDAAGAMDQLNTVNTRLNISGYNGSAS
FT                   TLDASTNTTSATIQGHYGTLQINLDGAYTYTLNNGIAISSITSKEVFTYQLDDKMGHTD
FT                   SATLTIDMVPQIVSTNQNDVLIGSAYGDTLIYHLLNGADATGGNGTDRWQNFSTAQGDK
FT                   IDIHELLTGWDHQAATLGNFVQVHTSGANTVISVDRDGAGSAFKSTDLVTLENVQLTLN
FT                   DLLQNNHLVIGG"
FT   gene            233648..233782
FT                   /locus_tag="SARI_00239"
FT   CDS_pept        233648..233782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20185"
FT                   /db_xref="GOA:A9MGS4"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGS4"
FT                   /protein_id="ABX20185.1"
FT                   /translation="MGWQTIKDGFLFIFMFYRIFLIFIFCFFNIITPPFVKVFSNIKF"
FT   gene            complement(233968..234495)
FT                   /locus_tag="SARI_00240"
FT   CDS_pept        complement(233968..234495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00240"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0691 tmRNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20186"
FT                   /db_xref="GOA:A9MGS5"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGS5"
FT                   /inference="protein motif:BlastProDom:IPR000037"
FT                   /inference="protein motif:HMMPfam:IPR000037"
FT                   /inference="protein motif:HMMTigr:IPR000037"
FT                   /inference="protein motif:ScanRegExp:IPR000037"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217675.1"
FT                   /protein_id="ABX20186.1"
FT                   /translation="MGCFRYQITYEFTTLMTKKKAHKPGSATIALNKRARHEYFIEEEF
FT                   EAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRK
FT                   LLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQ
FT                   LDKARIMKHAGR"
FT   gene            234620..235075
FT                   /locus_tag="SARI_00241"
FT   CDS_pept        234620..235075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_1222 0.00068 actinorhodin polyketide
FT                   synthase bifunctional cyclase/dehydratase K05554; COG:
FT                   COG2867 Oligoketide cyclase/lipid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20187"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGS6"
FT                   /inference="protein motif:HMMPfam:IPR005031"
FT                   /inference="protein motif:ScanRegExp:IPR004827"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457156.1"
FT                   /protein_id="ABX20187.1"
FT                   /translation="MLMGIAMPQISRTALVPYSAEQMYQLVNDVQSYPQFLPGCVGSRV
FT                   LESSPAQMTAAVDVSKAGISKTFTTRNQLTRNQSILMHLVDGPFKKLIGGWKFTPLSPE
FT                   ACRIEFQLDFEFTNKLIELAFGRVFKELASNMVQAFTVRAKEVYRAG"
FT   gene            235080..235355
FT                   /locus_tag="SARI_00242"
FT   CDS_pept        235080..235355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00242"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2914 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00242"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20188"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGS7"
FT                   /inference="protein motif:HMMPfam:IPR005346"
FT                   /inference="similar to AA sequence:INSD:CAD05864.1"
FT                   /protein_id="ABX20188.1"
FT                   /translation="MVEVAYALPKKQYLLRVTLEQGATVEEAIRASGLLELRTDIDLAK
FT                   NKVGVYSRPVKLTDTVQDGDRVEIYRPLIADPKALRRQRAEKSAGR"
FT   gene            complement(235515..235853)
FT                   /locus_tag="SARI_00243"
FT   CDS_pept        complement(235515..235853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00243"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2913 Small protein A (tmRNA-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20189"
FT                   /db_xref="GOA:A9MGS8"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGS8"
FT                   /inference="protein motif:HMMPfam:IPR007450"
FT                   /inference="protein motif:ScanRegExp:IPR002048"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217672.1"
FT                   /protein_id="ABX20189.1"
FT                   /translation="MRCKTLTAAAAVLLMLTAGCSTLERVVYRPDINQGNYLTPTDVAK
FT                   VRVGMTQQQVAYALGTPMMTDPFGTNTWFYVFRQQPGHENVTQQTLTLTFNSSGVLTHI
FT                   DNKPALTK"
FT   gene            complement(236003..237664)
FT                   /locus_tag="SARI_00244"
FT   CDS_pept        complement(236003..237664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00244"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yps:YPTB0915 3.2e-06 sbcC; putative
FT                   ATP-dependent dsDNA exonuclease K03546; COG: COG0497 ATPase
FT                   involved in DNA repair; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20190"
FT                   /db_xref="GOA:A9MGS9"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGS9"
FT                   /inference="protein motif:HMMPfam:IPR003395"
FT                   /inference="protein motif:HMMTigr:IPR004604"
FT                   /inference="similar to AA sequence:INSD:AAO70209.1"
FT                   /protein_id="ABX20190.1"
FT                   /translation="MLAQLTISNFAIVRELEIDFQSGMTVITGETGAGKSIAIDALGLC
FT                   LGGRAEADMVRTGATRADLCARFSLKDTPAALRWLEENQLEEGRECLLRRVISSDGRSR
FT                   GFINGTAVPLSQLRELGQLLIQIHGQHAHQQLTKPEQQKSLLDSYANESALAQLMAAHY
FT                   QLWHQSCRDLAHHQQQSQERAARAELLQYQLKELNDFNPQAGEFEQIDEEYKRLANSGQ
FT                   LLTTSQNALALLADGEDVNLQSQLYSAKQLVSELVGMDSKLSGILDMLEEATIQLTEAS
FT                   DELRHYCERLDLDPNRLFELEQRIAKQISLARKHHVSPEALPQLHQSLLEEQQQLDDQA
FT                   DSLETLTLAVNKHRQQALETAQALHQQRLFYAQELGQLITESMHQLSMPHGLFTIDVKF
FT                   DEHHLSSDGADRVEFKVTTNPGQPLQPIVKVASGGELSRIALAIQVITARKMETPALIF
FT                   DEVDVGISGPTAAVVGKLLRQLGESTQVMCVTHLPQVAGCGHQHFFVSKETDGAMTETH
FT                   MQPLDKRARLQELARLLGGSEVTRNTLANAKELLAA"
FT   unsure          236847..236995
FT                   /note="Sequence derived from one plasmid subclone"
FT   unsure          237156..237258
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            complement(237750..238556)
FT                   /locus_tag="SARI_00245"
FT   CDS_pept        complement(237750..238556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA2542 1.9e-137 yfjB; Probable inorganic
FT                   polyphosphate/ATP-NAD kinase K00858; COG: COG0061 Predicted
FT                   sugar kinase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20191"
FT                   /db_xref="GOA:A9MGT0"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGT0"
FT                   /inference="protein motif:HMMPfam:IPR002504"
FT                   /inference="similar to AA sequence:PDB:2AN1"
FT                   /protein_id="ABX20191.1"
FT                   /translation="MLYRWLCAQGYEVIVEQQIAHELQLKNVPTGTLAEIGQQADLAVV
FT                   VGGDGNMLGAARTLARYDINVIGINRGNLGFLTDLDPDNALQQLSDVLEGRYISEQRFL
FT                   LEAQVCQQDCQKRISTAINEVVLHPGKVAHMIEFEVYIDEIFAFSQRSDGLIISTPTGS
FT                   TAYSLSAGGPILTPSLDAITLVPMFPHTLSARPLVINSNSTIRLRFSHRRSDLEISCDS
FT                   QIALPIQEGEDVLIRRCDYHLNLIHPKDYSYFNTLSTKLGWSKKLF"
FT   gene            238581..239345
FT                   /locus_tag="SARI_00246"
FT   CDS_pept        238581..239345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmo:MMOB1120 8.9e-08 grpE; heat shock protein
FT                   GrpE K03687; COG: COG0576 Molecular chaperone GrpE (heat
FT                   shock protein); Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20192"
FT                   /db_xref="GOA:A9MGT1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGT1"
FT                   /inference="protein motif:FPrintScan:IPR000740"
FT                   /inference="protein motif:Gene3D:IPR009012"
FT                   /inference="protein motif:Gene3D:IPR013805"
FT                   /inference="protein motif:HMMPfam:IPR000740"
FT                   /inference="protein motif:ScanRegExp:IPR000740"
FT                   /inference="protein motif:superfamily:IPR009012"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217670.1"
FT                   /protein_id="ABX20192.1"
FT                   /translation="MTRMSHNADTLEMIIHFSEVLVAKIDDNVSASLETLNLIPIISEV
FT                   SEMNAKKNAEKFMSSKEQKTPEGQAPEEIIMDQHEEVEAVEPNDSAEQVDPRDEKIANL
FT                   EVQLAEAQTRERDTVLRIKAEMENLRRRTEQDIEKAHKFALEKFVNELLPVIDSLDRAL
FT                   EVADKANPDMAAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESEEI
FT                   PAGNVLGIMQKGYTLNGRTIRAAMVTVAKAKG"
FT   unsure          239206..239342
FT                   /locus_tag="SARI_00246"
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            complement(239406..240647)
FT                   /locus_tag="SARI_00247"
FT   CDS_pept        complement(239406..240647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00247"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ece:Z3906m 3.8e-203 yfjD; uncharacterized CBS
FT                   domain-containing protein K00638; COG: COG4536 Putative
FT                   Mg2+ and Co2+ transporter CorB; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20193"
FT                   /db_xref="GOA:A9MGT2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGT2"
FT                   /inference="protein motif:HMMPfam:IPR000644"
FT                   /inference="protein motif:HMMPfam:IPR002550"
FT                   /inference="protein motif:HMMPfam:IPR005170"
FT                   /inference="similar to AA sequence:INSD:AAL21568.1"
FT                   /protein_id="ABX20193.1"
FT                   /translation="MVVISAYFSGSETGMMTLNRYRLRHMAKQGNRSAKRVEKLLRKPD
FT                   RLISLVLIGNNLVNILASALGTIVGMRLYGDAGVAIATGVLTFVVLVFAEVLPKTIAAL
FT                   YPEKVAYPSSFLLAPLQILMMPLVWLLNTITRLLMRLMGIKADIVVSGSLSKEELRTIV
FT                   HESRSQISRRNQDMLLSVLDLEKVSVDDIMVPRNEIIGIDINDDWKSIERQLTHSPHGR
FT                   IVLYRDSLDDAISMLRVREAWRLMAEKKEFTKEMMLRAADEIYYVPEGTPLSTQLIKFQ
FT                   RNKKKVGLVVNEYGDIQGLVTVEDILEEIVGDFTTSMSPTLAEEVTPQNDGSVIIDGTA
FT                   NVREINKAFNWHLPEDDARTVNGVILEALEEIPVAGTRVRIEQYDIDILDVQENMIKQV
FT                   KVVPVKPLRESVAE"
FT   gene            complement(240712..241503)
FT                   /locus_tag="SARI_00248"
FT   CDS_pept        complement(240712..241503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_00150 3.3e-05 heme export protein
FT                   apocytochrome heme-lyase; COG: COG4137 ABC-type
FT                   uncharacterized transport system, permease component; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20194"
FT                   /db_xref="GOA:A9MGT3"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGT3"
FT                   /inference="protein motif:HMMPfam:IPR002541"
FT                   /inference="similar to AA sequence:INSD:AAO70204.1"
FT                   /protein_id="ABX20194.1"
FT                   /translation="MPVFALLALVAYSFSLALIVPGLLQKNSGWRRMAILSAVIALVCH
FT                   AVALESRILPGGDSGQNLSLLNVGSLVSLMICTVMTVVASRNRGWLLLPIVYAFALINL
FT                   AFATFMPNEYITHLEATPGMMVHIGLSLFSYATLIIAALYALQLAWIDYQLKNKKLAFS
FT                   NEMPPLMSIERKMFHITQIGVVLLTLTLCTGLFYMHNLFSIENIDKAVLSIVAWFVYIV
FT                   LLWGHYHEGWRGRRVVWFNVAGAGLLTLAYFGSRILQQFVS"
FT   gene            241669..243030
FT                   /locus_tag="SARI_00249"
FT   CDS_pept        241669..243030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3018 1.5e-183 signal recognition
FT                   particle protein K01733; COG: COG0541 Signal recognition
FT                   particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20195"
FT                   /db_xref="GOA:A9MGT4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGT4"
FT                   /inference="protein motif:BlastProDom:IPR000897"
FT                   /inference="protein motif:Gene3D:IPR004125"
FT                   /inference="protein motif:Gene3D:IPR013822"
FT                   /inference="protein motif:HMMPfam:IPR000897"
FT                   /inference="protein motif:HMMPfam:IPR004125"
FT                   /inference="protein motif:HMMPfam:IPR013822"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR004780"
FT                   /inference="protein motif:ScanRegExp:IPR000897"
FT                   /inference="protein motif:superfamily:IPR013822"
FT                   /inference="similar to AA sequence:INSD:CAD05856.1"
FT                   /protein_id="ABX20195.1"
FT                   /translation="MFDNLTDRLSRTLRNISGRGRLTEDNVKETLREVRMALLEADVAL
FT                   PVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVRSELVAAMGEENQTLNLAAQPPAVVL
FT                   MAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFSSD
FT                   VGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVD
FT                   AMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTDA
FT                   LEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLATKLKKGDGFDLNDFLEQLKQ
FT                   MKNMGGMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTLKERAKPEIIKGSRK
FT                   RRIAQGCGMQVQDVNRLLKQFDDMQRMMKKMKKGGMAKMMRSMKGMMPPGFPGR"
FT   gene            243246..243530
FT                   /locus_tag="SARI_00250"
FT   CDS_pept        243246..243530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00250"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0228 Ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20196"
FT                   /db_xref="GOA:A9MGT5"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGT5"
FT                   /inference="protein motif:BlastProDom:IPR000307"
FT                   /inference="protein motif:Gene3D:IPR000307"
FT                   /inference="protein motif:HMMPanther:IPR000307"
FT                   /inference="protein motif:HMMPfam:IPR000307"
FT                   /inference="protein motif:HMMTigr:IPR000307"
FT                   /inference="protein motif:ScanRegExp:IPR000307"
FT                   /inference="protein motif:superfamily:IPR000307"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217664.1"
FT                   /protein_id="ABX20196.1"
FT                   /translation="MGPGVLFTQEDVMVTIRLARHGAKKRPFYQVVVTDSRNARNGRFI
FT                   ERVGFFNPIASEKEEGTRLDLDRIAHWVGQGATISDRVAALIKEVKKAA"
FT   gene            243546..244097
FT                   /locus_tag="SARI_00251"
FT   CDS_pept        243546..244097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00251"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0806 RimM protein, required for 16S rRNA
FT                   processing; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20197"
FT                   /db_xref="GOA:A9MGT6"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGT6"
FT                   /inference="protein motif:HMMPfam:IPR002676"
FT                   /inference="protein motif:HMMPfam:IPR007903"
FT                   /inference="protein motif:HMMTigr:IPR011961"
FT                   /inference="protein motif:superfamily:IPR011033"
FT                   /inference="similar to AA sequence:INSD:AAO70201.1"
FT                   /protein_id="ABX20197.1"
FT                   /translation="MMGKQLTAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDY
FT                   QPWFIQKADQWQQVQLESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPALEE
FT                   GDYYWKDLMGCQVVTAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQ
FT                   VIKKVDLATRTIEVDWDPGF"
FT   gene            244175..244957
FT                   /locus_tag="SARI_00252"
FT   CDS_pept        244175..244957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00252"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2674 6.1e-125 trmD; tRNA
FT                   (guanine-7-)-methyltransferase K00554; COG: COG0336
FT                   tRNA-(guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00252"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20198"
FT                   /db_xref="GOA:A9MGT7"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGT7"
FT                   /inference="protein motif:BlastProDom:IPR002649"
FT                   /inference="protein motif:HMMPfam:IPR002649"
FT                   /inference="protein motif:HMMTigr:IPR002649"
FT                   /inference="similar to AA sequence:INSD:AAL21563.1"
FT                   /protein_id="ABX20198.1"
FT                   /translation="MFRAITDYGVTGRAVKKGLLNVQSWSPRDFAYDRHRTVDDRPYGG
FT                   GPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRY
FT                   EGVDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVARFIPGVLGHEASAIEDSFADG
FT                   LLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENLALTEEQ
FT                   ARLLAEFKMEHAQQQQIHESIQDASRRLTLRQHERRSV"
FT   gene            245017..245364
FT                   /locus_tag="SARI_00253"
FT   CDS_pept        245017..245364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00253"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0335 Ribosomal protein L19; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20199"
FT                   /db_xref="GOA:A9MGT8"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGT8"
FT                   /inference="protein motif:BlastProDom:IPR001857"
FT                   /inference="protein motif:HMMPfam:IPR001857"
FT                   /inference="protein motif:HMMTigr:IPR001857"
FT                   /inference="protein motif:ScanRegExp:IPR001857"
FT                   /inference="similar to AA sequence:INSD:AAX66580.1"
FT                   /protein_id="ABX20199.1"
FT                   /translation="MSNIIKQLEQEQMKQNVPSFRPGDTVEVKVWVVEGTKKRLQAFEG
FT                   VVIAIRNRGLHSAFTVRKISNGEGVERVFQTHSPVVDSIAVKRRGAVRKAKLYYLRERT
FT                   GKAARIKERLN"
FT   gene            complement(245534..246609)
FT                   /pseudo
FT                   /locus_tag="SARI_00254"
FT                   /note="Pseudogene compared to gi|16765987|ref|NP_461602.1|
FT                   putative diguanylate cyclase/phosphodiesterase [Salmonella
FT                   typhimurium LT2]"
FT   gene            complement(246569..246751)
FT                   /locus_tag="SARI_00255"
FT   CDS_pept        complement(246569..246751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00255"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2199 FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20200"
FT                   /db_xref="GOA:A9MGT9"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGT9"
FT                   /inference="similar to AA sequence:INSD:AAV78400.1"
FT                   /protein_id="ABX20200.1"
FT                   /translation="MNKEFSLSRPTFKRTLRRISIISVLITMTLIWLLICVASVLTLKQ
FT                   YAQKKSRLNRRHDSP"
FT   gene            complement(246744..247268)
FT                   /locus_tag="SARI_00256"
FT   CDS_pept        complement(246744..247268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00256"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG17158 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20201"
FT                   /db_xref="InterPro:IPR025293"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGU0"
FT                   /inference="similar to AA sequence:INSD:AAX66579.1"
FT                   /protein_id="ABX20201.1"
FT                   /translation="MLMRFSHRFILLFSLLLASLPLYTQRATEEEKSVRAIVSGIISYI
FT                   PWPTLSGPPGLCIFSSSHVARVFSEEAGGDFPYQPLIIRTTQEALSARCDGFYFGNESP
FT                   SYQVELTRHYPVNALLLIAEQNTECIIGRVFCLIINNNEVNFSVNPDSLSHSGMRVNPE
FT                   VLMLARNQKHE"
FT   gene            247634..248773
FT                   /locus_tag="SARI_00257"
FT   CDS_pept        247634..248773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecc:c3122 4.8e-187 aroF;
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase K01626; COG:
FT                   COG0722 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP)
FT                   synthase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20202"
FT                   /db_xref="GOA:A9MGU1"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGU1"
FT                   /inference="protein motif:Gene3D:IPR006218"
FT                   /inference="protein motif:HMMPfam:IPR006218"
FT                   /inference="protein motif:HMMPIR:IPR006219"
FT                   /inference="protein motif:HMMTigr:IPR006219"
FT                   /inference="similar to AA sequence:REFSEQ:NP_755004.1"
FT                   /protein_id="ABX20202.1"
FT                   /translation="MWYGLNILVEDQLSQTRKDRIAIMQKDALNNVRITDEQVLMTPEQ
FT                   LKAAFPLSLAQEAQIAQSRRTISDIIAGRDPRLLVVCGPCSIHDPETALEYARRFKALA
FT                   AEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLKIARQLLVELVNMGLP
FT                   LATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSLATAIN
FT                   AMRAAAQSHRFVGINQAGQVALLQTQGNPHGHVILRGGKAPNYSPADVAQCEKEMEQAG
FT                   LRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIESNIHEGNQSSEQPR
FT                   SEIKYGVSVTDACISWEMTDALLREIHKDLSGQLAVRVA"
FT   gene            248783..249904
FT                   /locus_tag="SARI_00258"
FT   CDS_pept        248783..249904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2856 6.7e-190 tyrA; prephenate
FT                   dehydrogenase / chorismate mutase K04092:K04517; COG:
FT                   COG1605 Chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20203"
FT                   /db_xref="GOA:A9MGU2"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008244"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011277"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGU2"
FT                   /inference="protein motif:HMMPfam:IPR002701"
FT                   /inference="protein motif:HMMPfam:IPR003099"
FT                   /inference="protein motif:HMMPIR:IPR008244"
FT                   /inference="protein motif:HMMTigr:IPR011277"
FT                   /inference="protein motif:superfamily:IPR002701"
FT                   /inference="similar to AA sequence:INSD:CAD05848.1"
FT                   /protein_id="ABX20203.1"
FT                   /translation="MVAELTALRDQIDDVDKALLNLLAKRLELVAEVGEVKSRFGLPIY
FT                   VPEREASMLASRRAEAEAIGVPPDLIEDVLRRVMRESYSSENDKGFKTLCPSLRPVVIV
FT                   GGGGQMGRLFEKMLTLSGYQVRILEQQDWPRAGGIVADAGMVIVSVPIHVTEQVIAKLP
FT                   RLPPDCILVDLASVKSGPLQAMLAVHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRQPEA
FT                   YQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALS
FT                   SPIYRLELAMVGRLFAQDPQLYADIIMSSKRNLALIKRYYKRFGDAIALLEQGDKQAFI
FT                   DSFRKVEHWFGDYARRFHNESRVLLRQANDSRQ"
FT   gene            249962..250870
FT                   /locus_tag="SARI_00259"
FT   CDS_pept        249962..250870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bme:BMEI1997 2.0e-23 gluconolactonase K01053;
FT                   COG: COG3386 Gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00259"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20204"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGU3"
FT                   /inference="protein motif:HMMPfam:IPR013658"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217657.1"
FT                   /protein_id="ABX20204.1"
FT                   /translation="MTTPHVLFDYVGHLPECPTWSEDEGALYWTDILEKEIHRYHPASG
FT                   AHSVLAFPEKVGCFALREQGGFIVAMRNAIWLADKNGLLQCKVCDNPSNPKLARFNDGG
FT                   TDGDGRFYAGTFWAPGDYNGAMLMRIDHDLTAKVIQCDIQGHNGLAFSPDNQWMYTSDT
FT                   PNGVIYRTSLDKHGEPGKREPFRHFGEGEGLPDGAAMDSEGCYWSAMFDGWRVARFSPQ
FT                   GEQLEEYRLPVRCPTMVCFGGADMKTLFITTTRENMSAQEVTDYPLSGAIFTLQVTVAG
FT                   MKKSRFIERQAGSTGTTFSLG"
FT   gene            complement(250831..251991)
FT                   /locus_tag="SARI_00260"
FT   CDS_pept        complement(250831..251991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2669 7.3e-200 pheA; bifuctional:
FT                   chorismate mutase P; prephenate dehydratase K04093:K04518;
FT                   COG: COG0077 Prephenate dehydratase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20205"
FT                   /db_xref="GOA:A9MGU4"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010952"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGU4"
FT                   /inference="protein motif:HMMPfam:IPR001086"
FT                   /inference="protein motif:HMMPfam:IPR002701"
FT                   /inference="protein motif:HMMPIR:IPR008242"
FT                   /inference="protein motif:HMMTigr:IPR010952"
FT                   /inference="protein motif:ScanRegExp:IPR001086"
FT                   /inference="protein motif:superfamily:IPR002701"
FT                   /inference="similar to AA sequence:INSD:AAX66575.1"
FT                   /protein_id="ABX20205.1"
FT                   /translation="MTSENPLLALRDKISALDEELLVLLAKRRALAIEVGQAKLLSHRP
FT                   VRDIDRERALLDRLIHLGKAHHLDAHYITRLFQLIIEDSVLTQQALLQQHLNNTHPHSA
FT                   RIAFLGPKGSYSHLAARQYAARHFEQFIESGCAKFADIFHQVETGQADYAVVPIENTSS
FT                   GAINDVYDLLQHTSLSIVGEMTVTIDHCILVSGATDLNTIETVYSHPQPFQQCSKFLSR
FT                   YPHWKIDYTESTSAAMEKVAQANSPRVAALGSEAGGTLHGLQVLERIAANQTQNITRFL
FT                   VLARKAINVSDQVPAKTTLLIATGQQAGALVEALLVLRNHNLIMTKLESRPIHGNPWEE
FT                   MFYLDIQANLESQVMQNSLKELGEITRSMKVLGCYPSENVVPVEPA"
FT   gene            252714..253367
FT                   /locus_tag="SARI_00261"
FT   CDS_pept        252714..253367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20206"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGU5"
FT                   /inference="similar to AA sequence:REFSEQ:NP_288436.1"
FT                   /protein_id="ABX20206.1"
FT                   /translation="MNIIKNCFSFLNSMLGMSGRSYAVSEGHIASKLGSKIVNVKNGSA
FT                   ELLTYRSADLSKERVITQEILSRLDIRENFVAVRIQEDKFTDLKNKTIQGHKETVAKVR
FT                   DWYNPYQNYLGISMGRVELSSDIAKKECRNAMNVMLMERNDFNNKILNSDNLQKQYGGN
FT                   GDKSWVVAPLKELLDKGAKVYPDETCSLRLGQPFIITLPETTKVNVDIYPVNKK"
FT   gene            complement(253855..254271)
FT                   /locus_tag="SARI_00262"
FT   CDS_pept        complement(253855..254271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00262"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1544 Ribosome-associated protein Y (PSrp-1);
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20207"
FT                   /db_xref="GOA:A9MGU6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGU6"
FT                   /inference="protein motif:HMMPfam:IPR003489"
FT                   /inference="protein motif:HMMTigr:IPR003489"
FT                   /inference="similar to AA sequence:INSD:AAX66574.1"
FT                   /protein_id="ABX20207.1"
FT                   /translation="MIYITHFDIKNGMLESPRRERQEVKFMTMNITSKQMEITPAIRQH
FT                   VADRLAKLEKWQTHLINPHIILSKEPQGFIADATINTPNGHLVASAKHEDMYTAINELI
FT                   NKLERQLNKVQHKGEARRATASVKDASFVEAEEE"
FT   gene            complement(254465..255202)
FT                   /locus_tag="SARI_00263"
FT   CDS_pept        complement(254465..255202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00263"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4105 DNA uptake lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20208"
FT                   /db_xref="GOA:A9MGU7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGU7"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="similar to AA sequence:REFSEQ:YP_151705.1"
FT                   /protein_id="ABX20208.1"
FT                   /translation="MTRMKYLVAAATLSLFLAGCSGSKEEVPDNPPNEIYATAQQKLQD
FT                   GNWKQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFMRLNPTHPN
FT                   IDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQHARAAFNDFSKLVRSYPNSQYTTDA
FT                   TKRLVFLKDRLAKYEYSVAEYYTARGAWVAVVNRVEGMLRNYPDTQATRDALPLMENAY
FT                   RQMQLNAQADKVAKIIAANSKNT"
FT   gene            255334..256290
FT                   /locus_tag="SARI_00264"
FT   CDS_pept        255334..256290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2851 3.8e-139 sfhB, rluD; ftsH
FT                   suppressor protein SfhB K06180; COG: COG0564
FT                   Pseudouridylate synthases, 23S RNA-specific; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20209"
FT                   /db_xref="GOA:A9MGU8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGU8"
FT                   /inference="protein motif:BlastProDom:IPR006145"
FT                   /inference="protein motif:HMMPfam:IPR002942"
FT                   /inference="protein motif:HMMPfam:IPR006145"
FT                   /inference="protein motif:HMMSmart:IPR002942"
FT                   /inference="protein motif:HMMTigr:IPR006225"
FT                   /inference="protein motif:ScanRegExp:IPR006224"
FT                   /inference="similar to AA sequence:SwissProt:P65837"
FT                   /protein_id="ABX20209.1"
FT                   /translation="MAQRVQLTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILNQRV
FT                   LVNGQLCDKPKEKVLGGERVAIDAEIDEEIRFEAQDIPLDIVYEDDDILVINKPRDLVV
FT                   HPGAGNPDGTVLNALLHYYPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESLQ
FT                   LREITREYEAVAIGHMTAGGTVNEPISRHPTKRTHMSVHPMGKPAVTHYRIMEHFRVHT
FT                   RLRLRLETGRTHQIRVHMAHITHPLVGDQVYGGRPRPPKAHRKRLFPRCVSSTASASCN
FT                   DAASLPSCIGYRNGVARADSTGYGGPYRCDARRFRRT"
FT   gene            256309..257040
FT                   /locus_tag="SARI_00265"
FT   CDS_pept        256309..257040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00265"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1496 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20210"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGU9"
FT                   /inference="protein motif:HMMPfam:IPR003730"
FT                   /inference="protein motif:HMMTigr:IPR003730"
FT                   /inference="protein motif:superfamily:IPR009030"
FT                   /inference="similar to AA sequence:REFSEQ:YP_151703.1"
FT                   /protein_id="ABX20210.1"
FT                   /translation="MNVLIVPQWPLPKGVAACSSTRIGGMSLPPYDSLNLGAHCGDNPA
FT                   HVEENRKRLFAEGNLPSKPVWLEQVHGKNVLRLTGEPYASKRADASYSNTPGTVCAVMT
FT                   ADCLPVLFCNREGTEVAAAHAGWRGLCEGVLEETVACFADKPENIIAWLGPAIGPAAFE
FT                   VGPEVRDAFLVKDAQADSAFLAHGEKFLANIYQLARQRLANTGVAHVYGGDRCTFSESE
FT                   TFFSYRRDKTTGRMASFIWLI"
FT   gene            257158..259743
FT                   /locus_tag="SARI_00266"
FT   CDS_pept        257158..259743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2925 0. clpB; heat shock protein
FT                   K03695; COG: COG0542 ATPases with chaperone activity,
FT                   ATP-binding subunit; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20211"
FT                   /db_xref="GOA:A9MGV0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGV0"
FT                   /inference="protein motif:HMMPfam:IPR003959"
FT                   /inference="protein motif:HMMPfam:IPR004176"
FT                   /inference="protein motif:HMMPfam:IPR013093"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR001270"
FT                   /protein_id="ABX20211.1"
FT                   /translation="MGGVMRLDRLTNKFQLALADAQSLALGHDNQFIEPLHLMSALLNQ
FT                   EGGSVRPLLTSAGINAGQLRTAIDQALSRLPQVEGTGGDVQPSSELVRVLNLCDKLAQK
FT                   RGDNFISSELFVLAALESRGTLTDLLKSAGATTANITQAIEQMRGGESVNDQGAEDQRQ
FT                   ALKKYTVDLTERAEQGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEG
FT                   LAQRIINGEVPEGLKGRRVLALDMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFI
FT                   DELHTMVGAGKADGAMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDAALERRFQKV
FT                   FVAEPSVEDTIAILRGLKERYELHHHVQITDPAIVAAATLSHRYIADRQLPDKAIDLID
FT                   EAASSIRMQIDSKPEELDRLDRRIIQLKLEQQALMKESDEASKKRLDMLNEELDDKERQ
FT                   YSELEEEWKAEKASLSGTQTIKAELEQAKIAIEQARRVGDLARMSELQYGKIPELEKQL
FT                   EAATQSEGKTMRLLRNKVTDAEIAEVLARWTGIPVARMLEGEREKLLRMEQELHSRVIG
FT                   QNEAVEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKALANFMFDSDDAMVR
FT                   IDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNIL
FT                   LQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQERFGELDYGRMKEMVLGVVGHNF
FT                   RPEFINRIDEVVVFHPLGEQHIAAIAQIQLQRLYKRLEERGYEIHISDEALKLLSANGY
FT                   DPVYGARPLKRAIQQQIENPLAQQILSGELVPGKVIRLEASDDRIVAVQ"
FT   unsure          257356..257399
FT                   /locus_tag="SARI_00266"
FT                   /note="Sequence derived from one plasmid subclone"
FT   unsure          259165..259622
FT                   /locus_tag="SARI_00266"
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            260223..260754
FT                   /locus_tag="SARI_00267"
FT   rRNA            260223..260754
FT                   /locus_tag="SARI_00267"
FT                   /product="small subunit ribosomal RNA"
FT                   /note="Rfam score 351.93; 5 domain"
FT                   /inference="nucleotide motif:Rfam:RF00177"
FT   unsure          260591..260610
FT                   /locus_tag="SARI_00267"
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            261826..261898
FT                   /locus_tag="SARI_00268"
FT   tRNA            261826..261898
FT                   /locus_tag="SARI_00268"
FT                   /product="tRNA-Glu"
FT   gene            265377..265492
FT                   /locus_tag="SARI_00269"
FT   rRNA            265377..265492
FT                   /locus_tag="SARI_00269"
FT                   /product="5S ribosomal RNA"
FT                   /note="Rfam score 84.4"
FT                   /inference="nucleotide motif:Rfam:RF00001"
FT   gene            265780..266235
FT                   /locus_tag="SARI_00270"
FT   CDS_pept        265780..266235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00270"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09993 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20212"
FT                   /db_xref="InterPro:IPR025494"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGV1"
FT                   /inference="protein motif:superfamily:IPR008979"
FT                   /inference="similar to AA sequence:INSD:AAV76285.1"
FT                   /protein_id="ABX20212.1"
FT                   /translation="MAIKSFNYQQDFSSIDFRQQPDLYQVGRGEQGVLLVEPYKSEILP
FT                   FWRYKDEASAIKSAEQIYQLFEAYRQQDDFVGMDMARKFIQMGYTRARRYANYKGGRKY
FT                   AEDGSLNTRGNDPTKAAAATVFKGWWDKIRQDEDYLKRKRQHQARWG"
FT   gene            266339..267640
FT                   /locus_tag="SARI_00271"
FT   CDS_pept        266339..267640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00271"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20213"
FT                   /db_xref="GOA:A9MGV2"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGV2"
FT                   /inference="protein motif:HMMPfam:IPR005828"
FT                   /inference="protein motif:HMMTigr:IPR004736"
FT                   /inference="protein motif:ScanRegExp:IPR005829"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149598.1"
FT                   /protein_id="ABX20213.1"
FT                   /translation="MAEIIQRIDKNNAEAPEIRRRVWAIVGASSGNLVEWFDFYAYSFC
FT                   SLYFAHIFFPSGNTTTQLLQTAGVFAAGFLMRPIGGWLFGRIADRRGRKASMLISVCMM
FT                   CLGSLVIACLPGYDTIGIWAPALLLIARLFQGLSVGGEYGTSATYMSEVALDGLKGFFA
FT                   SFQYVTLIGGQLLALLVVVLLQQVLEDAELRAWGWRIPFALGAVLAVVALWLRRQLDET
FT                   SKHETRALKEAGSLKGLWRNRKAFLMVLGFTAAGSLCFYTFTTYMQKYLVNTAGMHANV
FT                   ASGIMTVALCVFMLVQPLFGALSDKIGRRTSMLCFGALATLFTVPILSALQNVTSPYVA
FT                   FALVMCALLIVSFYTSISGILKAEMFPAQVRALGVGLSYAVANALFGGSAEYVALSLKS
FT                   FGMENSFFWYVTAMAVLAFLVSLMLHRKGKGLRL"
FT   gene            complement(267637..267864)
FT                   /locus_tag="SARI_00272"
FT   CDS_pept        complement(267637..267864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00272"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG5544 Predicted periplasmic lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20214"
FT                   /db_xref="InterPro:IPR018736"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGV3"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457128.1"
FT                   /protein_id="ABX20214.1"
FT                   /translation="MASAMLSAAGNEYARHQGVNPDRSAAIGLMFSLSLGASKELWDSR
FT                   PEGSGWSWKDFAWDVAGATTGYAIWQMAQH"
FT   gene            complement(268005..269360)
FT                   /locus_tag="SARI_00273"
FT   CDS_pept        complement(268005..269360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0265 6.9e-243 pssA;
FT                   CDP-diacylglycerol-serine O-phosphatidyltransferase K00998;
FT                   COG: COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases and related enzymes; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00273"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20215"
FT                   /db_xref="GOA:A9MGV4"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGV4"
FT                   /inference="protein motif:HMMPfam:IPR001736"
FT                   /inference="protein motif:HMMSmart:IPR001736"
FT                   /inference="similar to AA sequence:INSD:AAL21546.1"
FT                   /protein_id="ABX20215.1"
FT                   /translation="MLSKFKRNKHQQHLAQLPKISQSVDDVDFFYTPATFRETLLEKIA
FT                   SATQRICIVALYLEQDDGGKGILDALYAAKRQRPELDVRVLVDWHRAQRGRIGAAASNT
FT                   NADWYCRLAQENPDIEVPVYGVPINTREALGVLHFKGFIIDDSVLYSGASLNDVYLHQH
FT                   DKYRYDRYQLIRNRQMADIMFDWVTRNLMNGRGVNRLDNTLRPKSPEIKNDIRLYRQEL
FT                   REASYHFQGDANDEQLSVTPLVGLGKSSLLNKTIFHLMPCAEHKLTICTPYFNLPAVLV
FT                   RNIIQLLRDGKKVEIIVGDKTANDFYIPEDEPFKIIGALPYLYEINLRRFLSRLQYYVN
FT                   TDQLVVRLWKDDDNTYHLKGMWVDDKWMLLTGNNLNPRAWRLDLENAILIHDPKQELAP
FT                   QREKELELIRTHTTIVKHYRDLQSIADYPVKVRKLIRRLRRIRIDRLISRIL"
FT   gene            complement(269475..272135)
FT                   /locus_tag="SARI_00274"
FT   CDS_pept        complement(269475..272135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2907 0. yfiQ; hypothetical protein
FT                   YfiQ K09181; COG: COG1042 Acyl-CoA synthetase (NDP
FT                   forming); Psort location: CytoplasmicMembrane, score:9.27"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20216"
FT                   /db_xref="GOA:A9MGV5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGV5"
FT                   /inference="protein motif:Gene3D:IPR013816"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="protein motif:HMMPfam:IPR003781"
FT                   /protein_id="ABX20216.1"
FT                   /translation="MSQQGLEALLRPKSIAVIGASMKPHRAGYLMMRNLLAGGFNGPVL
FT                   PVTPAWKAVLGVMAWPDIASLPFTPDLAILCTNASRNLALLDALGANGCKTCIILSAPT
FT                   SQHEELLACARRHKMRLLGPNSLGLLAPWLGLNASFSPVPIKQGKLAFISQSAAVSNTI
FT                   LDWAQQREMGFSYFIALGDSLDIDVDELLDYLARDSKTSAILLYLEQLSDARRFVSAAR
FT                   SASRNKPILVIKSGRSPAAQRLLNTSAGMDPAWDAAIQRAGLLRVQDTHELFSAVETLS
FT                   HMRPLRGDRLMIISNGAAPAALALDELWSRNGKLATLSEETCLQLRQALPAHIDIANPL
FT                   DLCDDASSEHYVKTLDILLASQDFDALMVIHSPSAAAPGTESAHALIETIKRHPRGRFV
FT                   TLLTNWCGEFSSQEARRLFSEAGLPTYRTPEGTITAFMHMVEYRRNQKQLRETPALPSN
FT                   LTSNTAEAHNLLQQAIAEGATSLDTHEVQPILHAYGLHTLPTWIAGDSAEAVHIAEQIG
FT                   YPVALKLRSPDIPHKSDVQGVMLYLRTANEVQQAANAIFDRVKMAWPQARIHGLLVQSM
FT                   ANRAGAQELRVVVEHDPVFGPLIMLGEGGVEWRPEEQAVVALPPLNMNLARYLVIQGIK
FT                   QRKIRARSALHPLDIVGLSQLLVQVSNLIVDCPEIQRLDIHPLLASASEFTALDVTLDI
FT                   APFDGDSESRLAVRPYPHQLEEWVEMKNGDRCLFRPILPEDEPQLRQFIAQVTKEDLYY
FT                   RYFSEINEFTHEDLANMTQIDYDREMAFVAVRRLDNTEEILGVTRAISDPDNIDAEFAV
FT                   LVRSDLKGLGLGRRLMEKLIAYTRDHGLRRLNGITMPNNRSMVALARKLGFQVDIQLEE
FT                   GIVGLTLNLAQCDES"
FT   gene            complement(272171..272695)
FT                   /locus_tag="SARI_00275"
FT   CDS_pept        complement(272171..272695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00275"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3148 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20217"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGV6"
FT                   /inference="protein motif:HMMPfam:IPR005636"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149602.1"
FT                   /protein_id="ABX20217.1"
FT                   /translation="MFDTEPLKPSNTGRLIADILPDTAAFQWSRTEPPQALLELVQHPD
FT                   YQPIVVFPASYAGEAREVIFTPPAGKPPLFIMLDGTWPEARKMFRKSPYLDHLPIISVD
FT                   LSRLSAYRLREIHAEGQYCTAEVAIALLDMAGDTEAAVGLGEHFTRFKTRYLAGKTQHP
FT                   GNITAENSESV"
FT   gene            complement(272940..273359)
FT                   /locus_tag="SARI_00276"
FT   CDS_pept        complement(272940..273359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2649 1.4e-72 trxC; thioredoxin 2, redox
FT                   factor K03672; COG: COG0526 Thiol-disulfide isomerase and
FT                   thioredoxins; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00276"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20218"
FT                   /db_xref="GOA:A9MGV7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGV7"
FT                   /inference="protein motif:FPrintScan:IPR006662"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR013766"
FT                   /inference="protein motif:HMMTigr:IPR005746"
FT                   /inference="protein motif:ScanRegExp:IPR006662"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461584.1"
FT                   /protein_id="ABX20218.1"
FT                   /translation="MNTVCTHCQAINRIPDDRLQDAAKCGRCGHELFDGEVINATSETL
FT                   DKLLKDDLPVVIDFWAPWCGPCRNFAPIFKDVAEERSGKVRFVKVDTEAERELSARFGI
FT                   RSIPTIMIFKHGQVVDMLNGAVPKAPFDNWLNEAL"
FT   gene            273563..274600
FT                   /locus_tag="SARI_00277"
FT   CDS_pept        273563..274600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00277"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0262 1.1e-182 yfiF; putative RNA
FT                   methyltransferase K03214; COG: COG0566 rRNA methylases;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20219"
FT                   /db_xref="GOA:A9MGV8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGV8"
FT                   /inference="protein motif:BlastProDom:IPR001537"
FT                   /inference="protein motif:HMMPfam:IPR001537"
FT                   /inference="protein motif:HMMPfam:IPR013123"
FT                   /inference="similar to AA sequence:INSD:CAD05832.1"
FT                   /protein_id="ABX20219.1"
FT                   /translation="MNDELKNKSGKVKVMYVRSDDDSDKRTHNPRTGKGGGRPTKSRTD
FT                   GGRRPARDERNNQSRDRKHETSPWRTVSRAPGDETAEKVDHGGISGKSFIDPEILRRQR
FT                   AEETRVYGENACQALFQSRPDAIVRAWFIQSVTPRFKEALRWMAANRKAYHVVDEAELA
FT                   KVSGTEHHGGVCFLIKKRNGMTVKQWVKQAADQDCVLALEDIANPHNLGGMMRSCAHFG
FT                   VKGVVVQDAALLESGAAIRTAEGGAEHVQPITGESIVDVLDDFRQAGYTVVTTSSDRGQ
FT                   ALFGATLPEKMVLVLGREYDFLPEAAREPDDLCVKINGTGNVESLNVSVATGVLLAEWW
FT                   RQNKA"
FT   gene            complement(274719..275408)
FT                   /locus_tag="SARI_00278"
FT   CDS_pept        complement(274719..275408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2652 1.4e-123 ung;
FT                   uracil-DNA-glycosylase K03648; COG: COG0692 Uracil DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20220"
FT                   /db_xref="GOA:A9MGV9"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGV9"
FT                   /inference="protein motif:BlastProDom:IPR003249"
FT                   /inference="protein motif:HMMPfam:IPR005122"
FT                   /inference="protein motif:HMMTigr:IPR002043"
FT                   /inference="protein motif:ScanRegExp:IPR002043"
FT                   /inference="similar to AA sequence:INSD:AAV76293.1"
FT                   /protein_id="ABX20220.1"
FT                   /translation="MATELTWHDVLADEKQQPYFINTLHTVAGERQSGITVYPPQKDVF
FT                   NAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGIAPPPSLVNMYKELEASIPGFV
FT                   RPPHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQYREGVVFLL
FT                   WGSHAQKKGAIIDPLRHHILKAPHPSPLSAHRGFFGCNHFALTNQWLEQHGEKPIDWTP
FT                   VLPAESE"
FT   gene            275727..276110
FT                   /locus_tag="SARI_00279"
FT   CDS_pept        275727..276110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF2115 1.2e-48 formate acetyltransferase
FT                   K00656; COG: COG3445 Acid-induced glycyl radical enzyme;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20221"
FT                   /db_xref="GOA:A9MGW0"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR011140"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGW0"
FT                   /inference="protein motif:HMMPfam:IPR001150"
FT                   /inference="protein motif:HMMPIR:IPR011140"
FT                   /inference="protein motif:ScanRegExp:IPR001150"
FT                   /inference="similar to AA sequence:INSD:AAL21540.1"
FT                   /protein_id="ABX20221.1"
FT                   /translation="MITGIQITKAANDDLLNSFWLLDSEKGEARCIVAKSGFAEDEVVA
FT                   VSKLGEIEYREIPMEVKPEVRVEGGQHLNVNVLRRETLEDAVKHPEKYPQLTIRVSGYA
FT                   VRFNSLTPEQQRDVIARTFTESL"
FT   gene            complement(276224..277558)
FT                   /locus_tag="SARI_00280"
FT   CDS_pept        complement(276224..277558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2643 1.9e-233 srmB; ATP-dependent RNA
FT                   helicase K05590; COG: COG0513 Superfamily II DNA and RNA
FT                   helicases; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20222"
FT                   /db_xref="GOA:A9MGW1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028621"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGW1"
FT                   /inference="protein motif:HMMPfam:IPR001650"
FT                   /inference="protein motif:HMMPfam:IPR011545"
FT                   /inference="protein motif:HMMSmart:IPR001650"
FT                   /inference="protein motif:HMMSmart:IPR014001"
FT                   /inference="protein motif:ScanRegExp:IPR000629"
FT                   /inference="similar to AA sequence:INSD:AAX66554.1"
FT                   /protein_id="ABX20222.1"
FT                   /translation="MTVTTFSELELDESLLDALQDKGFTRPTAIQAAAIPPALDGRDVL
FT                   GSAPTGTGKTAAYLLPALQHLLDFPRKKSGPPRILILTPTRELAIQVADHARELAKHTH
FT                   LDIATITGGVAYMNHAEVFSENQDIVVATTGRLLQYIKEENFDCRAVETLILDEADRML
FT                   DMGFAQDIEHIAGETRWRKQTMLFSATLEGDAIKDFAERLLEDPVEVSATPSTRERKKI
FT                   HQWYYRADNFEHKVALLKHLLKQDDATRSIVFVRKRERVHELAETLRLAGINNCYLEGE
FT                   MAQIKRNEGIKRLTDGRVNVLVATDVAARGIDIPDVSHVINFDMPRSGDTYLHRIGRTG
FT                   RAGRKGTAISLVEAHDHLLLLKIGRYIEEPLKARVIDELRPTTRAPSEKLTGKPSKKVL
FT                   AKRAEKKKEKEKEKPRVKKRHRDTKNIGKRRKPSGTKMQEQSSEE"
FT   gene            277766..278425
FT                   /locus_tag="SARI_00281"
FT   CDS_pept        277766..278425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2897 1.3e-97 yfiC; hypothetical
FT                   protein YfiC K00599; COG: COG4123 Predicted
FT                   O-methyltransferase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20223"
FT                   /db_xref="GOA:A9MGW2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGW2"
FT                   /inference="protein motif:HMMPfam:IPR007848"
FT                   /inference="protein motif:ScanRegExp:IPR002052"
FT                   /inference="similar to AA sequence:INSD:AAL21536.1"
FT                   /protein_id="ABX20223.1"
FT                   /translation="MKVGTDGILLGAWAPVADVKRILDIGTGSGLLALMLAQRTDDNVP
FT                   VDAVELDAEAAMQAQENVAHSPWAHRITVHTDDIQRWAPRQTVRFDLIISNPPYYEPGV
FT                   ECATPQREQARYTATLDHQTLLAIAADCITEDGFLCVVLPEQIGNAFTQQALSMGWHLR
FT                   LRTDVAENEARLPHRVLLAFSPQAGECFSDRLVIRGPDQHYSESYTALTQAFYLFM"
FT   gene            complement(278410..280032)
FT                   /locus_tag="SARI_00282"
FT   CDS_pept        complement(278410..280032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0269 9.3e-287 nadB; L-aspartate oxidase
FT                   K00278; COG: COG0029 Aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20224"
FT                   /db_xref="GOA:A9MGW3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGW3"
FT                   /inference="protein motif:FPrintScan:IPR001100"
FT                   /inference="protein motif:FPrintScan:IPR013027"
FT                   /inference="protein motif:HMMPfam:IPR003953"
FT                   /inference="protein motif:HMMPfam:IPR004112"
FT                   /inference="protein motif:HMMTigr:IPR005288"
FT                   /inference="protein motif:superfamily:IPR004112"
FT                   /inference="similar to AA sequence:INSD:CAD02790.1"
FT                   /protein_id="ABX20224.1"
FT                   /translation="MMITPELSCDVLIIGSGAAGLSLALRLAEKHKVIVLSKGPVSEGS
FT                   TFYAQGGIAAVFDETDSIESHVEDTLIAGAGICDRHAVEFVASNARACVQWLIDQGVLF
FT                   DTHIQPNGEESYHLTREGGHSHRRILHAADATGKEVETTLVSRALKHPNIRVLERSNAV
FT                   DLIISDKIGLPGPRRVVGAWIWNRNKEWVETCHAKSVVLATGGASKVYQYTTNPDISSG
FT                   DGIAMAWRAGCRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGSRFMPDV
FT                   DERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPDDFVRQHFPMIYAKLLDLGMDLT
FT                   KEPIPVVPAAHYTCGGVVVDDYGRTDVDGLYAIGEVSYTGLHGANRMASNSLLECLVYG
FT                   WSAAKDIDRRMPYAHGVDVLPAWDESRVENADEQVVIQHNWHELRLLMWDYVGIVRTTK
FT                   RLERALRRITMLQQEIDEYYANFRVSNNLLELRNLAQVAELIVRCAIMRKESRGLHFTL
FT                   DYPQQLAESGPSILSPLTSHINR"
FT   gene            280457..281032
FT                   /locus_tag="SARI_00283"
FT   CDS_pept        280457..281032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A2563 7.2e-58 rpoE1; DNA-directed RNA
FT                   polymerase sigma subunit (RpoE,sigma24) K00960; COG:
FT                   COG1595 DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20225"
FT                   /db_xref="GOA:A9MGW4"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGW4"
FT                   /inference="protein motif:HMMPfam:IPR007627"
FT                   /inference="protein motif:HMMPfam:IPR013249"
FT                   /inference="protein motif:ScanRegExp:IPR000838"
FT                   /inference="protein motif:superfamily:IPR013324"
FT                   /inference="protein motif:superfamily:IPR013325"
FT                   /inference="similar to AA sequence:INSD:CAD02789.1"
FT                   /protein_id="ABX20225.1"
FT                   /translation="MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGD
FT                   VPDVVQESFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNHLVAQGRRPPSSDVDVIEAE
FT                   NFESGGALKEISNPENLMLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIM
FT                   DCPVGTVRSRIFRAREAIDNKVQPLIRR"
FT   gene            281064..281714
FT                   /locus_tag="SARI_00284"
FT   CDS_pept        281064..281714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00284"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3073 Negative regulator of sigma E activity"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00284"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20226"
FT                   /db_xref="GOA:A9MGW5"
FT                   /db_xref="InterPro:IPR005572"
FT                   /db_xref="InterPro:IPR005573"
FT                   /db_xref="InterPro:IPR026279"
FT                   /db_xref="InterPro:IPR036147"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGW5"
FT                   /inference="protein motif:HMMPfam:IPR005572"
FT                   /inference="protein motif:HMMPfam:IPR005573"
FT                   /inference="similar to AA sequence:INSD:AAL21533.1"
FT                   /protein_id="ABX20226.1"
FT                   /translation="MQKEKLSALMDGETLDSELLNALTHDPEMQKTWESYHLIRDSMRG
FT                   DTPDVLHFDISARVMAAIENDPVRQVSPLIPEAQPAPQQWQKMPFWKKVRPWAAQLTQV
FT                   GVAACVSLAVIVGVQHYNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEAAPVGSQQ
FT                   QQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ"
FT   gene            281714..282670
FT                   /locus_tag="SARI_00285"
FT   CDS_pept        281714..282670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00285"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3026 Negative regulator of sigma E activity;
FT                   Psort location: Periplasmic, score:9.76"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20227"
FT                   /db_xref="InterPro:IPR005588"
FT                   /db_xref="InterPro:IPR033434"
FT                   /db_xref="InterPro:IPR033436"
FT                   /db_xref="InterPro:IPR038484"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGW6"
FT                   /inference="protein motif:HMMPfam:IPR005588"
FT                   /inference="similar to AA sequence:INSD:CAD02787.1"
FT                   /protein_id="ABX20227.1"
FT                   /translation="MKQLWFAMSLVAGSLFFSVNASADPASGALLQQMNIASQSLNYEL
FT                   SFVSITKQGVESLRYRHARLDSRPLAQLLQLDGPRREVVQRGNEISYFEPGLEPFTLNG
FT                   DYIVDSLPSLIYTDFKRLAPYYDFISVGRTRIADRLCEVIRVVARDGTRYSYIVWMDMD
FT                   TKLPMRVDLLDRDGETLEQFRVIAFTVSKDIGSTMQALAKANLPPLLSVPGGEKTKFNW
FT                   SPSWVPQGFSEVSSSRRPLPTMDNLPIESRLYSDGLFSFSVNVNRATPNSSDQMLRTGR
FT                   RTVYSSVRDNAEITIVGELPPQTAKRIADSIKFRAVQ"
FT   gene            282667..283146
FT                   /locus_tag="SARI_00286"
FT   CDS_pept        282667..283146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00286"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3086 Positive regulator of sigma E activity"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20228"
FT                   /db_xref="GOA:A9MGW7"
FT                   /db_xref="InterPro:IPR007359"
FT                   /db_xref="InterPro:IPR026268"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGW7"
FT                   /inference="protein motif:HMMPfam:IPR007359"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149615.1"
FT                   /protein_id="ABX20228.1"
FT                   /translation="MIKEWATVVSWQNGQAVVSCDVKASCSSCASRAGCGSRVLNKLGP
FT                   QTSHTIVVPSAEPLAPGQKVELGIAEKSLLGSALLVYMSPLAGLFFCAALFQVLFGSDL
FT                   AALSGAVLGGMGGFLVARGYSRKLSERDAWQPVILNVALPPGLVRVETTSIEMRQ"
FT   gene            283575..284054
FT                   /locus_tag="SARI_00287"
FT   CDS_pept        283575..284054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20229"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGW8"
FT                   /protein_id="ABX20229.1"
FT                   /translation="MLSGNTGAPDSTTATTTTAVNYVLNQALAAYSLVASRYTADGATT
FT                   ANAGLVKLVNSMGAGSLVMTQAAVTNAIQTYPSLGKGQKIQDLRASRSAEVTYTSSTGF
FT                   PIAVYVRISGGYSAVLYTHVNGIEFGDGGSTASNTSIAMAFFIVPNGATYLVEAT"
FT   gene            284096..284221
FT                   /locus_tag="SARI_00288"
FT   CDS_pept        284096..284221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20230"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGW9"
FT                   /protein_id="ABX20230.1"
FT                   /translation="MIMMAYYKDKNNAVYTYDAYITQDLYIKEGLVLIIRSHGNY"
FT   gene            284208..284441
FT                   /locus_tag="SARI_00289"
FT   CDS_pept        284208..284441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00289"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG18524 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20231"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGX0"
FT                   /inference="protein motif:HMMPfam:IPR003458"
FT                   /protein_id="ABX20231.1"
FT                   /translation="MEIINPPPMHEDLIQAAENKRQRLLFRADWRTELMLGETSDANRN
FT                   KLSAWLANKNEVKLVDITTTPDNIIWPAPPEG"
FT   gene            284648..284866
FT                   /locus_tag="SARI_00290"
FT   CDS_pept        284648..284866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20232"
FT                   /db_xref="InterPro:IPR029335"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGX1"
FT                   /protein_id="ABX20232.1"
FT                   /translation="MKYIKNIFLVLTFALSAAAFSTSAMAASDTKAPPKANDIPHDPLP
FT                   DMSKFCQDLLEGGGPIPPAMYQYCWQN"
FT   gene            complement(285259..285668)
FT                   /pseudo
FT                   /locus_tag="SARI_00291"
FT                   /note="Pseudogene compared to gi|16765208|ref|NP_460823.1|
FT                   phage-tail assembly-like protein [Salmonella typhimurium
FT                   LT2]"
FT   gene            286325..288358
FT                   /locus_tag="SARI_00292"
FT   CDS_pept        286325..288358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gga:427844 4.7e-07 LOC427844; similar to
FT                   leucine-rich repeat kinase 1 K08843; COG: COG4886
FT                   Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20233"
FT                   /db_xref="GOA:A9MGX2"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR029487"
FT                   /db_xref="InterPro:IPR032674"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGX2"
FT                   /inference="similar to AA sequence:INSD:AAD40326.1"
FT                   /protein_id="ABX20233.1"
FT                   /translation="MSSWEKSKAFFCSTHQTEALECIRTICHPPAGTTREDVVSRFEQL
FT                   RMLAYAGCEENIHSGLHGENHYCIMDEDNQEILSVTLDDAGNYTVNCQEYSETYRLTME
FT                   TEPGEEYTEHAEGASGTSRLPATTAPQTAAEYYAVWSAWQRAAPEGEARGRAAAVKKMR
FT                   DCLKNGNPVLCLERAGLTTLPDHLPPHITILFIPGNNLTSLPALPSGLRELSVSYNQLT
FT                   SLPPLPSGLWKLSVFNNQLASLPPLPSGLQTLWAYHNQLPSLPALPPGLRDLSVSNNQL
FT                   ASLPALPSGLRKLWVSHNQLPSLPELPSGLRALWVSHNQLASLPESITGLSSEATVDLE
FT                   GNPLSERTLQTLRDITSAPDYSGPRIRFDMAGPSVPREARALHLAVADWLMPAREGEPD
FT                   PADRWHASGQEDNAAAFSLFLDRLRETENFEKDAGFKAQISSWLALLAEDDVLRAKTFA
FT                   MATEATSSCQDRITLALHHMKNVQLVHNAEKGVYDNNLPGLVSTGREMFRMEMLERIAR
FT                   EKARTLAFVDEIEVYLAYQNKLKKPLGLTSVTAKMRFFGVSGVTASDLRSAERQVKAAE
FT                   KREFSEWILQWGPLHSVLERKEPERFNALREKQISDYEHTYQMLSDTELKPSGLVGNTD
FT                   AECTIGVRAMESAKKEFLNGLRPLVEEMLGSYLKVKARWRLN"
FT   gene            complement(288351..288503)
FT                   /locus_tag="SARI_00293"
FT   CDS_pept        complement(288351..288503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20234"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGX3"
FT                   /protein_id="ABX20234.1"
FT                   /translation="MIYQHLWGTENQGLSRYSPVHYQCCLVLFVRDSLCFTTPHSPGAV
FT                   NIVLS"
FT   gene            288563..288724
FT                   /locus_tag="SARI_00294"
FT   CDS_pept        288563..288724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2205 3.2e-10 umuC; UmuC protein K03502;
FT                   COG: COG0389 Nucleotidyltransferase/DNA polymerase involved
FT                   in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20235"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGX4"
FT                   /protein_id="ABX20235.1"
FT                   /translation="MEVLDQLNAKDGKGRLYFAGPGIQQQWEMKREKLSPDIPPAMKTC
FT                   FRLSARFN"
FT   gene            289037..290836
FT                   /locus_tag="SARI_00295"
FT   CDS_pept        289037..290836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2891 0. lepA; GTP-binding
FT                   elongation factor LepA K03596; COG: COG0481 Membrane GTPase
FT                   LepA; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20236"
FT                   /db_xref="GOA:A9MGX5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGX5"
FT                   /inference="protein motif:FPrintScan:IPR000795"
FT                   /inference="protein motif:Gene3D:IPR000640"
FT                   /inference="protein motif:HMMPfam:IPR000640"
FT                   /inference="protein motif:HMMPfam:IPR000795"
FT                   /inference="protein motif:HMMPfam:IPR004161"
FT                   /inference="protein motif:HMMPfam:IPR013842"
FT                   /inference="protein motif:HMMTigr:IPR005225"
FT                   /inference="protein motif:HMMTigr:IPR006297"
FT                   /inference="protein motif:ScanRegExp:IPR000795"
FT                   /inference="protein motif:superfamily:IPR009022"
FT                   /inference="protein motif:superfamily:IPR011051"
FT                   /protein_id="ABX20236.1"
FT                   /translation="MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMEAQVLDSMD
FT                   LERERGITIKAQSVTLDFKASDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDA
FT                   GQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAVRCSA
FT                   KTGVGVTDVLERLVRDIPPPQGDPDGPLQALIIDSWFDNYLGVVSLVRIKNGTMRKGDK
FT                   IKVMSTGQTYNADRLGIFTPKQVDRTELKCGEVGWLVCAIKDILGAPVGDTLTSARNPA
FT                   EKALPGFKKVKPQVYAGLFPVSSDDYESFRDALGKLSLNDASLFYEPENSSALGFGFRC
FT                   GFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVETTAKEIIYVDSPSKLPPLNNIYEL
FT                   REPIAECHMLLPQAYLGNVITLCIEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDRL
FT                   KSTSRGYASLDYNFKRFQASDMVRVDVLINNERVDALALITHRDNAQNRGRELVDKMKD
FT                   LIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRKKKLLQKQKEGKKRMK
FT                   QIGNVELPQEAFLAILHVGKDNK"
FT   unsure          290183..290270
FT                   /locus_tag="SARI_00295"
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            290853..291827
FT                   /locus_tag="SARI_00296"
FT   CDS_pept        290853..291827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2577 3.6e-175 lepB; leader peptidase
FT                   (signal peptidase I), serine protease K03100; COG: COG0681
FT                   Signal peptidase I; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20237"
FT                   /db_xref="GOA:A9MGX6"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGX6"
FT                   /inference="protein motif:HMMPanther:IPR000223"
FT                   /inference="protein motif:HMMPfam:IPR006198"
FT                   /inference="protein motif:HMMTigr:IPR000223"
FT                   /inference="protein motif:ScanRegExp:IPR000223"
FT                   /inference="protein motif:superfamily:IPR011056"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217564.1"
FT                   /protein_id="ABX20237.1"
FT                   /translation="MANMFALILVIATLVTGILWCVDKFVFAPKRRARQAAAQTATGDA
FT                   LDNATLNKVAPKPGWLETGASVFPVLAIVLIVRSFLYEPFQIPSGSMMPTLLIGDFILV
FT                   EKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKITYDPIAK
FT                   EVTIQPGCSSGQACENALPVTYSNVEPSDFVQTFARRNGGEATSGFFEVPLNETKENGI
FT                   RLTERKETLGDVTHRILMVPIAQDQLGMYYQQPGQPLATWVVPPGQYFMMGDNRDNSAD
FT                   SRYWGFVPEANLVGKAVAIWMSFDKQEGEWPTGVRLSRIGGIH"
FT   misc_feature    291944..292155
FT                   /note="rncO; Rfam score 223.8; SARI_00297"
FT                   /inference="nucleotide motif:Rfam:RF00552"
FT   gene            292778..293683
FT                   /locus_tag="SARI_00298"
FT   CDS_pept        292778..293683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A2554 1.9e-73 GTPase; COG: COG1159
FT                   GTPase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20238"
FT                   /db_xref="GOA:A9MGX7"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGX7"
FT                   /inference="protein motif:HMMPfam:IPR002917"
FT                   /inference="protein motif:HMMPfam:IPR004044"
FT                   /inference="protein motif:HMMTigr:IPR005225"
FT                   /inference="protein motif:HMMTigr:IPR005289"
FT                   /inference="protein motif:HMMTigr:IPR005662"
FT                   /inference="similar to AA sequence:INSD:AAO68002.1"
FT                   /protein_id="ABX20238.1"
FT                   /translation="MSIEKTYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRH
FT                   RIVGIHTEGPYQAIYVDTPGLHIEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPD
FT                   DEMVLNKLRDGKAPVILAVNKVDNVQEKADLLPHLQFLASQMSFLDIVPISAETGMNVD
FT                   TIASIVRKHLPEATHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFV
FT                   TNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLELWVKV
FT                   KSGWADDERALRSLGYVDDL"
FT   gene            293755..294423
FT                   /locus_tag="SARI_00299"
FT   CDS_pept        293755..294423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00299"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1381 Recombinational DNA repair protein
FT                   (RecF pathway); Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20239"
FT                   /db_xref="GOA:A9MGX8"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGX8"
FT                   /inference="protein motif:HMMPfam:IPR003717"
FT                   /inference="protein motif:HMMTigr:IPR003717"
FT                   /inference="similar to AA sequence:INSD:AAO68003.1"
FT                   /protein_id="ABX20239.1"
FT                   /translation="MLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLRYSGRGE
FT                   VKTLRSAEAVSLALPLNGITLYSGLYINELLSRVLEYETRFSELFFDYLNCIQALAGTT
FT                   GSPEPVLRRFELALLGHLGYGVNFTHCAGSGEQVDDTMTYRYREEKGFIASVVIDNNTF
FT                   TGRHLKALEAREFPDVDTLRAAKRFTRMALKPYLGGKPLKSRELFRRFMPKRTVKMKKD
FT                   "
FT   gene            294435..295166
FT                   /locus_tag="SARI_00300"
FT   CDS_pept        294435..295166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2573 4.4e-122 pdxJ; carries out
FT                   condensation and ring closure step after PdxA in pyridoxine
FT                   biosynthesis K03474; COG: COG0854 Pyridoxal phosphate
FT                   biosynthesis protein; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20240"
FT                   /db_xref="GOA:A9MGX9"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGX9"
FT                   /inference="protein motif:BlastProDom:IPR004569"
FT                   /inference="protein motif:HMMPfam:IPR004569"
FT                   /inference="protein motif:HMMTigr:IPR004569"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217560.1"
FT                   /protein_id="ABX20240.1"
FT                   /translation="MAELLLGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVH
FT                   LREDRRHISDRDVRILRQTLHTRMNLEMAVTEEMLAIAVETRPHFCCLVPEKRQEVTTE
FT                   GGLDVAGQRDKMRDACSRLAAAGIQVSLFIDADEAQINAAAEVGAPFIEIHTGCYANAK
FT                   TDAEQSKELARIASAATLAVRLGLKVNAGHGLTYHNVKAIAALPEMHELNIGHAIIGRA
FT                   VMSGLKEAVAEMKRLMLEARG"
FT   gene            295166..295561
FT                   /locus_tag="SARI_00301"
FT   CDS_pept        295166..295561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2823 3.8e-61 acpS; holo-[acyl-carrier
FT                   protein] synthase K00997; COG: COG0736 Phosphopantetheinyl
FT                   transferase (holo-ACP synthase); Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20241"
FT                   /db_xref="GOA:A9MGY0"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGY0"
FT                   /inference="protein motif:BlastProDom:IPR004568"
FT                   /inference="protein motif:HMMPfam:IPR008278"
FT                   /inference="protein motif:HMMTigr:IPR002582"
FT                   /inference="protein motif:HMMTigr:IPR004568"
FT                   /inference="protein motif:superfamily:IPR008278"
FT                   /inference="similar to AA sequence:INSD:AAV76310.1"
FT                   /protein_id="ABX20241.1"
FT                   /translation="MAILGLGTDIVEISRIEAVISRSGERLARRVLSANEWAIWETHQQ
FT                   PVRFLAKRFAVKEAAAKAFGTGIRNGLAFNQFEVFNDELGKPRLRLWGEALTLAEKLGV
FT                   THMHVTLADERHYACATVILESQISAG"
FT   gene            complement(295642..295911)
FT                   /locus_tag="SARI_00302"
FT   CDS_pept        complement(295642..295911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00302"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0708 2.0e-06 fdxH; formate
FT                   dehydrogenase, beta subunit K00124; COG: COG1145
FT                   Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20242"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGY1"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="similar to AA sequence:INSD:CAD02778.1"
FT                   /protein_id="ABX20242.1"
FT                   /translation="MALLITKKCINCDMCEPECPNEAISMGDSIYEINSDKCTECVGHY
FT                   ETPTCQKVCPIPNTILQDPTHVETEEQLWDKFVLMHHADKLQAS"
FT   gene            complement(295967..296815)
FT                   /locus_tag="SARI_00303"
FT   CDS_pept        complement(295967..296815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00303"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I1550 1.0e-22
FT                   glucokinase/transcriptional regulator, RpiR family, fusion
FT                   K00845; COG: COG1737 Transcriptional regulators; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20243"
FT                   /db_xref="GOA:A9MGY2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGY2"
FT                   /inference="protein motif:HMMPfam:IPR000281"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="similar to AA sequence:INSD:AAX66473.1"
FT                   /protein_id="ABX20243.1"
FT                   /translation="MNCLIRIRQHYPDLAQSDKKLADYLLAQPDTARHLSSQQLAAEAG
FT                   ISQSSVVKFAQKLGFKGFPALKLAISEALASNPNPHSIPVHNQIRGDDPMRLVGEKLIK
FT                   ENVAAMHATLDVNSEEKLLESVAMLRHARRIVITGMGASGLVAQNFAWKLLKIGVNAGV
FT                   ERDMHALLSTVQALAPGDLLLAISYSGERRELKLAADETLRTGAKILAITGFSPNALQQ
FT                   RATRCLYTIAEEQATRSAAISSTHAQMMLTDLLFMALVQQDLERAPERIRHSEALVKKL
FT                   I"
FT   gene            296931..297824
FT                   /locus_tag="SARI_00304"
FT   CDS_pept        296931..297824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_2606 1.0e-05
FT                   glucosamine--fructose-6-phosphate aminotransferase,
FT                   isomerizing K00820; COG: COG2103 Predicted sugar phosphate
FT                   isomerase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00304"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20244"
FT                   /db_xref="GOA:A9MGY3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGY3"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="protein motif:HMMTigr:IPR005488"
FT                   /inference="protein motif:ScanRegExp:IPR005486"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZN25"
FT                   /protein_id="ABX20244.1"
FT                   /translation="MNLGALVSETRNPQTMDLDALPTPELVKRFNEQDTLVAEAVKATL
FT                   TEVARAVDAAAAALQSGGRIIYMGAGTSGRLGVLDASECPPTFGVPHGLVVGLIAGGPG
FT                   ALLKAVEGAEDSQQAGEDDLVALNLQEEDLVVGLAASGRTPYVIGGLRYARQSGCTTVA
FT                   VSCNPDSPIAREANIAISPVVGPEALTGSTRLKSGTAQKMVLNMISTGAMVKFGKVYQN
FT                   LMVDMKATNVKLVDRACRMVVEATGISREEAETLLKQTDFEVKPAILMALTGLDAAAAR
FT                   EKLAAHQGFLRAALEH"
FT   gene            298009..298314
FT                   /locus_tag="SARI_00305"
FT   CDS_pept        298009..298314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2565 3.6e-27 yfeV; putative
FT                   phosphotransferase system IIB components K02809:K02810;
FT                   COG: COG1264 Phosphotransferase system IIB components;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20245"
FT                   /db_xref="GOA:A9MGY4"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGY4"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457099.1"
FT                   /protein_id="ABX20245.1"
FT                   /translation="MITDIIILKRPDIVGNVSVYYSNLLGLFMWSWCKRMAITRCFPFW
FT                   RWRALISYWKVVKVITFGISLTIVAGKVVFYLLGYLIAVIAGVIFTWLLGFNDPEE"
FT   gene            298318..298953
FT                   /locus_tag="SARI_00306"
FT   CDS_pept        298318..298953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00306"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0560 Phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20246"
FT                   /db_xref="GOA:A9MGY5"
FT                   /db_xref="InterPro:IPR006435"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGY5"
FT                   /inference="protein motif:HMMTigr:IPR006435"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461504.1"
FT                   /protein_id="ABX20246.1"
FT                   /translation="MVSQERRVVFFDLDGTLHQQDMFGSFLRYLLRRQPLNALLVLPLL
FT                   PVIGLGLLAKGRAARWPMSLLLWGCTFGHSETRLQAHQADFVRWFRANVTAFPVVQERL
FT                   TTYLLSSDADIWLITGSPQSLVEQVYFDTPWLPRVNLIASQMARRYGGWVLTVRCLGHE
FT                   KVAQLERKIGTPLRLYSGYSDSKQDNPLLYFCQHRWRVTPHGELQQLE"
FT   gene            298978..299508
FT                   /locus_tag="SARI_00307"
FT   CDS_pept        298978..299508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0289 3.5e-90 yfhC; hypothetical protein
FT                   K01500; COG: COG0590 Cytosine/adenosine deaminases; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00307"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20247"
FT                   /db_xref="GOA:A9MGY6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGY6"
FT                   /inference="protein motif:HMMPfam:IPR002125"
FT                   /inference="protein motif:ScanRegExp:IPR002125"
FT                   /inference="similar to AA sequence:INSD:CAD02770.1"
FT                   /protein_id="ABX20247.1"
FT                   /translation="MPPAFITGVTSLSDVELDHEYWMRHALTLAKRAWDEREVPVGAVL
FT                   VHNHRVIGEGWNRPIGRHDPTAHAEIMALRQGGLVLQNYRLLDTTLYVTLEPCVMCAGA
FT                   MVHSRIRRVVFGARDAKTGAAGSLIDVLHHPGMNHRVEIIEGVLHDECAMLLSDFFRMR
FT                   RQEIKALKKAARA"
FT   gene            complement(299544..301088)
FT                   /locus_tag="SARI_00308"
FT   CDS_pept        complement(299544..301088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2878 1.1e-237 yfhD; putative
FT                   periplasmic binding transport protein K01238; COG: COG4623
FT                   Predicted soluble lytic transglycosylase fused to an
FT                   ABC-type amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20248"
FT                   /db_xref="GOA:A9MGY7"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023703"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGY7"
FT                   /inference="protein motif:HMMPfam:IPR008258"
FT                   /inference="protein motif:HMMSmart:IPR001638"
FT                   /inference="protein motif:ScanRegExp:IPR000189"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461502.1"
FT                   /protein_id="ABX20248.1"
FT                   /translation="MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHVAAIQARGVL
FT                   RVSTIDSPLTYAVVNGKKYGLDYELAQQFANYLGVKLKITVRQNISQLFDDLDNGNADL
FT                   LAAGLVYDSARVKKYQPGPMYYSVSQQLVYRVGQYRPRSLATVTENQLTIAPGHVVVND
FT                   LQRLKETKFPDLSWKVDDKKGSTTLLEDVINGKLDYTIADSVAISLFQRVHPELAVALD
FT                   VTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFL
FT                   RAVDNVLPELEALFKKYAKEIDWRLLAAISYQESHWDPQATSPTGVRGLMMLTKNTAQS
FT                   LGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARALTV
FT                   KTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEK
FT                   EKQEAEAMKLAQDYPAASPEELNKAPFPFISFLSQSSGYLTHSPSLLFTPQKKEEK"
FT   gene            complement(301093..301230)
FT                   /locus_tag="SARI_00309"
FT   CDS_pept        complement(301093..301230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20249"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGY8"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217548.1"
FT                   /protein_id="ABX20249.1"
FT                   /translation="MSYGAAIDANKLPTGALLRKMPLIDDLSIAAQHLFQPEATHDPEN
FT                   "
FT   gene            301344..305231
FT                   /locus_tag="SARI_00310"
FT   CDS_pept        301344..305231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2565 0. purG;
FT                   phosphoribosylformylglycinamidine synthetase K01952; COG:
FT                   COG0046 Phosphoribosylformylglycinamidine (FGAM) synthase,
FT                   synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20250"
FT                   /db_xref="GOA:A9MGY9"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGY9"
FT                   /inference="protein motif:HMMPfam:IPR000728"
FT                   /inference="protein motif:HMMPfam:IPR010918"
FT                   /inference="protein motif:HMMTigr:IPR010073"
FT                   /protein_id="ABX20250.1"
FT                   /translation="MMEILRGSPALSAFRINKLLARFQAARLQVHNIYAEYVHFADLNA
FT                   PLNDNEQAQLTRLLQYGPALSSHTPTGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVD
FT                   RLERGVAYYIEASTLTAEQWRQVAAELHDRMMETVFSSLTDAEKLFIHHQPAPVSSVDL
FT                   LAEGRQALIAANLRLGLALAEDEIDYLQAAFTKLGRNPNDIELYMFAQANSEHCRHKIF
FT                   NADWIIDGKPQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMEGSAVGRYFADHNTGRYD
FT                   FHQEPAHILMKVETHNHPTAISPWPGAATGSGGEIRDEGATGRGAKPKAGLVGFSVSNL
FT                   RIPGFEQPWEEDFGKPERIVTALDIMTEGPLGGAAFNNEFGRPALTGYFRTYEEKVNSH
FT                   NGEELRGYHKPIMLAGGIGNIRADHVQKGEIVVGAKLIVLGGPAMNIGLGGGAASSMAS
FT                   GQSDADLDFASVQRDNPEMERRCQEVIDRCWQLGDANPILFIHDVGAGGLSNAMPELVS
FT                   DGGRGGKFELRDILSDEPGMSPLEIWCNESQERYVLAVAADQLPLFDKLCKRERAPYAV
FT                   IGEATEEQHLSLHDNHFDNQPIDLPLDVLLGKTPKMTRDVQTLKAKGDALNRADITIAD
FT                   AVNRVLHLPTVAEKTFLVTIGDRTVTGMVARDQMVGPWQVPVADCAVTTASLDSYYGEA
FT                   MSIGERAPVALLDFAASARLAVGEALTNIAATQIGDIKRIKLSANWMAAAGHPGEDAGL
FT                   YDAVKAIGEEMCPQLGLTIPVGKDSMSMKTRWQEGNEQREMTSPLSLVISAFARVEDVR
FT                   HTITPQLSTEDNVLLLIDLGKGHSALGATALAQVYRQLGDTPADVRDVAQLKGFYEAIQ
FT                   ALVAARKLLAYHDRSDGGLLVTLAEMAFAGHCGVQVDIAALGDDHLAALFNEELGGVIQ
FT                   VRAEDRDAVEALLAQYGLADCVHYLGQALAGDRFVITAHDQTVFSESRTTLRVWWAETT
FT                   WQMQRLRDNPQCADQEHEEKANDADPGLNVKLSFDINEDIAAPYIATGARPKVAVLREQ
FT                   GVNSHVEMAAAFHRAGFDAIDVHMSDLLGGRIGLGNFQALVACGGFSYGDVLGAGEGWA
FT                   KSILFNHRVRDEFETFFHRPQTLALGVCNGCQMMSNLRELIPGSELWPRFMRNHSDRFE
FT                   ARFSLVEVTQSPSLLLQGMVGSQMPIAVSHGEGRVEVRDDAHLAALESKGLVALRYVDN
FT                   FGKVTETYPANPNGSPNGITAVTNENGRVTIMMPHPERVFRTVANSWHPENWGEDSPWM
FT                   RIFRNARKQLG"
FT   gene            complement(305504..305652)
FT                   /locus_tag="SARI_00311"
FT   misc_RNA        complement(305504..305652)
FT                   /locus_tag="SARI_00311"
FT                   /product="tke1 RNA"
FT                   /note="Rfam score 177.53"
FT                   /inference="nucleotide motif:Rfam:RF00128"
FT   gene            305792..307177
FT                   /locus_tag="SARI_00312"
FT   CDS_pept        305792..307177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2559 8.7e-236 yfhK; putative sensory
FT                   kinase in regulatory system K07711; COG: COG0642 Signal
FT                   transduction histidine kinase; Psort location:
FT                   CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20251"
FT                   /db_xref="GOA:A9MGZ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGZ0"
FT                   /inference="protein motif:FPrintScan:IPR004358"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMPfam:IPR003661"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR003661"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="protein motif:superfamily:IPR009082"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217546.1"
FT                   /protein_id="ABX20251.1"
FT                   /translation="MLAFLLILLPLLVLAWQAWQSLNALSDQAAVTNRSTLIDARRSEA
FT                   MTNVALEMERSYRQYCVLDDPTLAKVYQSQRKRYSDMLDAHAGVLPDDKLYQALRQDLN
FT                   ALAQLQCKDSGPEAAAAARLEAFANANTEMVQATRTVVYSRGQQLQQEIAERGQFFGWQ
FT                   ALVLFLVSLAMVLLFTRMIIGPVKGIERMINRLGEGHSLGNTVTFTGPRELRSVGQRII
FT                   WLSERLAWLESQRHQFLRHLSHELKTPLASMREGTELLADRVVGPLTPEQKEVVDILDV
FT                   SSRNLQKLIEQLLDYNRKLVDSATELETVDIAPLVDMVVSAHSLPARAKMMHTDVDLEV
FT                   ERCIAEPMLLMSVLDNLYSNAVHYGAESGNICIRSRSQGSMVYIDVINSGEPIPQTESE
FT                   MIFEPFFQGSHQRKGAVKGSGLGLSIARDCIRRMQGEIRLVDANAQEVCFRISLPLPAS
FT                   DKH"
FT   unsure          306884..307026
FT                   /locus_tag="SARI_00312"
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            307179..307937
FT                   /locus_tag="SARI_00313"
FT   CDS_pept        307179..307937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00313"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06210 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00313"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20252"
FT                   /db_xref="GOA:A9MHH4"
FT                   /db_xref="InterPro:IPR025262"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHH4"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804169.1"
FT                   /protein_id="ABX20252.1"
FT                   /translation="MNLSLVSMPHVLVQTIKRCLFRGVIPASISCLALAACVPYTVQQR
FT                   PGSAAQDKLPHYQLADYLPTACADIWSLRGQSVDTNPLYWLRAIDCAERLMPVQSRAEA
FT                   RALTDDNWQTAFRRGILLADAKITPPERRAIVSRLEALSAQIPAQVRPVYQIWHDGQAL
FT                   QLALSAERQRYSKLQQTSDSELDALRQQQQALQTQLELTTRKLESLTDIERQLSTRKPA
FT                   ENYNADTSHTNDKPATSEDGAAPSQDEVTP"
FT   gene            307934..309271
FT                   /locus_tag="SARI_00314"
FT   CDS_pept        307934..309271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2502 1.2e-82 atoC; acetoacetate
FT                   metabolism regulatory protein AtoC K07714; COG: COG2204
FT                   Response regulator containing CheY-like receiver, AAA-type
FT                   ATPase, and DNA-binding domains; Psort location:
FT                   Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20253"
FT                   /db_xref="GOA:A9MHH5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHH5"
FT                   /inference="protein motif:BlastProDom:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR002078"
FT                   /inference="protein motif:HMMSmart:IPR001789"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR002078"
FT                   /inference="protein motif:superfamily:IPR011006"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461497.1"
FT                   /protein_id="ABX20253.1"
FT                   /translation="MISRKPAHLLLVDDDPGLLKLLGMRLASEGYSVVTAESGQEGLRI
FT                   LNREKVDLVISDLRMDEMDGMQLFTEIQKVQPGMPVIILTAHGSIPDAVAATQKGVFSF
FT                   LTKPIDKDALYKAIDEALEQTAPATDDSWRKPIVTRSPLMLRLLEQAHMVAQSDVSVLI
FT                   NGQSGTGKEIFAQAIHNASPRSNKPFVAINCGALPEQLLESELFGHARGAFTGAVSNRE
FT                   GLFQAAEGGTLFLDEIGDMPTPLQVKLLRVLQERKVRPLGSNRDIDIDVRIISATHRDL
FT                   PKAMARGEFREDLYYRLNVVSLKIPALAERTEDIPLLANHLLRQSAQRHKPFVRAFSTD
FT                   AMKRLMTASWPGNVRQLVNVIEQCVALTSSPVISDALVEQALEGENTALPTFAEARNQF
FT                   ELNYLRKLLQITKGNVTHAARMAGRNRTEFYKLLSRHELDANDFKE"
FT   gene            309348..309686
FT                   /locus_tag="SARI_00315"
FT   CDS_pept        309348..309686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00315"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0347 Nitrogen regulatory protein PII; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20254"
FT                   /db_xref="GOA:A9MHH6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHH6"
FT                   /inference="protein motif:BlastProDom:IPR002187"
FT                   /inference="protein motif:FPrintScan:IPR002187"
FT                   /inference="protein motif:Gene3D:IPR002187"
FT                   /inference="protein motif:HMMPfam:IPR002187"
FT                   /inference="protein motif:ScanRegExp:IPR002187"
FT                   /inference="protein motif:ScanRegExp:IPR002332"
FT                   /inference="similar to AA sequence:INSD:ABB67124.1"
FT                   /protein_id="ABX20254.1"
FT                   /translation="MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTEL
FT                   YRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRT
FT                   GEEDDAAI"
FT   unsure          309586..309763
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            complement(309735..311195)
FT                   /locus_tag="SARI_00316"
FT   CDS_pept        complement(309735..311195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00316"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3104 Dipeptide/tripeptide permease; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20255"
FT                   /db_xref="GOA:A9MHH7"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHH7"
FT                   /inference="protein motif:HMMPanther:IPR000109"
FT                   /inference="protein motif:HMMPanther:IPR005279"
FT                   /inference="protein motif:HMMPfam:IPR000109"
FT                   /inference="protein motif:HMMTigr:IPR005279"
FT                   /inference="protein motif:ScanRegExp:IPR000109"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461495.1"
FT                   /protein_id="ABX20255.1"
FT                   /translation="MKTPSQPRAIFYIVAIQIWEYFSFYGMRALLILYLTHQLGFNDSH
FT                   AINLFSAYASLVYVTPILGGWLADRLLGNRVAVITGALLMTLGHVVLGLESDSTLSLYA
FT                   ALAIIICGYGLFKSNISCLLGELYAPDDSRRDGGFSLLYAAGNIGSIAAPIACGLAAQW
FT                   YGWHVGFALAGVGMFIGLLIFLSGHRHFQQTRGVNRPALRAVKFALPTWSWLVLMLCVA
FT                   PVFFTLLLENNWSGYVLAIVCAFAAQLIARIMVKFPEHRRALWQIVLLMITGTLFWVLA
FT                   QQGGSSISLFIDRFVNRQWLHMTVPTALFQSVNAIAVMAAGVMLAWLSSPKESARSVLR
FT                   VWLKFAVGLALMGGGFMLLALNAHQARLDGQASMGMMIAGLAMMGFAELFIDPVAMAQI
FT                   TRLNLPGVTGVLTGIYMLATGAVANWLAGVVAQQTTESQISDTAVAAYGHFFSQMGEWT
FT                   LSCVALIVAIVGLRWLCNRTTSALPQGD"
FT   gene            complement(311251..313395)
FT                   /locus_tag="SARI_00317"
FT   CDS_pept        complement(311251..313395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0297 0. cadA; lysine decarboxylase
FT                   K01582; COG: COG1982 Arginine/lysine/ornithine
FT                   decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20256"
FT                   /db_xref="GOA:A9MHH8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHH8"
FT                   /inference="protein motif:HMMPfam:IPR000310"
FT                   /inference="protein motif:HMMPfam:IPR005308"
FT                   /inference="protein motif:HMMPfam:IPR008286"
FT                   /inference="protein motif:HMMPIR:IPR011193"
FT                   /inference="protein motif:ScanRegExp:IPR000310"
FT                   /inference="protein motif:superfamily:IPR008286"
FT                   /protein_id="ABX20256.1"
FT                   /translation="MNVIAIMNHMGVYFKEEPIRELHRALEGLNFRIVYPNDREDLLKL
FT                   IENNARLCGVIFDWDKYNLELCEEISKLNEYMPLYAFANSYSTLDVSLNDLRMQVRFFE
FT                   YALGAAADIAAKIRQNTDEYIDNILPPLTKALFKYVREGKYTFCTPGHMGGTAFQKSPV
FT                   GSIFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEAEEYIARVFNAERSYMVTNGTST
FT                   ANKIVGMYSAPAGSTVLIDRNCHKSLTHLMMMSDITPIYFRPTRNAYGILGGIPQSEFQ
FT                   HATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDYIKKTLDVKSIHFDSAWVPYTNFS
FT                   PIYEGKCGMSGDRVEGKIIYETQSTHKLLAAFSQASMIHVKGDINEETFNEAYMMHTTT
FT                   SPHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIKRLKSESDGWFFDVWQPEH
FT                   IDGAECWPLRSDSAWHGFKNIDNEHMYLDPIKVTILTPGMKKDGTMDEFGIPASLVAKY
FT                   LDERGIIVEKTGPYNLLFLFSIGIDKTKALSLLRALTEFKRAFDLNLRVKNILPALYRE
FT                   APEFYENMRIQELAQNIHKLVEHHNLPDLMYRAFEVLPKMVMTPYTAFQKELHGETEEV
FT                   YLEEMVGRVNANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLCEIGAHYPGFETDIH
FT                   GAYRQADGRYTVKVLKENTK"
FT   gene            complement(313478..314815)
FT                   /locus_tag="SARI_00318"
FT   CDS_pept        complement(313478..314815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0120 4.2e-10 aroP; aromatic amino
FT                   acid transport protein AroP K03293; COG: COG0531 Amino acid
FT                   transporters; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20257"
FT                   /db_xref="GOA:A9MHH9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHH9"
FT                   /inference="protein motif:HMMPanther:IPR002293"
FT                   /inference="protein motif:HMMPfam:IPR004841"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461493.1"
FT                   /protein_id="ABX20257.1"
FT                   /translation="MNMSSVKKIGLFACTGVVAGNMMGSGIALLPANLASIGGIAIWGW
FT                   VISIIGAMSLAYVYARLATKNPQQGGPIAYAGEISPAFGFQTGVLYYHANWIGNLAIGI
FT                   TAVSYLSTFFPALNNPIPAGIACIAIVWLFTFINMLGGAWVSRLTTIGLFLVLIPVVLT
FT                   AVAGWHWFDIATYHANWNTSTTTDSHAIVKSILLCLWAFVGVESAAVSTGMVKNPKRTV
FT                   PLATMLGTALAGIIYIAATQVIAGMFPASVMASSGAPFAISTSTILGGWAAPLVSAFTA
FT                   FACLTSLGSWMMLVGQAGVRAANDGNFPKIYGEIDKNGIPKKGLLLAAVKMTALMILIT
FT                   IMNSSGGKASDLFGELTGIAVLLTMLPYFYSCVDLIRFEGFNIRNSVSLICSVLGCAFC
FT                   FIALMGASSFELSGTFIVSLIILMFYGRKMHQRQNNDSENNTVEAL"
FT   gene            complement(315168..316706)
FT                   /locus_tag="SARI_00319"
FT   CDS_pept        complement(315168..316706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:RL2429 9.6e-10 cya; putative adenylate
FT                   cyclase K01768; COG: COG3710 DNA-binding winged-HTH
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00319"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20258"
FT                   /db_xref="GOA:A9MHI0"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="InterPro:IPR040970"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHI0"
FT                   /inference="protein motif:BlastProDom:IPR001867"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR001867"
FT                   /inference="similar to AA sequence:INSD:CAD02760.1"
FT                   /protein_id="ABX20258.1"
FT                   /translation="MQQPVVRIGEWLVTPSVNQISRQGRQITLEPRLIDLLMYFAHHPD
FT                   EVLSRDNIIDHVWMRTIVTNHVVTQSISELRKSLRDGGDSNAEYIVTVPKRGYKLTAPV
FT                   IWCEENSDEIDNASTSPSIASTLTEPTDVIPAAPPAAPPPLQASTKKARRPRIAAFWTW
FT                   FMFLLSLATLVVFIVMSVVDHNAAVTKTRLLLNPRDIDVRFEGGNSCNNWLSQESYAIG
FT                   LGGLITDLLNTYSTFMVHDKTNYRVNEPSSSGKTLTIQFVNQRHYRAQQCFMSVVLIDN
FT                   ADGSTMLDKRYFVTNTNQLSIQDDLFNSLSFVLTQPWPDRMREQLALFRTPQNTALMHF
FT                   YEARQLILSGDAQALSKASDILNGIIKETPDFKYAYEYKVLVDVLRQSQQPFDKKRMAA
FT                   LNEEFKEIDQIPGVKKTSVYYKIKTVDLLGKGDIDAAYEEINKSIELEMSWFNYVLLGK
FT                   VYEMKGENRLAADAYLTAFNLRPGENTLYWIENGVFQTSVQKIVPYLNSFLAED"
FT   gene            complement(316887..318077)
FT                   /locus_tag="SARI_00320"
FT   CDS_pept        complement(316887..318077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0310 9.4e-207 hmpA; flavohemoprotein
FT                   (haemoglobin-like protein) K05916; COG: COG1018 Flavodoxin
FT                   reductases (ferredoxin-NADPH reductases) family 1"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20259"
FT                   /db_xref="GOA:A9MHI1"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHI1"
FT                   /inference="protein motif:Gene3D:IPR012292"
FT                   /inference="protein motif:HMMPfam:IPR000971"
FT                   /inference="protein motif:HMMPfam:IPR001433"
FT                   /inference="protein motif:HMMPfam:IPR008333"
FT                   /inference="protein motif:superfamily:IPR009050"
FT                   /inference="similar to AA sequence:INSD:AAV76329.1"
FT                   /protein_id="ABX20259.1"
FT                   /translation="MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNM
FT                   SNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGTHLLA
FT                   TLDEMFSPGQAVLDAWGKAYGVLANVFINREAEIYHENASKNGGWEGTRPFRIVAKTPC
FT                   SALITSFEFEPVDGGTVAEYRPGQYLGVWLKPEGFTHQEIRQYSLTRKPDGKGYRIAVK
FT                   REDGGQVSNWLHNHASVGDVVHLAAPAGDFFMNVAADTPVSLISAGVGQTPMLAMLDTL
FT                   AKAQHTAQVNWFHAAENGEVHAFADEVRELGRTLPRFTAHTWYREPTETDHAQSVFDSE
FT                   GLMDLRQLEAAIRAPAMQFYLCGPVGFMQFAAKQLISLGVNNENIHYECFGPHKVL"
FT   gene            318133..318264
FT                   /locus_tag="SARI_00321"
FT   CDS_pept        318133..318264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20260"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHI2"
FT                   /protein_id="ABX20260.1"
FT                   /translation="MPLNCKWFFAALSCERNNVKNLHHKAEKKSVEIRNAPVQENLI"
FT   unsure          318252..318400
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            318396..319655
FT                   /locus_tag="SARI_00322"
FT   CDS_pept        318396..319655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2555 5.4e-220 glyA; serine
FT                   hydroxymethyltransferase K00600; COG: COG0112
FT                   Glycine/serine hydroxymethyltransferase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20261"
FT                   /db_xref="GOA:A9MHI3"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHI3"
FT                   /inference="protein motif:HMMPanther:IPR001085"
FT                   /inference="protein motif:HMMPfam:IPR001085"
FT                   /inference="protein motif:HMMPIR:IPR001085"
FT                   /inference="protein motif:ScanRegExp:IPR001085"
FT                   /inference="similar to AA sequence:INSD:AAX66455.1"
FT                   /protein_id="ABX20261.1"
FT                   /translation="MRMLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRV
FT                   MQAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQAN
FT                   FAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIIPYGIDASGKIDYDDMAKQ
FT                   AQEHKPKMIIGGFSAYSGVVDWARMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVPHA
FT                   HVVTTTTHKTLAGPRGGLILAKGGDEDLYKKLNSAVFPSAQGGPLMHVIAAKAVALKEA
FT                   MEPEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEADAALG
FT                   RANITVNKNSVPNDPKSPFVTSGIRIGSPAVTRRGFKEAEVKELAGWMCDVLDNINDEA
FT                   TIERVKTKVLDICARFPVYA"
FT   gene            319850..320989
FT                   /locus_tag="SARI_00323"
FT   CDS_pept        319850..320989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3355 7.8e-05 nupG; transport of
FT                   nucleosides, permease protein K03289; COG: COG0477
FT                   Permeases of the major facilitator superfamily; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20262"
FT                   /db_xref="GOA:A9MHI4"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHI4"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="protein motif:ScanRegExp:IPR001623"
FT                   /inference="similar to AA sequence:INSD:AAX66454.1"
FT                   /protein_id="ABX20262.1"
FT                   /translation="MALHSTRWLALSYFTYFFSYGIFLPFWSVWLKGLGLTPETIGLLL
FT                   GVGLVARFLGSLLIAPRVSNPSRLISALRVLALLTLVFALAFWAGTHVAWLMVVMVGFN
FT                   LFFSPLVPLTDALANTWQKQIILDYGRVRLWGSIAFVIGSALTGKLVSLYDYQAILALL
FT                   TLGVASMLLGMLLRPSVPPQGESRQQEGAGWSAWCILVTQSWRFLACVCLLQGAHAAYY
FT                   GFSAIYWQGAGYSASAVGYLWSLGVVAEVIIFALSKKLFRRFSARDLLLLSAVCGVVRW
FT                   GLMGWSTTLPWLIVIQILHCGTFTVCHLAAMRYIAARQGSEVIRLQAVYSAVAMGGSIA
FT                   IMTVFAGFLYQHLGCGVFWIMALVALPAIFLRPKVVAAS"
FT   gene            complement(320984..322261)
FT                   /locus_tag="SARI_00324"
FT   CDS_pept        complement(320984..322261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00324"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spz:M5005_Spy_1664 0.0080 PTS system, mannitol
FT                   (cryptic)-specific IIA component K00890; COG: COG3711
FT                   Transcriptional antiterminator; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20263"
FT                   /db_xref="GOA:A9MHI5"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHI5"
FT                   /inference="protein motif:HMMPfam:IPR011608"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461488.1"
FT                   /protein_id="ABX20263.1"
FT                   /translation="MMPTIAPPSVLSAPQRRCQILLTLFQPGQIATMEIFSALNGVDDD
FT                   IAREDLTETGLEIQRYHRLAITTCQNGCYRIEGTALDQRLCLLHWLRRGLRLCPTFVTQ
FT                   QFTPALKNALKQRGIARPLYDDINLHALINLCARRLQKPFENRDVQFLRLFLQYCLLQH
FT                   HAGITPAFNPVQQIWALSCAEYSLAQEIGRHWQRHVMQAAPLNEALFMALLFSMIRLPD
FT                   PIRDTHPRAQKLRLEVARLVLRFREKGNARFSDEQGLNDQLYVHLAQALNRSLFTIGID
FT                   NTLPEEFNRLYPRLVRTTREALAGFEAEYGIRFSDEEKGLVAVIFGAWLMQDNDLHEKQ
FT                   IVLLTDKNDALETHIEQQLRELTLLPLNIKRVSTLAFQKEGCPRGVALIVTPYATPLPL
FT                   FSPPLIHADRALTAHQQQQIRKILES"
FT   gene            322387..323025
FT                   /locus_tag="SARI_00325"
FT   CDS_pept        322387..323025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00325"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3683 ABC-type uncharacterized transport
FT                   system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20264"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="InterPro:IPR016537"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHI6"
FT                   /inference="protein motif:HMMPfam:IPR010412"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149645.1"
FT                   /protein_id="ABX20264.1"
FT                   /translation="MKPVKRSALTLFLAVLSFVAAAHPHSFIRLQTQVVSENQQFVALK
FT                   MRWTMDELTSADLLYDAGSAAPGSEIWKKLAAEVMANVLGQHYFTEAWRNGAKVKFKNR
FT                   PTEYGMTRDAHQAVLTFTLPLAEPQPLSGQTYTFSTFDPSYYVDMHYDQDSDVTMPEPL
FT                   REKCRIQVHTPAPGEEILRFAQSLDKEDAPPEDMDLGKQFAQTVTLQCQ"
FT   gene            323094..324002
FT                   /locus_tag="SARI_00326"
FT   CDS_pept        323094..324002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00326"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2215 ABC-type uncharacterized transport
FT                   system, permease component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20265"
FT                   /db_xref="GOA:A9MHI7"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHI7"
FT                   /inference="protein motif:HMMPfam:IPR011541"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217532.1"
FT                   /protein_id="ABX20265.1"
FT                   /translation="MLAGGLWIWQAWPQVMLKSALWQREVNQQLSALLKAVATHPERAG
FT                   GSLLVLSFMYGVLHALGPGHGKVVIATWLATHPSRLKSSIALTLAAALLQGLLAIGLVV
FT                   GVLTVLQLPARKLHLSGFWLEKVSYALVGGLGILLCWRAMKRLRALLRKPGFIAFTPRH
FT                   VHHEKCGCGHQHLPTREHLHSGDDWRARLMIVLSMGMRPCSGAIMVLLFSKVIGVFSWG
FT                   MASVLAMAAGTSLTITSLALLVHTFRALAVKLSGNKTPALWRLVGWSTLALAGGIILLI
FT                   AALVMWFSVPQPVGGLRPWRG"
FT   gene            complement(324003..325037)
FT                   /locus_tag="SARI_00327"
FT   CDS_pept        complement(324003..325037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0306 4.8e-180 asrC; anaerobic sulfite
FT                   reductase subunit C K00385; COG: COG2221 Dissimilatory
FT                   sulfite reductase (desulfoviridin), alpha and beta
FT                   subunits; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20266"
FT                   /db_xref="GOA:A9MHI8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR014261"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHI8"
FT                   /inference="protein motif:FPrintScan:IPR006066"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:HMMPfam:IPR005117"
FT                   /inference="protein motif:HMMPfam:IPR006067"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR006066"
FT                   /inference="protein motif:superfamily:IPR011255"
FT                   /inference="similar to AA sequence:INSD:AAX66450.1"
FT                   /protein_id="ABX20266.1"
FT                   /translation="MPIKENIMSIDIDIIKARAKNEYRLSKVRGEAMISVRIPGGILPA
FT                   HLLTVARDIAETWGNGQIHLTTRQKLAMPGIRYEDIDKVNAALEPFLREIEMELCDVQV
FT                   EDTKAGYLAIGGRNIVACQGNRICQKANTDTTGLSRRLEKLVYPSPYHLKTVIVGCPND
FT                   CAKASMADLGIIGVAKMRFTAERCIGCGACMKACSHHAVGCLALKNGKAVKEESACIGC
FT                   GECVLACPTLAWQRKPEQLWQVRLGGRTSKKTPRVGKLFLNWVTEEVIKQVIVNLYEFE
FT                   KEMLGGKPIYLHMGHLIDKGGYMRFKERVLRGVQLNPEAMVAERIYWAEDESVARMHLK
FT                   SAGH"
FT   gene            complement(325027..325740)
FT                   /locus_tag="SARI_00328"
FT   CDS_pept        complement(325027..325740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00328"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0256 1.7e-58 anaerobic sulfite
FT                   reductase subunit B; COG: COG0543 2-polyprenylphenol
FT                   hydroxylase and related flavodoxin oxidoreductases; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00328"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20267"
FT                   /db_xref="GOA:A9MHI9"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR014260"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHI9"
FT                   /inference="protein motif:FPrintScan:IPR001221"
FT                   /inference="protein motif:HMMPfam:IPR001433"
FT                   /inference="protein motif:HMMPfam:IPR008333"
FT                   /inference="protein motif:HMMPIR:IPR012165"
FT                   /inference="similar to AA sequence:INSD:AAL21443.1"
FT                   /protein_id="ABX20267.1"
FT                   /translation="MEVDFPAHWGQFVEVSLPRVGEAPISVSDCGNGWIDLLIRNVGKV
FT                   TSALFTLKEGDNVWLRGCYGNGYPVNTLRHKPLLVVAGGTGVAPVKGLMRYFVENPQEI
FT                   GQLDMILGYKNRDCVLYREEMATWRGKHNLVLTLDEGEADDRYQIGRVTDRLAELALSD
FT                   IDTMQAIVVGPPIMITFTVKMLLQKGLKPEQIWVDYERRMACSVGKCGHCRMGEVYVCT
FT                   DGPIFNYAVAQRFAD"
FT   gene            complement(325849..326895)
FT                   /locus_tag="SARI_00329"
FT   CDS_pept        complement(325849..326895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0257 5.9e-79 anaerobic sulfite
FT                   reductase subunit A K00437; COG: COG1145 Ferredoxin; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20268"
FT                   /db_xref="GOA:A9MHJ0"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR014259"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHJ0"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="protein motif:superfamily:IPR009051"
FT                   /inference="similar to AA sequence:SwissProt:P26474"
FT                   /protein_id="ABX20268.1"
FT                   /translation="MMAIKITPDEFSLLIQRLSKQWRVFAPSAEFRGGRFSDTDNIIYQ
FT                   QISGWRDLIWHEKSHMSPNTIITPITETLFYFDKDTIQIAGTDTSPIVIFARACDINAM
FT                   SRLDYMFLSNGNNSDYSYQLLREHIHFVLIECEESFENCFCVSMGTNKTDRYSAAMRFS
FT                   DEGALVSIRDPFIEAAIQGLGQEVDYTPSFVSENRETVVKPDSVCHDPQKIRDILTRHP
FT                   LWDAYDSRCISCGRCTTGCPTCTCYSVFDVAYDENPQRGERRRQWASCMVPGFSDMAGG
FT                   HGFREKPGERLRYRALHKVNDYKARNGIEHMCVGCGRCDDRCPQYIKFSLIINKMTAAV
FT                   QQALAEEA"
FT   gene            complement(327116..327910)
FT                   /locus_tag="SARI_00330"
FT   CDS_pept        complement(327116..327910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0320 1.5e-137 suhB; extragenic
FT                   suppressor protein SuhB K01092; COG: COG0483 Archaeal
FT                   fructose-1,6-bisphosphatase and related enzymes of inositol
FT                   monophosphatase family; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20269"
FT                   /db_xref="GOA:A9MHJ1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHJ1"
FT                   /inference="protein motif:BlastProDom:IPR000760"
FT                   /inference="protein motif:FPrintScan:IPR000760"
FT                   /inference="protein motif:HMMPfam:IPR000760"
FT                   /inference="protein motif:ScanRegExp:IPR000760"
FT                   /inference="similar to AA sequence:SwissProt:P58537"
FT                   /protein_id="ABX20269.1"
FT                   /translation="MLTIAVRAARKAGNVIAKNYETPDAVEASQKGSNDFVTNVDKAAE
FT                   AVIIDTIRKSYPQHTIITEESGEHVGTDQDVQWVIDPLDGTTNFIKRLPHFAVSIAVRI
FT                   KGRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQYAT
FT                   TYINIIGKLFTECADFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVREAGG
FT                   IVSDFTGGHNYLMTGNIVAGNPRVVKAMLANMRDELSDALKR"
FT   gene            328038..328766
FT                   /locus_tag="SARI_00331"
FT   CDS_pept        328038..328766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2545 5.6e-122 putative rRNA methylase
FT                   K02533; COG: COG0565 rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20270"
FT                   /db_xref="GOA:A9MHJ2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHJ2"
FT                   /inference="protein motif:BlastProDom:IPR001537"
FT                   /inference="protein motif:HMMPfam:IPR001537"
FT                   /inference="protein motif:HMMTigr:IPR004384"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457076.1"
FT                   /protein_id="ABX20270.1"
FT                   /translation="MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQ
FT                   AIALAAGASDVIGNAQIVDTLDEALTGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEA
FT                   TNTPVALVFGRERVGLTNDELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLAT
FT                   QENGDAEHEETPYPLVDDLERFYSHLEQTLLSTGFIRENHPGQVMNKLRRLFTRARPES
FT                   LELNILRGMLASIEQQNKGK"
FT   gene            328982..329476
FT                   /locus_tag="SARI_00332"
FT   CDS_pept        328982..329476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ama:AM656 1.7e-14 aminotransferase, class V
FT                   K04487; COG: COG1959 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20271"
FT                   /db_xref="GOA:A9MHJ3"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHJ3"
FT                   /inference="protein motif:BlastProDom:IPR000944"
FT                   /inference="protein motif:HMMPfam:IPR000944"
FT                   /inference="protein motif:HMMTigr:IPR000944"
FT                   /inference="protein motif:HMMTigr:IPR010242"
FT                   /inference="protein motif:ScanRegExp:IPR000944"
FT                   /inference="similar to AA sequence:INSD:AAV76341.1"
FT                   /protein_id="ABX20271.1"
FT                   /translation="MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQL
FT                   FSRLRKNGLVSSVRGPGGGYLLGKDAGSIAVGEVISAVDESVDATRCQGKGGCQGGDKC
FT                   LTHALWRDLSDRLTGFLNNITLGELVNNQEVLDVSGRQHTHDAPRANGRVQDAIDVKLR
FT                   A"
FT   gene            329657..330871
FT                   /locus_tag="SARI_00333"
FT   CDS_pept        329657..330871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2537 6.7e-213 nifS; putative
FT                   aminotransferase class-V K04487; COG: COG1104 Cysteine
FT                   sulfinate desulfinase/cysteine desulfurase and related
FT                   enzymes; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00333"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20272"
FT                   /db_xref="GOA:A9MHJ4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHJ4"
FT                   /inference="protein motif:HMMPfam:IPR000192"
FT                   /inference="protein motif:HMMTigr:IPR010240"
FT                   /inference="protein motif:ScanRegExp:IPR000192"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149654.1"
FT                   /protein_id="ABX20272.1"
FT                   /translation="MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGW
FT                   QAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEH
FT                   KAVLDTCRQLEREGFEVTYLAPQSNGIIDLKALEAAMRDDTILVSIMHVNNEIGVVQDI
FT                   ATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKP
FT                   RIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGI
FT                   KDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLR
FT                   ALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSI
FT                   EWAHH"
FT   gene            330899..331285
FT                   /locus_tag="SARI_00334"
FT   CDS_pept        330899..331285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_1354 9.8e-16 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase
FT                   K00566; COG: COG0822 NifU homolog involved in Fe-S cluster
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20273"
FT                   /db_xref="GOA:A9MHJ5"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHJ5"
FT                   /inference="protein motif:HMMPfam:IPR002871"
FT                   /inference="protein motif:HMMTigr:IPR011339"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149655.1"
FT                   /protein_id="ABX20273.1"
FT                   /translation="MAYSEKVIDHYENPRNVGSFDNNDDNVGSGMVGAPACGDVMKLQI
FT                   KVNDEGIIEDARFKTYGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIADELELPPVKI
FT                   HCSILAEDAIKAAIADYKSKREAK"
FT   gene            331314..331637
FT                   /locus_tag="SARI_00335"
FT   CDS_pept        331314..331637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00335"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0316 Uncharacterized conserved protein;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20274"
FT                   /db_xref="GOA:A9MHJ6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHJ6"
FT                   /inference="protein motif:BlastProDom:IPR000361"
FT                   /inference="protein motif:HMMPanther:IPR000361"
FT                   /inference="protein motif:HMMPfam:IPR000361"
FT                   /inference="protein motif:HMMTigr:IPR000361"
FT                   /inference="protein motif:HMMTigr:IPR011302"
FT                   /inference="protein motif:ScanRegExp:IPR000361"
FT                   /inference="similar to AA sequence:SwissProt:Q8XFZ8"
FT                   /protein_id="ABX20274.1"
FT                   /translation="MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFV
FT                   DEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGES
FT                   FHV"
FT   gene            331904..332419
FT                   /locus_tag="SARI_00336"
FT   CDS_pept        331904..332419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00336"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1076 DnaJ-domain-containing proteins 1"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20275"
FT                   /db_xref="GOA:A9MHJ7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHJ7"
FT                   /inference="protein motif:HMMPfam:IPR001623"
FT                   /inference="protein motif:HMMPfam:IPR012895"
FT                   /inference="protein motif:HMMSmart:IPR001623"
FT                   /inference="protein motif:HMMTigr:IPR004640"
FT                   /inference="protein motif:superfamily:IPR001623"
FT                   /inference="protein motif:superfamily:IPR009073"
FT                   /inference="similar to AA sequence:INSD:AAL21434.1"
FT                   /protein_id="ABX20275.1"
FT                   /translation="MDYFTLFGLPASYHIDTQALSLRFQDLQRQYHPDKFANGTQAQHL
FT                   AAVQQSATINQAWQTLRHPLTRAEYLLSLHGFDLASEQHTVRDTAFLMEQLTLREELDD
FT                   IEQTKDDARLESFIKRVQKMFDTRLQQMVTQLDNAAWGEAADTVRKLRFLDKLRSSADQ
FT                   LEEKLLDF"
FT   gene            332432..334282
FT                   /locus_tag="SARI_00337"
FT   CDS_pept        332432..334282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2848 8.6e-300 hscA; chaperone
FT                   protein HscA K04044; COG: COG0443 Molecular chaperone;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20276"
FT                   /db_xref="GOA:A9MHJ8"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHJ8"
FT                   /inference="protein motif:BlastProDom:IPR013126"
FT                   /inference="protein motif:FPrintScan:IPR001023"
FT                   /inference="protein motif:HMMPanther:IPR001023"
FT                   /inference="protein motif:HMMPfam:IPR013126"
FT                   /inference="protein motif:HMMTigr:IPR010236"
FT                   /inference="protein motif:ScanRegExp:IPR013126"
FT                   /protein_id="ABX20276.1"
FT                   /translation="MALLQISEPGLSAAPHQRRLAAGIDLGTTNSLVATVRSGQAETLP
FT                   DHEGRHLLPSVVHYQQQGHTVGYAARDNAAQDTANTISSVKRMMGRSLADIQSRYPHLP
FT                   YRFQASENGLPMIETAAGLLNPVRVSADILKALAARASESLSGELDGVVITVPAYFDDA
FT                   QRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLDSGKEGVIAVYDLGGGTFDISILRLSC
FT                   GVFEVLATGGDSALGGDDFDHLLADYIREQAGIADRSDNRVQRELLDAAIAAKIALSDA
FT                   DTVRVNVAGWQGEITREQFNDLIAALVKRTLLACRRALKDADVDPQEVLEVVMVGGSTR
FT                   VPLVRERVGEFFGRTPLTAIDPDKVVAIGAAIQADILVGNKPDSEMLLLDVIPLSLGLE
FT                   TMGGLVEKVIPRNTTIPVARAQDFTTFKDGQTAMSIHVMQGERELAQDCRSLARFALRG
FT                   IPALPAGGAHIRVTFQVDADGLLSVTAMEKSTGIEASIQVKPSYGLTDSEIASMIKDSM
FT                   SFAEQDVKARMLAEQKVEAARVLESLTGALTADAALLSAAERQCIDDAAAHLNAVAQGD
FT                   DVDAIEQAIKNVDKQTQEFAARRMDQSVRRALKGHSVDEV"
FT   gene            334284..334619
FT                   /locus_tag="SARI_00338"
FT   CDS_pept        334284..334619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2847 2.2e-56 fdx; ferredoxin,
FT                   2Fe-2S K04755; COG: COG0633 Ferredoxin; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20277"
FT                   /db_xref="GOA:A9MHJ9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR011536"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHJ9"
FT                   /inference="protein motif:Gene3D:IPR012675"
FT                   /inference="protein motif:HMMPfam:IPR001041"
FT                   /inference="protein motif:HMMTigr:IPR011536"
FT                   /inference="protein motif:ScanRegExp:IPR001055"
FT                   /inference="protein motif:superfamily:IPR001041"
FT                   /inference="similar to AA sequence:INSD:AAO68042.1"
FT                   /protein_id="ABX20277.1"
FT                   /translation="MPKIVILPHQDLCPDGAVLEAQTGETILDVALRNGIEIEHACEKS
FT                   CACTTCHCIVREGFDSLPESSEEEDDMLDKAWGLEPESRLSCQARVTDDDLVIEIPRYT
FT                   INHAREH"
FT   gene            334631..334831
FT                   /locus_tag="SARI_00339"
FT   CDS_pept        334631..334831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00339"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2975 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20278"
FT                   /db_xref="GOA:A9MHK0"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHK0"
FT                   /inference="protein motif:HMMPfam:IPR007479"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457068.1"
FT                   /protein_id="ABX20278.1"
FT                   /translation="MGLKWTDSREIGEALYDAYPDVDPKTVRFTDLHQWICELDDFDDD
FT                   PNASNEKILEAILLVWLDEAE"
FT   gene            335080..336363
FT                   /locus_tag="SARI_00340"
FT   CDS_pept        335080..336363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2536 6.7e-229 pepB; peptidase B K07751;
FT                   COG: COG0260 Leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20279"
FT                   /db_xref="GOA:A9MHK1"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR008330"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHK1"
FT                   /inference="protein motif:HMMPfam:IPR000819"
FT                   /inference="protein motif:HMMPIR:IPR008330"
FT                   /inference="protein motif:ScanRegExp:IPR000819"
FT                   /inference="similar to AA sequence:INSD:AAL21430.1"
FT                   /protein_id="ABX20279.1"
FT                   /translation="MTEAMNITLSTQPADARWGDKATYSINNDGITLHLNGNDDLGLIQ
FT                   RAARKIDGLGIKQVALTGEGWDIERCWAFWAGYKGPKGVRTVMWPDLDDAQRQELDNRL
FT                   TIIDWVRDTINAPAEELGPEQLAQRAVDLLCSVACDHVTYRITKGEDLREQNYMGLHTV
FT                   GRGSERSPVLLALDYNPTGDKDAPVYACLVGKGITFDSGGYSIKQSAFMDSMKSDMGGA
FT                   ATVTGALAFAITRGLNKRVKLFLCCADNLISGNAFKLGDIIRYRNGKNVEVMNTDAEGR
FT                   LVLADGLIDASAQHPQLIIDMATLTGAAKTALGNDYHALFSFDDTLAGRLLSSAAQENE
FT                   PFWRLPLAEFHRNQLPSNFAELNNTGSAAYPAGASTAAGFLSHFVENYREGWLHIDCSA
FT                   TYRKAPVEQWAAGATGLGVRTIANLLTA"
FT   gene            336470..337246
FT                   /locus_tag="SARI_00341"
FT   CDS_pept        336470..337246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00341"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06208 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20280"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="InterPro:IPR027945"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHK2"
FT                   /inference="protein motif:HMMPfam:IPR009839"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217517.1"
FT                   /protein_id="ABX20280.1"
FT                   /translation="MSEIKNELEILLEKAATEPAHRPAFFRTLLESTVWVPGSAAEGEA
FT                   IVEDSALDLQHWEKEDGTTVIPFFTSLEALQQAVEDEQAFVVMPVRTLFEMTLGETLFL
FT                   NAKLPTGKEFMPREISLLLGEEGSPLSTQEVLEGGESLILSEVAEPPSQMIDSLTTLFK
FT                   TIKPVKRAFLCAIKEHADAQPNLLIGIEADGDIEEIIHAAGNVATDTLPGDEPIDICQV
FT                   RKGEQGISHFITEHIAPFYERRWGGFLRDFKQNRII"
FT   gene            complement(337250..337545)
FT                   /locus_tag="SARI_00342"
FT   misc_RNA        complement(337250..337545)
FT                   /locus_tag="SARI_00342"
FT                   /product="RyfA RNA"
FT                   /note="Rfam score 323.14"
FT                   /inference="nucleotide motif:Rfam:RF00126"
FT   gene            337629..337835
FT                   /locus_tag="SARI_00343"
FT   CDS_pept        337629..337835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20281"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHK3"
FT                   /protein_id="ABX20281.1"
FT                   /translation="MVCLRCYGNKACWKGREPDQHKKTAQLSGFFVACLNRIYVDSFQI
FT                   SLNCRPDKRERHPAWQILSGFNR"
FT   gene            complement(337815..338669)
FT                   /locus_tag="SARI_00344"
FT   CDS_pept        complement(337815..338669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0323 4.2e-149 sseA; putative thiosulfate
FT                   sulfurtransferase K01010; COG: COG2897 Rhodanese-related
FT                   sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20282"
FT                   /db_xref="GOA:A9MHK4"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHK4"
FT                   /inference="protein motif:HMMPfam:IPR001763"
FT                   /inference="protein motif:HMMSmart:IPR001763"
FT                   /inference="protein motif:ScanRegExp:IPR001307"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457064.1"
FT                   /protein_id="ABX20282.1"
FT                   /translation="MEMPMTTAYFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGE
FT                   YRAGHIPGALFFDIEALSDHASPLPHMMPRPEAFAVAMRELGVRQDKHLVIYDEGNLFS
FT                   APRAWWMLRTFGAEKVSILAGGLAGWQRDEWLLREGDEAHEEGEFEAKFTPQAVVRLTD
FT                   VLLASHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTELVFEGELKTTDE
FT                   LNEVFFSHGVSFDRPIIASCGSGVTAAVVVLALATLDVPDVTLYDGAWSEWGARTDLPV
FT                   EPA"
FT   gene            338866..343800
FT                   /locus_tag="SARI_00345"
FT   CDS_pept        338866..343800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00345"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2373 Large extracellular alpha-helical
FT                   protein; Psort location: CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20283"
FT                   /db_xref="GOA:A9MHK5"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR040639"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHK5"
FT                   /inference="protein motif:HMMPfam:IPR002890"
FT                   /inference="protein motif:HMMPfam:IPR011625"
FT                   /inference="protein motif:superfamily:IPR008930"
FT                   /protein_id="ABX20283.1"
FT                   /translation="MKHLRVVACIIMLALAGCDNNDKIAPTTKNETSAAAQSSPAKDPA
FT                   QLQKLAQQSQGKALTLLDASEAQLDGAATLVLTFSIPLDPEQDFSRVIHIVDKKSGSVD
FT                   GAWELAPNLKELRLRHLEPKRVLVVTVDPAVKALNNATFGTPYEKTITTRDVQPSVGFA
FT                   SRGSLLPGKIAEGLPVMALNVNHVDVNFFRVKPESLAAFVSQWEYRSSLSNWESDNLLK
FT                   MADLVYTGRFDLNPARNTREKLLLPLSDIKPLQQAGVYVAVMNQAGHYNYSNAATLFTL
FT                   SDIGVSAHRYHNRLDIFTQSLENGAAQSGIEIVLLNDKGQTLAQSTSDAQGHVQLESDK
FT                   AAALLLARKAGQTTLLDLKLPALDLSEFNVAGAPGYSKQFFMFGPRDLYRPGETVILNG
FT                   LLRDSDGKTLPDQPVKLEVVKPDGQVMRTVVSQPENGLYRLNYPLDSRAPTGLWHVRAN
FT                   TGDNVLRTWDFHVEDFMPERMALNLTAQKTPLAPADAVKFSVVGYYLYGAPASGNALQG
FT                   QLFLRPQRDAVAALPGFQFGNIAEENLSRSLDEVQLSLDKSGRGDVIAASQWQETHSPL
FT                   QVILQASLLESGGRPVTRRVEQAIWPADTLPGIRPQFTAKAVYDYRTDATVNQPIVDED
FT                   SNAAFDIVYANAQGEKKAVSGLQVRLIRERRDYYWNWSESEGWQSQFDQKDLVEGEQTL
FT                   DLNADETGKVSFPVEWGAYRLEVKAPNETVSSVRFWAGYSWQDNSDGSGAARPDRVTLK
FT                   LDKANYRPGDTMKLHIAAPVAGKGYAMVESSDGPLWWQAIDVPAQGLDLTIPVDKTWNR
FT                   HDLYLSTLVVRPGDKSRSATPKRAVGLLHLPLGDENRRLDLALESPAKMRPNQPLTVRV
FT                   KASVKHGEMPKQINVLVSAVDSGVLNITDYATPDPWQAFFGQKRYGADIYDIYGQVIEG
FT                   QGRLAALRFGGDGDALKRGGKPPVNHVNIIAQQAQPITLNEQGEGVVTLPIGDFNGELR
FT                   VMAQAWTADDFGRGESKVVVAAPVIAELNMPRFLAGGDVSRLVLDVTNLTDRPQTLNIA
FT                   LAASGLLELLSQQPQPVNLAPGVRTTLFVPVRALEGFGEGELQATMSGLNLPGETLDAQ
FT                   HKQWKISVRPAWPGQTVNSGIALAPGESWHVPAQHLANVSPATLQGQLLLSGKPPLNLA
FT                   RYIRELKAYPYGCLEQTASGLFPALYTNAAQLQALGIVGDSDEKRRAAVDIGISRVLQM
FT                   QRDNGGFALWDKNGAEEYWLTAYAMDFLVRAGEQGYSVPPEAINQGNERLLRYLQDPGM
FT                   MLIRYSDNTQASTFAAQAYAALVLARQQKAPLGALREIWERRSQAASGLPLMQLGIALK
FT                   TMGDARRGEEAITLALNTPRQDERQWIADYGSSLRDNALMLSLLEENNLKPDAQNALLS
FT                   SLSEQAFGQRWLSTQENNALFLAAHSRQASAGAWQAQTSLEAQPLSGDKALTRNLDADQ
FT                   LSALEVTNAGSQPLWLRLDSSGYPSSAPEPASNVLQIERQILGTDGQRKSLSSLRSGEL
FT                   VLVWLTVVADRNVPDALVVDLLPAGLELENQNLADSSASLPESGSEVQNLLNQMQQADI
FT                   QHMEFRDDRFVAAVAVNEGQPVTLVYLARAVTPGTYQLPQPQVESMYVPQWRATGASEG
FT                   LLIVTP"
FT   gene            343801..346116
FT                   /locus_tag="SARI_00346"
FT   CDS_pept        343801..346116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00346"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2531 0. pbpC; transglycosylase of
FT                   penicillin-binding protein 1c K05367; COG: COG4953 Membrane
FT                   carboxypeptidase/penicillin-binding protein PbpC; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20284"
FT                   /db_xref="GOA:A9MHK6"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHK6"
FT                   /inference="protein motif:BlastProDom:IPR001264"
FT                   /inference="protein motif:HMMPfam:IPR001264"
FT                   /inference="protein motif:HMMPfam:IPR001460"
FT                   /inference="protein motif:HMMPfam:IPR009647"
FT                   /inference="protein motif:HMMTigr:IPR011815"
FT                   /inference="protein motif:superfamily:IPR012338"
FT                   /protein_id="ABX20284.1"
FT                   /translation="MNGWRGKRGRWLWLAGAPLFILLALWAADNLWPLPLNEVHPARVV
FT                   VAHDGTPLWRFADAGGIWRYPVTIEEVSPRYLEALINYEDRWFWRHPGVNPFSVARAAW
FT                   QDLTAGRVISGGSTLTMQVARLLDPHPRTFGGKIRQLWRALQLEWHLSKRDILTLYLNR
FT                   APFGGTLQGIGAASWAYFGKSPARLSYADAALLAVLPQAPSRLRPDRWPARAEAARNKV
FT                   LDRMAAQGVWPAETVRESREEPVWLAPRQMPQLAPLFARMMLSKSQSDKIVTTLDAGLQ
FT                   RQLEDLARVWKGRLPARSSLAMIVVDHTDMSVRGWVGSVDLNDDSRFGHVDMVTAIRSP
FT                   GSVLKPFVYGLALDDALIHPASLLQDVPRRTGDYRPGNFDSGFHGPVSMSDALVRSLNL
FT                   PAVQVLEAYGPKRFAAKLRNVGLPLYLPAGAAPNLSLILGGAGARLDEMAAAYSAFARH
FT                   GKAAKLRLQPDDPLWERSLMSPGAAWIIRRIMADEAQPLPDNALPRIVPLAWKTGTSYG
FT                   YRDAWAIGVNARYIIGIWTGRPDGTPVVGQIGFASAVPLLNQVNNLLLAHAGRLPEDPR
FT                   PQSVSRGVICWPGGQSLPAGDSNCRRRLATWLLDDSQPPTLLLPEQEGINGIRFPVWLD
FT                   DTGLRVAADCPQAREHTFIVWPRPLELWLPSTERRSARLPAESALCPPLQGRNTAPLML
FT                   SGVREGAVIRQLPGQENITLPVFTTGGKGRRWWFLNGEPVNSANNSLSLLLNIAGRYQL
FT                   VVMDESGQVAAVNFELMR"
FT   gene            346279..348657
FT                   /locus_tag="SARI_00347"
FT   CDS_pept        346279..348657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY0357 3.7e-237 dmsA; putative anaerobic
FT                   DMSO reductase chain A precursor K00369; COG: COG0243
FT                   Anaerobic dehydrogenases, typically
FT                   selenocysteine-containing; Psort location: Periplasmic,
FT                   score:9.76"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20285"
FT                   /db_xref="GOA:A9MHK7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHK7"
FT                   /inference="protein motif:HMMPfam:IPR006656"
FT                   /inference="protein motif:HMMPfam:IPR006657"
FT                   /inference="protein motif:HMMPfam:IPR006963"
FT                   /inference="protein motif:HMMTigr:IPR011888"
FT                   /inference="protein motif:ScanRegExp:IPR006655"
FT                   /inference="protein motif:superfamily:IPR009010"
FT                   /protein_id="ABX20285.1"
FT                   /translation="MKKITCQGNSEQPAISRRNFIQASSALIALPFVSSTATAQARAVT
FT                   ATENRPAEKVVQTCSTFDCGGKCDIRVHVNEGIVTRISTRPDNALDAQMPVMRACVRGR
FT                   AYRKFVYHPDRLKYPMKRVGKRGEGKFERISWDEATTLIAANLKSITAKYGPASRYVHV
FT                   GTAVSGGTFSGDKMVRRLLNLTGGYLESYHSVSMGNTAAATPYTYGTAASGSSLDTLLE
FT                   TKLVILWGHNPTETIFGHTNYFFQKMKQNGTRFIVVDPRYSDTVASLADQWIPLLPTTD
FT                   NALMDAMMYVIISENLHDRAFIERYAIGFDEGSMPEGVPANESLVAYLTGAKDGVVKSP
FT                   EWAEKITHVPAQTIRQLARDYANTKPAALIQGWGPQRHNCGERTARGSTLLATITGNVG
FT                   IKGGWAAGYGGCANRKFAAGPEMPDNPVKAKISVMNWVQAADDASKVTPDVGLKDADKL
FT                   ESNIRILFSLAGNYLANQNPDLHQAVRVLEDESRIQFIVASDLFMTPSAKYADLLLPET
FT                   SFMERWNIGETWGTASYLILSEKLIEPEFERRSDYDWLREVAAKLDIENEFSQGRDEKA
FT                   WIEHIWEQTRLAMPDENLPDFATLRKTRQHLFKSAPSVAFEDNIRDPDNHPFPTPSGKI
FT                   EIFSKRLFDMQHPEIPALSHYVPAHEGPEDALAKDFPLQLITWKGKNRANSTQYANPWL
FT                   IEVQHQKLWINPQDAQKRGIKHGDMVRIHNQRGICEIPAEVTPRIIPGVVAMQAGAWWQ
FT                   PDENGIDKGGCANVLSSARITALAKGNSHQTMLVEVAKA"
FT   gene            348654..349283
FT                   /locus_tag="SARI_00348"
FT   CDS_pept        348654..349283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY0356 6.8e-62 dmsB; putative anaerobic
FT                   DMSO reductase chain B iron-sulfur subunit K00369; COG:
FT                   COG0437 Fe-S-cluster-containing hydrogenase components 1;
FT                   Psort location: CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20286"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHK8"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461464.1"
FT                   /protein_id="ABX20286.1"
FT                   /translation="MSQFTHYPPVSDKQLGFFIDSSRCSGCKACQVACKDKNNLEVGRR
FT                   FRRVYEVNGGNFIPTGQGGVSNNVFAYTLSISCNHCADPICTKNCPTTAMHKRPGDGIV
FT                   RVDTDKCVGCGYCAWSCPYGAPQLNDQTGQMSKCDMCVDLQAKGEQPVCVATCPLEAIK
FT                   FGPIDELRAKYGSVCDVNGLPDSSITKPNLVVKAHHGAEKEGKRHA"
FT   gene            349276..350085
FT                   /locus_tag="SARI_00349"
FT   CDS_pept        349276..350085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY4822 9.4e-33 dmsC; putative anaerobic
FT                   DMSO reductase chain C anchor subunit K00369; COG: COG3302
FT                   DMSO reductase anchor subunit; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20287"
FT                   /db_xref="GOA:A9MHK9"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHK9"
FT                   /inference="protein motif:HMMPfam:IPR007059"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457060.1"
FT                   /protein_id="ABX20287.1"
FT                   /translation="MHELPLLIFTLCLQGSVGVTLWLALGRQYAVEGREPVRGALPAMA
FT                   GAFVLACVGLLASALHMGYPLNALNALRHVASSWLSREIVFASLYLAALGLGVVLLFFR
FT                   KPGWQPLLALAAALGLVDVFCMAQIYIHASVATWQHSNTLALFFGTSGIIGSLVIALVY
FT                   LRNAGAAMRCAVVVVALMVLIRLIMQPLWLADINALDTTVVTLPHHPLQALAQLRDVYL
FT                   LGWCVSAAGMACFAAGGLRNARGALAAGSVLLLIGEIVLRYVFFSIG"
FT   gene            350085..350948
FT                   /locus_tag="SARI_00350"
FT   CDS_pept        350085..350948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mth:MTH926 1.5e-08 tungsten formylmethanofuran
FT                   dehydrogenase, subunit F homolog K00205; COG: COG1145
FT                   Ferredoxin; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20288"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHL0"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="similar to AA sequence:INSD:CAD02730.1"
FT                   /protein_id="ABX20288.1"
FT                   /translation="MVNLASDPAIDVTQACVRRRFRFSSCRACADVCPAQAFLLTQGQA
FT                   SIDMARCIACGDCLFVCPVDAITGIKPVKRFVQGDTLVGPFSLQAPTVDELLLWHSQYG
FT                   IRFIDIAVERSAQWLMALAGLNLALRRYGEPCWSFKHVVGTEINVSRRTLFHVPRDTIT
FT                   PCAVEPGKRRLRQAFSAFSECVPEISLEACRMCGACWRSCPENVIQFADDTLTITAARC
FT                   TGCGGCAAVCPHQALRLRFDMEPAQTRHIAAHTLTCESCKRTFQALTPEHTRCVLCQHH
FT                   DFAMRL"
FT   gene            complement(350975..351106)
FT                   /locus_tag="SARI_00352"
FT   CDS_pept        complement(350975..351106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20290"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHL1"
FT                   /protein_id="ABX20290.1"
FT                   /translation="MGLMMEKVRSIAMFTSEKCSVVMSGADYKEHPSNCLWMQVTFF"
FT   gene            351069..351500
FT                   /locus_tag="SARI_00351"
FT   CDS_pept        351069..351500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2771 6.7e-71 ndk; nucleoside
FT                   diphosphate kinase (ndk) K00940; COG: COG0105 Nucleoside
FT                   diphosphate kinase; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20289"
FT                   /db_xref="GOA:A9MHL2"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHL2"
FT                   /inference="protein motif:BlastProDom:IPR001564"
FT                   /inference="protein motif:FPrintScan:IPR001564"
FT                   /inference="protein motif:Gene3D:IPR001564"
FT                   /inference="protein motif:HMMPfam:IPR001564"
FT                   /inference="protein motif:HMMPIR:IPR012005"
FT                   /inference="protein motif:HMMSmart:IPR001564"
FT                   /inference="protein motif:ScanRegExp:IPR001564"
FT                   /inference="protein motif:superfamily:IPR001564"
FT                   /inference="similar to AA sequence:INSD:AAV76358.1"
FT                   /protein_id="ABX20289.1"
FT                   /translation="MAIERTFSIIKPNAVAKNVIGSIFARFEAAGFRIVGTRMLHLTVE
FT                   QARGFYAEHDGKPFFDGLVEFMTSGPIVVSVLESENAVQRHRDLLGATNPANALAGTLR
FT                   ADYADSFTENGTHGSDSLESAQREIAFFFGEGEVCPRTR"
FT   gene            351669..352835
FT                   /locus_tag="SARI_00353"
FT   CDS_pept        351669..352835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00353"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0820 Predicted Fe-S-cluster redox enzyme;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20291"
FT                   /db_xref="GOA:A9MHL3"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHL3"
FT                   /inference="protein motif:HMMPfam:IPR007197"
FT                   /inference="protein motif:HMMTigr:IPR004383"
FT                   /inference="protein motif:superfamily:IPR009063"
FT                   /inference="similar to AA sequence:INSD:CAD02728.1"
FT                   /protein_id="ABX20291.1"
FT                   /translation="MSEQIVTPESSTPVVSNNEAKINLLDLNRQQMREFFKNLGEKPFR
FT                   ADQVMKWMYHYCCDNFDEMTDINKVLRGKLKEVAEIRAPEVVEEQRSSDGTIKWAIAVG
FT                   DQRVETVYIPEDDRATLCVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIV
FT                   GAAKVTGQRPITNVVMMGMGEPLLNLTNVVPAMEIMLDDFGFGLSKRRVTLSTSGVVPA
FT                   LDKLGDMIDVALAISLHAPNDAIRDEIVPINKKYNIETFLGAVRRYLEKSNANQGRVTI
FT                   EYVMLDHVNDGTEHAHQLAELLKETPCKINLIPWNPFPGAPYGRSSNSRIDRFSKVLMS
FT                   YGFTTIVRKTRGDDIDAACGQLAGDVIDRTKRTLRKRMQGEAIDIKAI"
FT   gene            353128..354093
FT                   /locus_tag="SARI_00354"
FT   CDS_pept        353128..354093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bca:BCE_1379 0.0056 odhB; dihydrolipoamide
FT                   acetyltransferase K00658; COG: COG1426 Uncharacterized
FT                   protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00354"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20292"
FT                   /db_xref="GOA:A9MHL4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR023690"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHL4"
FT                   /inference="protein motif:HMMPfam:IPR001387"
FT                   /inference="protein motif:HMMSmart:IPR001387"
FT                   /inference="protein motif:superfamily:IPR010982"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457056.1"
FT                   /protein_id="ABX20292.1"
FT                   /translation="MNTEATHDQNEAQTTGVRLRNAREQLGLSQQAVAERLCLKVSTVR
FT                   DIEEDKAPSDLASTFLRGYIRSYARLVHVPEEELLPGLEKQAPLRAAKVAPMQNFSLGK
FT                   RRKKRDGWLMSFTWLVLFVVVGLTGAWWWQNHKAQQEEITTMADQSTAELNADKDSGQG
FT                   VQLDTRAAASQDTTPAETAPAAPVDSTAAATQNTVVAPSQANVDTAATSATATETSSAL
FT                   PTDQAGVAAPAADSNALVMNFTADCWLEVTDATGKKLFSGMQRKDGNLNLTGQAPYKLK
FT                   IGAPAAVQIQYQGKPVDLSRFIRTNQVARLTINAEPTSAQ"
FT   gene            354120..355238
FT                   /locus_tag="SARI_00355"
FT   CDS_pept        354120..355238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0344 5.8e-191 gcpE; GcpE protein
FT                   (protein E) K03526; COG: COG0821 Enzyme involved in the
FT                   deoxyxylulose pathway of isoprenoid biosynthesis; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20293"
FT                   /db_xref="GOA:A9MHL5"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHL5"
FT                   /inference="protein motif:HMMPfam:IPR004588"
FT                   /inference="protein motif:HMMTigr:IPR004588"
FT                   /inference="similar to AA sequence:INSD:AAV76361.1"
FT                   /protein_id="ABX20293.1"
FT                   /translation="MHNQAPIQRRKSTRIYVGNVPIGDGAPITVQSMTNTRTTDVEATV
FT                   NQIKALERVGADIVRVSVPTMDAAEAFKLIKQQVSVPLVADIHFDYRIALKVAEYGVDC
FT                   LRINPGNIGNEERIRMVVDCARDKNIPIRIGVNAGSLEKDLQEKYGEPTPQALLESAMR
FT                   HVDHLDRLNFEQFKVSVKASDVFLAVESYRLLAKQIDQPLHLGITEAGGARSGAVKSAI
FT                   GLGLLLSEGIGDTLRVSLAADPVEEIKVGFDILKSLRIRARGINFIACPTCSRQEFDVI
FT                   GTVNALEQRLEDIITPMDVSIIGCVVNGPGEALVSTLGVTGGNKKSGLYEDGVRKDRLD
FT                   NDDMIAQLESRIRAKASQLDEARRIDVLQVEK"
FT   gene            355238..355329
FT                   /locus_tag="SARI_00356"
FT   misc_RNA        355238..355329
FT                   /locus_tag="SARI_00356"
FT                   /product="SroE RNA"
FT                   /note="Rfam score 104.62"
FT                   /inference="nucleotide motif:Rfam:RF00371"
FT   gene            355349..356623
FT                   /locus_tag="SARI_00357"
FT   CDS_pept        355349..356623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2522 1.0e-223 hisS; histidine tRNA
FT                   synthetase K01892; COG: COG0124 Histidyl-tRNA synthetase;
FT                   Psort location: Cytoplasmic, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20294"
FT                   /db_xref="GOA:A9MHL6"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHL6"
FT                   /inference="protein motif:Gene3D:IPR004154"
FT                   /inference="protein motif:HMMPfam:IPR002314"
FT                   /inference="protein motif:HMMPfam:IPR004154"
FT                   /inference="protein motif:HMMPIR:IPR004516"
FT                   /inference="protein motif:HMMTigr:IPR004516"
FT                   /inference="protein motif:superfamily:IPR004154"
FT                   /inference="similar to AA sequence:SwissProt:O52765"
FT                   /protein_id="ABX20294.1"
FT                   /translation="MAKNIQAIRGMNDYLPGETAIWQRIESTLKNVLGSYGYSEIRLPI
FT                   VEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQR
FT                   LWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDIDAELIMLTARWWRALGIAEHVSL
FT                   ELNSIGSLEARANYRDALVAFLEQHQETLDEDCKRRMYTNPLRVLDSKNPDVQALLNDA
FT                   PALGDYLDDDSREHFAGLCKLLDAAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQGT
FT                   VCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFIASPVVDIYLVAAGTET
FT                   QSAAMTLAERLRDEMPDVKLITNHGGGNFKKQFARADKWGARIALVLGESEVANGTVVV
FT                   KDLRSGEQTAVAQDSVAAHLRTLLG"
FT   gene            356637..357257
FT                   /locus_tag="SARI_00358"
FT   CDS_pept        356637..357257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00358"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2976 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20295"
FT                   /db_xref="GOA:A9MHL7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHL7"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="similar to AA sequence:INSD:AAL21415.1"
FT                   /protein_id="ABX20295.1"
FT                   /translation="MEIYENEHDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWNSH
FT                   QTESARAASLAYQNAVTAISADKPDSIPAAEKFAAENKNTYGALASMELAQQFVDKNEL
FT                   KKAETQLQQGLAATSDENLKAVINLRLARVQVQLKQADAALKTLDAIKGEGWTAIVADL
FT                   RGEALLSKGDIKGARSAWEAGVNSDASPALSEMMQMKINNLSI"
FT   gene            357268..358446
FT                   /locus_tag="SARI_00359"
FT   CDS_pept        357268..358446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2833 3.1e-192 yfgL; hypothetical
FT                   protein YfgL K00870; COG: COG1520 FOG: WD40-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00359"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20296"
FT                   /db_xref="GOA:A9MHL8"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017687"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHL8"
FT                   /inference="protein motif:HMMPfam:IPR002372"
FT                   /inference="protein motif:HMMSmart:IPR002372"
FT                   /inference="protein motif:superfamily:IPR011047"
FT                   /inference="similar to AA sequence:INSD:AAO68059.1"
FT                   /protein_id="ABX20296.1"
FT                   /translation="MQLRKLLLPGLLSVTLLSGCSLFSGEEDVVKMSPLPQVENQFTPT
FT                   TAWSTSVGNGIGDFYSNLHPVMADNVVYAASRAGVVKALNADDGKEIWSVNLGEKDGWF
FT                   SRSSALLSGGVTVAGGHVYIGSEKALVYALNTSDGTTEWQTKVAGEALSRPVVSDGLVL
FT                   IHTSNGQLQALNQADGAIKWTVSLDMPSLSLRGESAPATAFGAAIVGGDNGRVSAVLMQ
FT                   QGQMIWQQRISQATGPTEIDRLSDVDTTPVVVNGVVYALAYNGNLTALDLRSGQIMWKR
FT                   ELGSVNDFIVDGDRIYLVDQNDRVLALTTDGGVTLWTQSDLLHRLLTSPVLYNGDLVVG
FT                   DSEGYLHWINVDDGRFVAQQKVDSSGFLTEPTVADGKLLIQAKDGTVYAITR"
FT   gene            358521..360035
FT                   /locus_tag="SARI_00360"
FT   CDS_pept        358521..360035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cjk:jk0878 4.6e-73 cmk; putative GTPases
FT                   K03977; COG: COG1160 Predicted GTPases; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20297"
FT                   /db_xref="GOA:A9MHL9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHL9"
FT                   /inference="protein motif:HMMPfam:IPR002917"
FT                   /inference="protein motif:HMMTigr:IPR005225"
FT                   /inference="protein motif:HMMTigr:IPR005289"
FT                   /inference="similar to AA sequence:INSD:AAV76365.1"
FT                   /protein_id="ABX20297.1"
FT                   /translation="MRALSDDFLNEALNMVPVVALVGRPNVGKSTLFNRLTRTRDALVA
FT                   DFPGLTRDRKYGRAEVEGREFICIDTGGIDGTEDGVETRMAEQSLLAIEEADVVLFMVD
FT                   ARAGLMPADEAIAKHLRSREKPTFLVANKTDGLDPDQAVVDFYSLGLGDIYPIAASHGR
FT                   GVLSLLEHVLLPWMDDIAPQEEVDEDAEYWAQFEAEENSEEAPEDDFNPQDLPIKLAIV
FT                   GRPNVGKSTLTNRILGEERVVVYDMPGTTRDSIYIPMERDEREYVLIDTAGVRKRGKIT
FT                   DAVEKFSVIKTLQAIEDANVVLLVIDAREGISDQDLSLLGFILNSGRSLVIVVNKWDGL
FT                   SQEVKEQVKETLDFRLGFIDFARVHFISALHGSGVGNLFESVREAYDSSTRRVSTALLT
FT                   RIMTMAVEDHQPPLVRGRRVKLKYAHAGGYNPPIVVIHGNQVKDLPDSYKRYLMNYFRK
FT                   SLEVMGTPIRIQFKEGENPYANKRNTLTPTQMRKRKRLMKHIKKSK"
FT   gene            360097..360345
FT                   /locus_tag="SARI_00361"
FT   CDS_pept        360097..360345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aha:AHA_1764 6.9e-14 ubiquitin ligase sinat5
FT                   K01932; COG: NOG17950 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20298"
FT                   /db_xref="InterPro:IPR010807"
FT                   /db_xref="InterPro:IPR029037"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHM0"
FT                   /inference="protein motif:HMMPfam:IPR010807"
FT                   /inference="similar to AA sequence:INSD:AAP83330.1"
FT                   /protein_id="ABX20298.1"
FT                   /translation="MDYALEENVVEITCPVCHRALERNGNAAHCATCVKDFVLQAICPD
FT                   CRQPLQVLKACGAVDYFCQNGHGLVSKKRVNFVISEQ"
FT   gene            complement(360622..360972)
FT                   /locus_tag="SARI_00362"
FT   CDS_pept        complement(360622..360972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00362"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG18711 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20299"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHM1"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01536042.1"
FT                   /protein_id="ABX20299.1"
FT                   /translation="MDIPELTDDAIVELAREGGVAFIPKLNKQRKIALAPLTASQRQRV
FT                   SDILKQTLPVGSPPGQVNSPGKGDQRYFRIHIIWTQHQQAQYTDIVILVPENDAPSSLV
FT                   ELWQKGEACICD"
FT   gene            complement(360973..362058)
FT                   /locus_tag="SARI_00363"
FT   CDS_pept        complement(360973..362058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA3211 1.1e-123 prt1; extracellular
FT                   metalloprotease; COG: COG3227 Zinc metalloprotease
FT                   (elastase); Psort location: Extracellular, score:9.71"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00363"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20300"
FT                   /db_xref="GOA:A9MHM2"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR032475"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHM2"
FT                   /inference="protein motif:Gene3D:IPR013832"
FT                   /inference="protein motif:Gene3D:IPR013856"
FT                   /inference="protein motif:HMMPfam:IPR001570"
FT                   /inference="protein motif:HMMPfam:IPR013856"
FT                   /inference="protein motif:ScanRegExp:IPR006025"
FT                   /inference="similar to AA sequence:INSD:ABK56826.1"
FT                   /protein_id="ABX20300.1"
FT                   /translation="MLTIYTTDVLFSVVRNKEIGMNTISCHTVIPPYILRRIIANGSAP
FT                   QQRCARLTLTHVQTLMAHKPVKSPVAHPAHPGRLERDIYDAKQGQELPGLQVRHEGQPS
FT                   NGDIAVDEAYNYLGITHDFFWKIYHRDSLDNKGLALTGTVHYGRDYQNAFWNGQQMVFG
FT                   DGDGEIFNRFTSSIDVVAHELTHGVTETEAGLIYFGQSGALNESLSDVLGSLVKQFHLQ
FT                   QTAGQADWIIGEGLLAKGINGKGLRSMAAPGTAYDDPLLGQDPQPAHMQNFIKTREDNG
FT                   GVHLNSGIPNRAFYLAACQIGGYAWEKAGYAWYDTLCDRNLAQNASFADFAGLTIAHGE
FT                   KRSGQTVASAIEQAWKTVGVL"
FT   gene            complement(362076..363440)
FT                   /locus_tag="SARI_00364"
FT   CDS_pept        complement(362076..363440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0355 3.2e-213 xseA;
FT                   exodeoxyribonuclease large subunit K03601; COG: COG1570
FT                   Exonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20301"
FT                   /db_xref="GOA:A9MHM3"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHM3"
FT                   /inference="protein motif:HMMPfam:IPR003753"
FT                   /inference="protein motif:HMMPfam:IPR004365"
FT                   /inference="protein motif:HMMTigr:IPR003753"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /inference="similar to AA sequence:SwissProt:Q5PI54"
FT                   /protein_id="ABX20301.1"
FT                   /translation="MLSSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFTQPASG
FT                   HWYFTLKDDTAQVRCAMFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQP
FT                   AGEGLLQQKYEQLKAKLQAEGLFDQQYKHPLPSPAYCVGVITSKTGAALHDILHVLKRR
FT                   DPSLPVIIYPAAVQGEDAPGQIVRAITLANARKECDVLIVGRGGGSLEDLWSFNDERVA
FT                   RAIFASTIPVVSAVGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQMQTACQRL
FT                   EMAMDYYLANRQRRFSQLYHRLQQQHPQLRLARQQTTLERLRQRMHLALENQLKQANQR
FT                   QQRASQRLRQQNPQPRIHRAQSRIQQLEYRLAENFRARLSEQRERFGNTVTHLEAVSPL
FT                   ATLARGYSVSTATDGNVLKKVKQLKVGDMMTTRLKDGWVTSEVTAIKPVKKIRLG"
FT   gene            363517..365067
FT                   /locus_tag="SARI_00365"
FT   CDS_pept        363517..365067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00365"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2509 1.4e-267 imdH;
FT                   inosine-5'-monophosphate dehydrogenase K00088; COG: COG0517
FT                   FOG: CBS domain; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20302"
FT                   /db_xref="GOA:A9MHM4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHM4"
FT                   /inference="protein motif:HMMPanther:IPR001093"
FT                   /inference="protein motif:HMMPfam:IPR000644"
FT                   /inference="protein motif:HMMPfam:IPR001093"
FT                   /inference="protein motif:HMMSmart:IPR000644"
FT                   /inference="protein motif:HMMTigr:IPR005990"
FT                   /inference="protein motif:ScanRegExp:IPR001093"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217496.1"
FT                   /protein_id="ABX20302.1"
FT                   /translation="MQKSVDATDYVLYNAAAIFINLPGEILPMLRIAKEALTFDDVLLV
FT                   PAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMDTVTEARLAIALAQEGGIGFIHKNMSI
FT                   ERQAEEVRRVKKHESGVVTDPQTVLPTTTLHEVKALTERNGFAGYPVVTEDNELVGIIT
FT                   GRDVRFVTDLNQPVSVYMTPKERLVTVREGEAREVVLAKMHEKRVEKALVVDDNFHLLG
FT                   MITVKDFQKAERKPNSCKDEQGRLRVGAAVGAGAGNEERVDALVAAGVDVLLIDSSHGH
FT                   SEGVLQRIRETRAKYPDLQIIGGNVATGAGARALAEAGCSAVKVGIGPGSICTTRIVTG
FT                   VGVPQITAVSDAVEALEGTGIPVIADGGIRFSGDIAKAIAAGASAVMVGSMLAGTEESP
FT                   GEIELYQGRSYKSYRGMGSLGAMSKGSSDRYFQSDNAADKLVPEGIEGRVAYKGRLKEI
FT                   IHQQMGGLRSCMGLTGCATIDELRTKAEFVRISGAGIQESHVHDVTITKESPNYRLGS"
FT   gene            365137..366714
FT                   /locus_tag="SARI_00366"
FT   CDS_pept        365137..366714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2751 5.3e-284 guaA; GMP synthase
FT                   (glutamine-hydrolyzing) K01951; COG: COG0518 GMP synthase -
FT                   Glutamine amidotransferase domain; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00366"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20303"
FT                   /db_xref="GOA:A9MHM5"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHM5"
FT                   /inference="protein motif:HMMPfam:IPR000991"
FT                   /inference="protein motif:HMMPfam:IPR001674"
FT                   /inference="protein motif:HMMPfam:IPR004506"
FT                   /inference="protein motif:HMMTigr:IPR001674"
FT                   /inference="protein motif:HMMTigr:IPR004739"
FT                   /inference="protein motif:ScanRegExp:IPR012998"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804218.1"
FT                   /protein_id="ABX20303.1"
FT                   /translation="MTDNIHKHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQ
FT                   IREFNPSGIILSGGPESTTEENSPRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEGSN
FT                   EREFGYAQVEVLTDSALIRGIEDSLTADGKPLLDVWMSHGDKVTAIPSDFVTVASTESC
FT                   PFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEALWTPAKIIDDAVARIR
FT                   EQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVMDMFGDHF
FT                   GLNIVHVPAEDRFLSALAGENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPD
FT                   VIESAASATGKAHVIKSHHNVGGLPKEMKMGLVEPLKELFKDEVRKIGLELGLPYDMLY
FT                   RHPFPGPGLGVRVLGEVKKEYCDLLRRADAIFIEELRKADLYDKVSQAFTVFLPVRSVG
FT                   VMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYGFLGRVSNRIINEVNGISRVVYDISGK
FT                   PPATIEWE"
FT   gene            complement(366839..367612)
FT                   /locus_tag="SARI_00367"
FT   CDS_pept        complement(366839..367612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00367"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG22997 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20304"
FT                   /db_xref="InterPro:IPR028969"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHM6"
FT                   /inference="similar to AA sequence:REFSEQ:NP_931775.1"
FT                   /protein_id="ABX20304.1"
FT                   /translation="MKLDFRIEHEFGSSESIKPVELATLFQGVTKQLDELLGTKRSWYE
FT                   QGYSRKQALQYKIFTEEGISEDVLDRWEMEYKKDYPNWTTGIWDGGSDEDSAGVDCYPS
FT                   YSSTHRRKNPLNLVVSFSIDLSQTRLNVEKMINFLSFLLHSTNNCTYSCVESGGYSFSE
FT                   IIPKENGYDEVYKKLFPDRISCGWMLFIPAIILPDLIPDAARIVPVLNGNKQIGTIVVS
FT                   TEEIFDGNNKEHQGKANDIEIKLLDLGLLPLMTEL"
FT   gene            complement(367756..368838)
FT                   /locus_tag="SARI_00368"
FT   CDS_pept        complement(367756..368838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00368"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3335 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00368"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20305"
FT                   /db_xref="GOA:A9MHM7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHM7"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00725515.1"
FT                   /protein_id="ABX20305.1"
FT                   /translation="MLPAMKIFITAQQKTELERLHDSSRDGRVRDRIKAILLASEGWSS
FT                   AMIAQALRLHQTTVDHHISEFLNKGKLKPENGGSDSKLSAEQRAFLISQLSNNLFHHTS
FT                   DIIAFFSRTWDIVFSVPGMNKWLHRNGFTYKKPSGVPHKFSEEKQRQFIEYYEELKATA
FT                   GDEPVLFIDAVHPTQATKISYGWIRKGHKKAVKTTGSRTRLNIMGTLNLKTLATPLICE
FT                   YKTINEYNVSTCAVGNANLKICIRGNVINVNGKLSIHVDALGFYLKDTYDFLDDNKLGI
FT                   DIPECLGIWGKNRILNKIDTASYMTSYASGSFGILVQLYSGFVPVFNSDFREWQKKTTL
FT                   VEITSFFLMYYGLLHLIKIG"
FT   gene            complement(368896..369456)
FT                   /locus_tag="SARI_00369"
FT   CDS_pept        complement(368896..369456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00369"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG23066 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20306"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHM8"
FT                   /inference="similar to AA sequence:INSD:ABG70793.1"
FT                   /protein_id="ABX20306.1"
FT                   /translation="MKINLFNLFRKKNKLQDDFPVTQFSALPKKGEGYPSFFSLEKNNI
FT                   YAHSACFMIKPDDISFIEHLVELFFHAKVKVSEIKEKFADHDKVLICYKFKEFEQEVVR
FT                   LITNDNEFINCLCEKGLEPPDPECVFPDKDFGTYGSLQGDMEFWWHVYWKPFWESLKEE
FT                   ERKQYLERSNLSIGTIEFLEHHH"
FT   gene            complement(369446..370330)
FT                   /locus_tag="SARI_00370"
FT   CDS_pept        complement(369446..370330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00370"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG31152 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20307"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHM9"
FT                   /inference="similar to AA sequence:INSD:ABG70792.1"
FT                   /protein_id="ABX20307.1"
FT                   /translation="MTEHSTLTNETPHSTYDITGMLMPARAFFFVVVDEPGKDGFLVRK
FT                   IYASNSDPYLSKMDLSEAKMLSETNPERYGLIPKDFSASYSVAEHVMGNNASAYISTSS
FT                   AFPQGSPRFEGKTIIVDIDKAVRSGAKLISTAEILKSLDEYKNQNPHLGKRIDKISKYV
FT                   NDIDKEVLLHGEKIPAAAIFTPETLKYTKYFTRAARVVQVTGIVFTAYDLEQASEKSLK
FT                   NGSVKPITAEAIRQAGGWGMAVAGAKIGTVAGAAVGIETGPGAALTGLIGGIIFGTAGY
FT                   FGADWVADHIDEN"
FT   gene            complement(370331..372802)
FT                   /locus_tag="SARI_00371"
FT   CDS_pept        complement(370331..372802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00371"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3501 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20308"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN0"
FT                   /inference="protein motif:HMMPfam:IPR006533"
FT                   /inference="protein motif:HMMTigr:IPR006533"
FT                   /inference="similar to AA sequence:INSD:ABP58869.1"
FT                   /protein_id="ABX20308.1"
FT                   /translation="MDNWSALFDGQTRYGLDINDSTMKADVLRFRGREALSEPFNWDIE
FT                   FTTLQANIPPEQVLMKYASFRMRNGKNVHGMVTRLEWLSTSRDQSHYRLTLSSRLTLLG
FT                   YTRQCAVYQNQSVPEVVEQVLRKHGLEGPDFEFRLERTYPARELITQWQETDLQFIQRI
FT                   LSEVGIYWRTMMDDVRGLDTYILADSQLNYQFDVQLPYSEPSGLFDGAAESVWDVRTWH
FT                   NIATGTVATRNYNYRTATTPMDATVSVRNDAVTTGEHYRYAAPYRVAGDDASPEPETES
FT                   GAFYARIHHERELNRSARIHLFSNAAHLTPGQVLEPQGDAITALKEGVILTQVTYRGAR
FT                   DSRLHVSVWGLPYTERYCFRPVEVPRPVIPGTLPARIESREKNDIYAHLDEQGRYRVKL
FT                   DFDREGTESGYGYLWLRMAKPYAGETLGWHTPLIDGTEVAIAYSNGDIDLPYIAYALHD
FT                   SEHPDHVTRDNHTRNVLRTPANNKLRMEDRRGEEHVRLATEYGKTQLNSGHLVDAQGQR
FT                   RGTGAELRTDEWGTIRAGKGLFVSADAQAKAQGEVLDMDAALKEIDRLNQQLQQLEMAA
FT                   EKAQALKADVDSQIQMFEQRLKPLSEVVLFSAPEGMALTSGEHLQMTATKNVAMNAGGN
FT                   FSAGVMGNLTALAGEKLGLFARTGQLSLKVSEGPVEVQAQNASMRLFAEKKLTLSSASD
FT                   ISFAGKKRITLVGGGSYLRLEAGKVEYGTTATYLRRVKRTMFAGAHSTPTSSVLMPLVE
FT                   DLIKDGFFDEQFRILNDSGKPMANVPYFISTESGETFKGVTDNQGLCKRVFSKEASKLT
FT                   VWLGVQALERW"
FT   gene            373548..373781
FT                   /locus_tag="SARI_00372"
FT   CDS_pept        373548..373781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00372"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG23217 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20309"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN1"
FT                   /inference="protein motif:HMMPfam:IPR003756"
FT                   /inference="similar to AA sequence:REFSEQ:YP_050337.1"
FT                   /protein_id="ABX20309.1"
FT                   /translation="MKVETISYVKKNAATLDLSEPILVTQNGVPAYVIESYDQQQEREN
FT                   TIALLKLLTLSEKDKAEGRVFSKDQLLDGFAD"
FT   gene            373812..374144
FT                   /locus_tag="SARI_00373"
FT   CDS_pept        373812..374144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00373"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG36091 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20310"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN2"
FT                   /inference="similar to AA sequence:REFSEQ:YP_050336.1"
FT                   /protein_id="ABX20310.1"
FT                   /translation="MKQQVTFEYTLTVKHCIDTIAGFLRRVDVEPRPVIADILTQFESA
FT                   VAQFPLGCQIYPELLKIGCAKYREFNHAEGYRVLHSVDGALVTAHAILAHRQDVQQLLF
FT                   KRLIMA"
FT   gene            374683..374838
FT                   /locus_tag="SARI_00374"
FT   CDS_pept        374683..374838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00374"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0790 FOG: TPR repeat, SEL1 subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20311"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN3"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="similar to AA sequence:INSD:CAD08375.1"
FT                   /protein_id="ABX20311.1"
FT                   /translation="MYAASDYVIPDYKLAIKWLEKSVKQGAYFSYFVIGYHYNYGKNFP
FT                   LNKKTR"
FT   gene            374835..375095
FT                   /locus_tag="SARI_00375"
FT   CDS_pept        374835..375095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_2705 0.00024 Sel1-like repeat protein
FT                   K01467; COG: COG0790 FOG: TPR repeat, SEL1 subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20312"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN4"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="protein motif:HMMPfam:IPR006597"
FT                   /inference="protein motif:HMMSmart:IPR006597"
FT                   /protein_id="ABX20312.1"
FT                   /translation="MKWYRKAAVLGGFTQEILGDACMYGNGIPQNTQMGLAWYRKAAER
FT                   GWLKRKKLLLVCICEAKGYRRITNKCFAGIPESRKPSCRND"
FT   gene            complement(375359..375550)
FT                   /locus_tag="SARI_00376"
FT   CDS_pept        complement(375359..375550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00376"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13900 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20313"
FT                   /db_xref="InterPro:IPR022576"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN5"
FT                   /inference="similar to AA sequence:INSD:AAL21400.1"
FT                   /protein_id="ABX20313.1"
FT                   /translation="MSQANSMRKRHRFNTRMTRIVLLISFLFFFGRFVYSSIGAWQHHQ
FT                   DKKEAQQSTLSVNTPGQR"
FT   gene            375964..378177
FT                   /locus_tag="SARI_00377"
FT   CDS_pept        375964..378177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3829 5.3e-23 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s) K01745;
FT                   COG: COG2199 FOG: GGDEF domain; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20314"
FT                   /db_xref="GOA:A9MHN6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN6"
FT                   /inference="protein motif:HMMPfam:IPR001633"
FT                   /inference="protein motif:HMMPfam:IPR007895"
FT                   /inference="protein motif:HMMSmart:IPR000160"
FT                   /inference="protein motif:HMMSmart:IPR001633"
FT                   /protein_id="ABX20314.1"
FT                   /translation="MKLNKTYINIRDKWWGLPLLLPSILLPVLSSANTYAHTSTGNVVL
FT                   FYLPLAFMFSLMLFFGWAALPGIVIAIFWRTYPQMGLYETLSVTMHFIITIVLSWGGYR
FT                   VFAPRRNNVSHGDARLIFQRMFWQVFCSATLFLVIYQCAAFVGMYESKSSLMGIMPFNI
FT                   NTLINYQALLVGNLIGVPLCYFIIRTIRNPLHLRGYYQQLKLQVDSKTTKKEIVIWLAV
FT                   LITLMFILCMPLTDNSSIFSTNYTLSLLLPVMLWGAMHYGYKFISIIWAFVLITSIHYY
FT                   QRYMPWYSGYDTQLAITSSSYLVFSFIVNYMAVLATRQRVVSSRARRLAYLDPVVHLPN
FT                   LRALNRALKNAPCSTLCFLHVPGLELLGKNYGVMLRIQYKQKLSHWITQMLASNECVYQ
FT                   MSGHDLVLRLNTESYQQRIEALDKHIKQFRFIWDGLPLQPPVGVSYCCVRSPVSHLYLL
FT                   LGELGTSSDLSLTTNAPEDLQRRGAVHLQRDLKGRVAMMNRLQQALEHDHFFLMAQPIS
FT                   GVRGDVYHEILLRLRDENGDVINPDNFLPVAHEFGLSSAIDLWVIENTLRFIATSREYM
FT                   PAHRFAVNLSPTSVCRAPFPSEVNQLLTQYQVEPWQLVFEVTESNSLTNADQAQLTLGQ
FT                   LQQFGCQIAIDDFGTGYASYARLKNVNADILKIDGSFIRNIVSNSLDYQIVSSICHLAR
FT                   MKKMQVVAEYVESEEIRSAVLSLGIDYLQGYLIGEPQPLSEIQ"
FT   gene            complement(378213..379754)
FT                   /locus_tag="SARI_00378"
FT   CDS_pept        complement(378213..379754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2743 1.0e-273 ppx; exopolyphosphatase
FT                   K01514; COG: COG0248 Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20315"
FT                   /db_xref="GOA:A9MHN7"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN7"
FT                   /inference="protein motif:HMMPfam:IPR003695"
FT                   /inference="similar to AA sequence:SwissProt:P0A269"
FT                   /protein_id="ABX20315.1"
FT                   /translation="MPIYDKSPRPQEFAAVDLGSNSFHMVIARVVDGAMQIIGRLKQRV
FT                   HLADGLGADNKLSEEAMERGLSCLSLFAERLQGFSPSSVCIVGTHTLRQAQNAADFLKR
FT                   AEKVIPYPIEIISGNEEARLIFMGVEHTQPEKGRKLVIDIGGGSTELVIGENFEPRLVE
FT                   SRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQYRIQGWNVAMGASGTIKA
FT                   AHEVLLALGEKDGFITPERLDELKSEVLKHRSFNALSLPGLSEERKAVFVPGLAILCGV
FT                   FDALAIRELRLSDGALREGVLYEMEGRFRHQDVRSRTAKSLANQYNIDREQARRVLETT
FT                   MQMYEQWQAQQPKLAHPQLEALLRWAAMLHEVGLNINHSGLHRHSAYILQHSDLPGFNQ
FT                   EQQMMMATLVRYHRKAVKLDDMPRFTLFKKKQYLPLIQLLRLGVLLNNQRQATTTPPTL
FT                   RLTTNDNHWTLCFPHDWFSQNALVLLDLEKEQQYWEAVTGWRLNIEEENSPEIAA"
FT   gene            complement(379759..381825)
FT                   /locus_tag="SARI_00379"
FT   CDS_pept        complement(379759..381825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2498 0. ppk; polyphosphate kinase,
FT                   component of RNA degradosome K00937; COG: COG0855
FT                   Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20316"
FT                   /db_xref="GOA:A9MHN8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN8"
FT                   /inference="protein motif:HMMPfam:IPR003414"
FT                   /protein_id="ABX20316.1"
FT                   /translation="MGQEKLYIEKELSWLAFNERVLQEAADKSNPLIERMRFLGIYSNN
FT                   LDEFYKVRFAELKRRIIISEEQGSNSHSRHLLGKIQSRVLKADQEFDGLYNELLLEMAR
FT                   NQIFLINERQLSVNQQSWLRHYFKHYLRQHITPILINRETDLVQFLKDDYTYLAVEIIR
FT                   GDTINYALLEIPSDKVPRFVNLPPETPRRRKPMILLDNILRYCLDDIFKGFFDYDALNA
FT                   YSMKMTRDAEYDLVHEMESSLMELMSSSLKQRLTAEPVRFVYQRDMPAALVDVLREKLT
FT                   ISRYDSIVPGGRYHNFKDFINFPNVGKANLVNKPLPRLRHLWFDKEKFRNGFDAIRERD
FT                   VLLYYPYHTFEHVLELLRQASFDPSVLAIKINIYRVAKDSRIIDSMIHAAHNGKKVTVV
FT                   VELQARFDEEANIHWAKRLTEAGVHVIFSAPGLKIHAKLFLISRREGYDVVRYAHIGTG
FT                   NFNEKTARLYTDYSLLTADARITNEVRRVFNFIENPYRPVTFDYLMVSPQNSRRLLYEM
FT                   IDREIANAQQGLPSGITLKLNNLVDKGLVDRLYAASGSGVQVNLLVRGMCSLIPQLEGI
FT                   SDNIRAISIVDRYLEHDRVYIFVNGGDKQVWLSSADWMTRNIDYRIEVATPILDPRLKQ
FT                   QVLDIIDILFSDTVKARFIDKELSNRYVPRGNRRKVQAQLAIYDYIKSLEQPD"
FT   gene            complement(382014..382652)
FT                   /locus_tag="SARI_00380"
FT   CDS_pept        complement(382014..382652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2741 1.1e-107 purN;
FT                   phosphoribosylglycinamidine myltransferase K00601; COG:
FT                   COG0299 Folate-dependent phosphoribosylglycinamide
FT                   formyltransferase PurN; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20317"
FT                   /db_xref="GOA:A9MHN9"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN9"
FT                   /inference="protein motif:Gene3D:IPR002376"
FT                   /inference="protein motif:HMMPfam:IPR002376"
FT                   /inference="protein motif:HMMPIR:IPR004607"
FT                   /inference="protein motif:HMMTigr:IPR004607"
FT                   /inference="protein motif:ScanRegExp:IPR001555"
FT                   /inference="protein motif:superfamily:IPR002376"
FT                   /inference="similar to AA sequence:INSD:CAD02702.1"
FT                   /protein_id="ABX20317.1"
FT                   /translation="MNIVVLISGNGSNLQAIIDACEAKKLKGTLRAVFSNKADAFGLER
FT                   AREAGIPAQALTADRFDSRDAFDRALIREIDAYAPDVVVLAGFMRILSPAFVAHYHGRL
FT                   LNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFADDSEE
FT                   DITARVQTQEHAIYPLVIGWFAEGRLKMRDNAAWLDGRRLPPQGYASDE"
FT   gene            complement(382652..383704)
FT                   /locus_tag="SARI_00381"
FT   CDS_pept        complement(382652..383704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2499.S 5.0e-185 purM;
FT                   phosphoribosylaminoimidazole synthetase K01933; COG:
FT                   COG0150 Phosphoribosylaminoimidazole (AIR) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20318"
FT                   /db_xref="GOA:A9MHP0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHP0"
FT                   /inference="protein motif:HMMPfam:IPR000728"
FT                   /inference="protein motif:HMMPfam:IPR010918"
FT                   /inference="protein motif:HMMTigr:IPR004733"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461434.2"
FT                   /protein_id="ABX20318.1"
FT                   /translation="MGNQAVTDKTSLSYKDAGVDIDAGNALVDRIKGVVKKTRRPEVMG
FT                   GLGGFGALCALPQKYREPVLVSGTDGVGTKLRLAMDLKRHDAIGIDLVAMCVNDLVVQG
FT                   AEPLFFLDYYATGKLDVDTAASVINGIAEGCLQSGCALVGGETAEMPGMYHGEDYDVAG
FT                   FCVGVVEKSEIIDGSRVAEGDVLIALGSSGPHSNGYSLVRKIIDVSGCDPQTTQLEGKP
FT                   LADHLLEPTRIYVKSVLELIENIDVHAIAHLTGGGFWENIPRVLPENTQAIINESSWQW
FT                   PAIFTWLQTAGNVSRHEMYRTFNCGVGMVIALSAPEADKALALLNEKGENAWQIGIIKA
FT                   SDSEQRVVIK"
FT   gene            384099..384725
FT                   /locus_tag="SARI_00382"
FT   CDS_pept        384099..384725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2495 1.5e-105 upp; uracil
FT                   phosphoribosyltransferase K00761; COG: COG0035 Uracil
FT                   phosphoribosyltransferase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20319"
FT                   /db_xref="GOA:A9MHP1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHP1"
FT                   /inference="protein motif:HMMPfam:IPR000836"
FT                   /inference="protein motif:HMMTigr:IPR005765"
FT                   /inference="similar to AA sequence:INSD:CAD02700.1"
FT                   /protein_id="ABX20319.1"
FT                   /translation="MKIVEVKHPLVKHKLGLMRENDISTKRFRELASEVGSLLTYEATA
FT                   DLETEKVTIEGWNGPVEIDQIKGKKITVVPILRAGLGMMEGVLENVPSARISVVGMYRN
FT                   EETLEPVPYFQKLVSNIDERMALIVDPMLATGGSVIATIDLLKKAGCSSIKVLVLVAAP
FT                   EGIAALEKAHPDVELYTASIDQGLNEHGYIIPGLGDAGDKIFGTK"
FT   gene            384813..386102
FT                   /locus_tag="SARI_00383"
FT   CDS_pept        384813..386102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK0244 1.3e-07 guanine-hypoxanthine
FT                   permease; xanthine/uracil permease family protein K06901;
FT                   COG: COG2233 Xanthine/uracil permeases; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20320"
FT                   /db_xref="GOA:A9MHP2"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHP2"
FT                   /inference="protein motif:HMMPfam:IPR006043"
FT                   /inference="protein motif:HMMTigr:IPR006042"
FT                   /inference="protein motif:ScanRegExp:IPR006042"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149695.1"
FT                   /protein_id="ABX20320.1"
FT                   /translation="MTRRAIGVSERPPLLQTIPLSLQHLFAMFGATVLVPVLFHINPAT
FT                   VLLFNGIGTLLYLFICKGKIPAYLGSSFAFISPVLLLLPLGYEVALGGFIMCGVLFCLV
FT                   SFIVKKAGTGWLDVMFPPAAMGAIVAVIGLELAGVAAGMAGLLTAQGQSPDTKTIIISM
FT                   ATLAVTVFGSVLFRGFLAIIPILIGVLAGYALSFALGVVDTTPIAQAHWFALPTFYTPR
FT                   FEWFAILTILPAALVVIAEHVGHLVVTANIVKKDLVRDPGLHRSMFANGLSTIVSGFFG
FT                   STPNTTYGENIGVMAITRVYSTWVIGGAAIFAILLSCVGKLAAAIQIIPLPVMGGVSLL
FT                   LYGVIGASGIRVLIESKVDYNKAQNLILTSVILIIGVSGAKVHIGAAELKGMALATIVG
FT                   IGLSLIFKLISLLRPEEVVLEANDTQPPHQ"
FT   gene            386173..386898
FT                   /locus_tag="SARI_00384"
FT   CDS_pept        386173..386898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0009 3.8e-15 chromosomal
FT                   replication initiator protein DnaA K00972; COG: COG0593
FT                   ATPase involved in DNA replication initiation; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00384"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20321"
FT                   /db_xref="GOA:A9MHP3"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR022864"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHP3"
FT                   /inference="protein motif:HMMPfam:IPR013317"
FT                   /inference="similar to AA sequence:INSD:AAL21390.1"
FT                   /protein_id="ABX20321.1"
FT                   /translation="MQSWVEVSLNTPAQLSLPLYLPDDETFASFWPGDNASLLAALQNV
FT                   LRQEHSGYIYLWAREGAGRSHLLHAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEHL
FT                   SLVCIDNIECVAGDELWEMAIFDLYNRILESGKTRLLITGDRPPRQLNLGLPDLASRLD
FT                   WGQIYKLQPLSDEDKLQALQLRARLRGFELPEDVGRFLLKRLDREMRTLFMTLDQLDHA
FT                   SITAQRKLTIPFVKEILKL"
FT   gene            complement(386925..387305)
FT                   /locus_tag="SARI_00385"
FT   CDS_pept        complement(386925..387305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA2520 1.2e-32 arsC; arsenate reductase;
FT                   COG: COG1393 Arsenate reductase and related proteins,
FT                   glutaredoxin family; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20322"
FT                   /db_xref="GOA:A9MHP4"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHP4"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR006660"
FT                   /inference="protein motif:HMMTigr:IPR006659"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:AAV76385.1"
FT                   /protein_id="ABX20322.1"
FT                   /translation="MASQGELMTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDT
FT                   PADGATVRELLRMLGMSSARELMRQKEDLYKTLHLADSQLSEEALIQALVEHPKLMERP
FT                   IVVANGQARIGRPPEQVLEILG"
FT   gene            complement(387324..388862)
FT                   /locus_tag="SARI_00386"
FT   CDS_pept        complement(387324..388862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2810 6.6e-238 yfgC; hypothetical
FT                   protein YfgC precursor; COG: COG4783 Putative Zn-dependent
FT                   protease, contains TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00386"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20323"
FT                   /db_xref="GOA:A9MHP5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR030873"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHP5"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="protein motif:HMMPfam:IPR001915"
FT                   /inference="protein motif:HMMPfam:IPR011717"
FT                   /inference="protein motif:HMMPfam:IPR013105"
FT                   /inference="similar to AA sequence:INSD:AAL21388.1"
FT                   /protein_id="ABX20323.1"
FT                   /translation="MKCRSVERYFTALVKGLSQNNRIEVMFRQLKKNLVATLIAAVALG
FT                   QVAPAFADPADTLPDMGTSAGSTLSIGQEMQMGDFYVRQLRGSAPLINDPLLVQYINAL
FT                   GMRLVSHADSVKTPFHFFLINNDEINAFAFFGGNVVLHSALFRYADNESQLASVMAHEI
FT                   SHVTQRHLARAMEDQKRSAPLTWVGALGSILLAMASPQAGMAALTGTLAGTRQGMISFT
FT                   QQNEQEADRIGIQVLQRAGFDPQAMPSFLEKLLDQARYSTRPPEILLTHPLPESRLADA
FT                   RNRANQMHPVVVQSSSDFYLAKARTLGMYNSGRNQLTSDLLEQWSKGNVRQQHAAQYGR
FT                   ALQAMEAGKYDEARKTLQPLLSAEPNNAWYLDLATDIDLGQKRANDAINRLKNARDLRV
FT                   NPVLQLNLANAYLQGGQPKAAETILNRYTFSHKDDGNGWDLLAQAEAALNNRDQELAAR
FT                   AEGYALAGRLDQAISLLSSASSLAKLGSQQQARYDARIDQLRQLQERFKPYTKM"
FT   gene            388995..390062
FT                   /locus_tag="SARI_00387"
FT   CDS_pept        388995..390062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2668 2.0e-28
FT                   phosphoribosylaminoimidazole-succinocarboxamide (SAICAR)
FT                   synthetase K01923; COG: COG0628 Predicted permease; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00387"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20324"
FT                   /db_xref="GOA:A9MHP6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHP6"
FT                   /inference="protein motif:HMMPfam:IPR002549"
FT                   /inference="similar to AA sequence:INSD:AAL21387.1"
FT                   /protein_id="ABX20324.1"
FT                   /translation="MLEMLMQWYRRRFSDPEAIALLVILVAGFSILFFFSGLLAPLLVA
FT                   IVLAYLLEWPTARLQAIGCSRRWATSIVLILFVGILLLMAFVVMPIAWQQGIYLIRDMP
FT                   GMLNKLSDFAATLPRRYPALMDAGIIDAMAENMRTRMLNMGDSVVKYSLASLVGLLTLA
FT                   VYLVLVPLMVFFLVKDKEQMLNAVRRVLPRNRGLAGQVWNEMNQQITNYIRGKVLEMVV
FT                   VGVATWLVFLLFGLNYSLLLAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGLGTEFWSC
FT                   FAVYLIIQALDGNLLVPVLFSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKA
FT                   VVHAWPDGQVTDTSS"
FT   gene            390340..391527
FT                   /locus_tag="SARI_00388"
FT   CDS_pept        390340..391527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_2682 2.6e-60 transcriptional
FT                   regulator, CdaR K01694; COG: COG3835 Sugar diacid
FT                   utilization regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20325"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHP7"
FT                   /inference="protein motif:HMMPfam:IPR008599"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217476.1"
FT                   /protein_id="ABX20325.1"
FT                   /translation="MRVLRKHYLKGYTARQIVQRAMKIIPYSVNVMDEHGVIIASGEPS
FT                   RLHQRHEGAILALKENRIVEIDSATANQLKGVRSGINLPISFHEQLIGVVGITGEPEQV
FT                   RAYAELVKMAAELVIEHMVLIEQRQWDKRYREELINQLILRENSTESLRSMAAYLGIDL
FT                   AVPRVVLIIELSQPDREALRNVMDYFENHARNHLVTFTEFNELIIIKPITLKEGKWNTR
FT                   QEMGELQMFKSWAASSGFSRILVGGYFAGETGLHRSLLTARATQAMAKRQKLRSQYIFY
FT                   HDHALPALLSGLSERWQVQELSRLWLQLAQHDAKGVLQQTLRTWFEHNCDLTQTAKALH
FT                   IHVNTLRYRLQRCEDITHIKINELKSTLWLYIGMELQAESVPTDKLPLPGWNEIC"
FT   gene            391574..392863
FT                   /locus_tag="SARI_00389"
FT   CDS_pept        391574..392863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3106 6.5e-19 ygbN; hypothetical
FT                   permease YgbN K03299; COG: COG2610 H+/gluconate symporter
FT                   and related permeases; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20326"
FT                   /db_xref="GOA:A9MHP8"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHP8"
FT                   /inference="protein motif:HMMPfam:IPR004680"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149700.1"
FT                   /protein_id="ABX20326.1"
FT                   /translation="MLKEALYMTSISTLGAIAALVVAIVLILRRVSPAYGMMAGALVGG
FT                   LIGGADLLQTVSLMVSGAQGIVNAVLRILAAGVLAGVLIESGAANTIAETVVRKVGETR
FT                   ALLALAIATLCLTAVGVFIDVAVITVAPIALSIARNADLSKSAILLAMIGGGKAGNVMS
FT                   PNPNAIAASDAFHVPLTSIMLAGVVPGIVGLIIAYLLAKRLNNKGVGVADHEVTHHDDT
FT                   VARPGFLVAISAPLVAIFLLSLRPFAGISIDPLIALPVGGLVGLLLMGRARHCNQYMVA
FT                   GLMRMAPVAIMLLGTGTLAGIIANSELKDVLIHGLTASGLPSWLLAPVSGAMMSMATAS
FT                   TTAGTAVASGVFSPTLLELGVSALAGAAMIHAGATVLDHLPHGSFFHATGGSVNMQIHE
FT                   RLKLMPYETLVGLTITFISTLMFGFFGFAG"
FT   gene            392869..394008
FT                   /locus_tag="SARI_00390"
FT   CDS_pept        392869..394008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0377 4.9e-194 putative glycerate kinase
FT                   K00865; COG: COG1929 Glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20327"
FT                   /db_xref="GOA:A9MHP9"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHP9"
FT                   /inference="protein motif:HMMPanther:IPR004381"
FT                   /inference="protein motif:HMMPfam:IPR004381"
FT                   /inference="protein motif:HMMTigr:IPR004381"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149701.1"
FT                   /protein_id="ABX20327.1"
FT                   /translation="MKIVIAPDSFKESLSAMAVAEAIEKGFREIYPDADYVKVPMADGG
FT                   EGTVQSMVEASGGRYVDQWVQGPLGQPVTARWGMLGDSDTAVIEMAAASGLHHVSPELR
FT                   NPLNTTSYGTGELIVAALERGVKRIILGIGGSATNDGGAGMMQALGVILRDKQGRSLPP
FT                   GGEALAALASIDLSGCHPLLRQVSITVACDVNNPLCGPQGASAVFGPQKGATAEMMDTL
FT                   DAALENWGRHIYLATGREVVNAPGAGAAGGMGAALLGLLNAELRAGVEIVVETLQLEQA
FT                   VEDADLVITGEGRLDSQSICGKTPIGVARVAKRYNKPVIALAGGLQHDHHVVYQQGIDA
FT                   ALSILSHIVTLPEALHEAEYNLSLSARNVAAIWRLARQA"
FT   gene            complement(394053..394523)
FT                   /locus_tag="SARI_00391"
FT   CDS_pept        complement(394053..394523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecj:JW2465 8.2e-82 bcp; thiol peroxidase,
FT                   thioredoxin-dependent K03564; COG: COG1225 Peroxiredoxin;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20328"
FT                   /db_xref="GOA:A9MHQ0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHQ0"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR013740"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:AAO68086.1"
FT                   /protein_id="ABX20328.1"
FT                   /translation="MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPG
FT                   CTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDENHQVCEQFG
FT                   VWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA"
FT   gene            complement(394523..394969)
FT                   /locus_tag="SARI_00392"
FT   CDS_pept        complement(394523..394969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2806 1.2e-66 gcvR; glycine cleavage
FT                   system transcriptional repressor K03567; COG: COG2716
FT                   Glycine cleavage system regulatory protein; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20329"
FT                   /db_xref="GOA:A9MHQ1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHQ1"
FT                   /inference="protein motif:HMMPfam:IPR002912"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461425.1"
FT                   /protein_id="ABX20329.1"
FT                   /translation="MLGDEFTFIMLLSGTWNAITLIESTLPLKGAELDLLIVMKRTSDR
FT                   PRPAMPATVWVQVEVADSPHLIERFTALFDSHEMNIAELVSRTQPAEGDKAAQLFIQIT
FT                   AHSPASQNSANIEQAFKALCTELNAQGSINVVNYSQHDEQDGVK"
FT   gene            395241..396119
FT                   /locus_tag="SARI_00393"
FT   CDS_pept        395241..396119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2484 2.0e-151 dapA; dihydrodipicolinate
FT                   synthase K01714; COG: COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00393"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20330"
FT                   /db_xref="GOA:A9MHQ2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHQ2"
FT                   /inference="protein motif:BlastProDom:IPR002220"
FT                   /inference="protein motif:FPrintScan:IPR002220"
FT                   /inference="protein motif:Gene3D:IPR013785"
FT                   /inference="protein motif:HMMPfam:IPR002220"
FT                   /inference="protein motif:HMMPIR:IPR002220"
FT                   /inference="protein motif:HMMTigr:IPR005263"
FT                   /inference="protein motif:ScanRegExp:IPR002220"
FT                   /inference="similar to AA sequence:INSD:AAX66390.1"
FT                   /protein_id="ABX20330.1"
FT                   /translation="MFTGSIVALVTPMDEKGNVSRSCLKKLIDYHVANGTSAIVSVGTT
FT                   GESATLSHDEHGDVVMMTLELADGRIPVIAGTGANATAEAISLTQRFNDSGVVGCLTVT
FT                   PYYNRPTQEGLFQHFKAIAEHTDLPQILYNVPSRTGCDMLPETVGRLAEIKNIIAIKEA
FT                   TGNLTRVHQIKELVSDDFILLSGDDASALDFMQLGGHGVISVTANVAARDMADMCKLAA
FT                   EGQFTEARVINQRLMPLHNKLFVEPNPIPVKWACKALGLVATDTLRLPMTPITDNGRDI
FT                   VKAALQHAGLL"
FT   gene            396136..397170
FT                   /locus_tag="SARI_00394"
FT   CDS_pept        396136..397170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00394"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3317 Uncharacterized lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20331"
FT                   /db_xref="GOA:A9MHQ3"
FT                   /db_xref="InterPro:IPR010653"
FT                   /db_xref="InterPro:IPR014524"
FT                   /db_xref="InterPro:IPR042268"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHQ3"
FT                   /inference="protein motif:HMMPfam:IPR010653"
FT                   /inference="protein motif:ScanRegExp:IPR001360"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461423.1"
FT                   /protein_id="ABX20331.1"
FT                   /translation="MAYSVQKSRLAKVAGVSLVLLLAACSSDSRYKRQVSGDESYLDAA
FT                   PLAELHAPAGMILPITTGDYVIPVTKGSGAVGKALDIRPPAQPLALVSGARTQFSGDTA
FT                   TLLVENGRSSTLWPQVVSVIQAKNYPIEKRDDASQTLMTDWVNWNRLDEDEQYRGRYQI
FT                   SVKPQGYQQAVTVKLVNLEQAGKPVADAASLQRYSTEMMNVISAGLDKTATDAANAAQS
FT                   RSAATMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKAGMKVTDSTRSQGSMAVTYK
FT                   PLSDSDWRELGASDPGLPSGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQA
FT                   AFNK"
FT   gene            397356..398069
FT                   /locus_tag="SARI_00395"
FT   CDS_pept        397356..398069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2487 1.0e-122 purC;
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthetase
FT                   (SAICAR synthetase) K01923; COG: COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20332"
FT                   /db_xref="GOA:A9MHQ4"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHQ4"
FT                   /inference="protein motif:BlastProDom:IPR001636"
FT                   /inference="protein motif:Gene3D:IPR013816"
FT                   /inference="protein motif:HMMPanther:IPR001636"
FT                   /inference="protein motif:HMMPfam:IPR001636"
FT                   /inference="protein motif:HMMTigr:IPR001636"
FT                   /inference="protein motif:ScanRegExp:IPR001636"
FT                   /inference="similar to AA sequence:INSD:AAV76394.1"
FT                   /protein_id="ABX20332.1"
FT                   /translation="MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEKFDR
FT                   KGMVNNKFNHFIMTKLAEAGIPTQMERLLSDTECLVKKLEMVPVECVVRNRAAGSLVKR
FT                   LGVEEGMELNPPIFDLFLKNDALHDPMVNSSYCETFGWVSQENLARMKALTYKANDVLK
FT                   KLFDDAGLILVDFKLEFGLYKGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLI
FT                   EAYEAVARRLGVKLD"
FT   gene            398269..399063
FT                   /locus_tag="SARI_00396"
FT   CDS_pept        398269..399063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2802 1.4e-134 ypfJ; hypothetical
FT                   protein; COG: COG2321 Predicted metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00396"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20333"
FT                   /db_xref="GOA:A9MHQ5"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHQ5"
FT                   /inference="protein motif:HMMPfam:IPR007343"
FT                   /inference="protein motif:ScanRegExp:IPR006025"
FT                   /inference="similar to AA sequence:INSD:AAV76395.1"
FT                   /protein_id="ABX20333.1"
FT                   /translation="MGGPGFRLPRGKGGIILLVVVLVAGYYGVDLTSLLTGQPVSQQQS
FT                   TRSISPNDDEAAKFTSVILATTEDTWGQLFQKMGRGYQQPKLVMYRGMTRTGCGAGQSV
FT                   MGPFYCPADGTVYIDLSFYDDMKNKLGADGDFAQGYVIAHEVGHHVQKLLGIEPKVRQL
FT                   QQNASQTEVNRLSVRMELQADCFAGVWGHSMQQQGVLEAGDLEEALNAAQAIGDDRLQQ
FT                   QGQGRVVPDSFTHGTSEQRYSWFKRGFDSGDPAQCNTFGKNF"
FT   gene            399079..401097
FT                   /locus_tag="SARI_00397"
FT   CDS_pept        399079..401097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00397"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1444 Predicted P-loop ATPase fused to an
FT                   acetyltransferase; Psort location: CytoplasmicMembrane,
FT                   score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20334"
FT                   /db_xref="GOA:A9MHQ6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="InterPro:IPR033442"
FT                   /db_xref="InterPro:IPR038321"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHQ6"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="protein motif:HMMPfam:IPR007807"
FT                   /protein_id="ABX20334.1"
FT                   /translation="MSDIDALQALTSQMIQEGIRRLLVISGDAAWCRERAEAMRAALPG
FT                   DWLWVAPDAPAEPRCTPQALQMLLGREFRHAIFDAWQGFDAAAFAALSGTLQAGSWLLL
FT                   LMPPYEAWECRPDTDSLRWSDCAQPIPTPQFAQHLKRTLSRDPQTLLWRQNLPFCWPSY
FT                   PARERWRPATGEPQPDQAAILSRLLEMPPGVATVIAARGRGKSALAGQFISQMTGTAIV
FT                   TAPAKSATDILATFAGGRFCFIAPDALLASEARADWLVVDEAAAIPAPLLLQLVSRFPR
FT                   TLLTTTVQGYEGTGRGFLLKFCARFPQLHRFTLRQPVRWAPECPLENIVSEALIFDDEA
FT                   FAQAPHGAIAISAFYQQAWGETPALPRAVYQLLSGAHYRTSPLDLRRMMDAPGQHFLQA
FT                   TANNRVAGALWLVEEGGLSAELSQAVWCGFRRPRGNLVAQSLAAHGSDPLAATLVGRRV
FT                   SRIAVHPARQREGIGQQLIACACVQAAQCDYLSVSFGYTPELWRFWQRCGFVLVRMGNH
FT                   REASSGCYTAMALLPLSDAGKRLAQQEHRRLRRDADILTQWNGEAIPLAALREQALDDE
FT                   DWRELVGFAFAHRPLLTSLGCLHRLLQYSALPLPALRGRLEEKASDAELCARLHVSGRK
FT                   ALLALQRAQAAQAVIALDAGRTQRLRDVMPGGENHAG"
FT   gene            complement(401124..401324)
FT                   /locus_tag="SARI_00398"
FT   CDS_pept        complement(401124..401324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00398"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13899 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20335"
FT                   /db_xref="GOA:A9MHQ7"
FT                   /db_xref="InterPro:IPR020910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHQ7"
FT                   /inference="similar to AA sequence:SwissProt:Q8XF02"
FT                   /protein_id="ABX20335.1"
FT                   /translation="MDWLAKYWWILVLVFLVGVLLNVIKDLKRIDHKKFLANKPELPPH
FT                   RDFNDKWDDEDDWPKKDQSKK"
FT   gene            complement(401352..402479)
FT                   /locus_tag="SARI_00399"
FT   CDS_pept        complement(401352..402479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2483 4.8e-203 dapE;
FT                   succinyl-diaminopimelate desuccinylase K01439; COG: COG0624
FT                   Acetylornithine deacetylase/Succinyl-diaminopimelate
FT                   desuccinylase and related deacylases; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00399"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20336"
FT                   /db_xref="GOA:A9MHQ8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHQ8"
FT                   /inference="protein motif:HMMPfam:IPR002933"
FT                   /inference="protein motif:HMMPfam:IPR011650"
FT                   /inference="protein motif:HMMTigr:IPR005941"
FT                   /inference="protein motif:ScanRegExp:IPR001261"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461418.1"
FT                   /protein_id="ABX20336.1"
FT                   /translation="MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDF
FT                   GDTQNFWAWRGRGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSL
FT                   AAMVVAAERFVAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEP
FT                   SSTEIVGDVVKNGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRG
FT                   NDFFPATSMQVANIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEKHQLR
FT                   YTVDWWLSGQPFLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVEL
FT                   GPVNATIHKINECVNAADLQLLARMYQRIMEQLVA"
FT   gene            complement(402483..402839)
FT                   /locus_tag="SARI_00400"
FT   CDS_pept        complement(402483..402839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2797 7.4e-49 yffB; conserved
FT                   thioredoxin-like protein; COG: COG1393 Arsenate reductase
FT                   and related proteins, glutaredoxin family; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20337"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHQ9"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR006660"
FT                   /inference="protein motif:HMMTigr:IPR006504"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:CAD02682.1"
FT                   /protein_id="ABX20337.1"
FT                   /translation="MITLYGIKNCDTIKKARRWLEEHGIDYRFHDYRVDGIDLSLINTF
FT                   IAELGWQPLLNTRGTTWRKLDEGDRSGITDADSAAALMVEQPAIIKRPLLCAPGKPMLL
FT                   GFSESRYQQFFDEV"
FT   gene            complement(403413..406526)
FT                   /locus_tag="SARI_00401"
FT   CDS_pept        complement(403413..406526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2351 3.6e-111 yegO; hypothetical
FT                   protein YegO K07789; COG: COG0841 Cation/multidrug efflux
FT                   pump; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20338"
FT                   /db_xref="GOA:A9MHR0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHR0"
FT                   /inference="protein motif:FPrintScan:IPR001036"
FT                   /inference="protein motif:HMMPfam:IPR001036"
FT                   /inference="protein motif:HMMTigr:IPR004764"
FT                   /protein_id="ABX20338.1"
FT                   /translation="MANFFIDRPIFAWVLAILLCLTGALAIFSLPVEQYPDLAPPNVRI
FT                   TANYPGASAQTLENTVTQVIEQNMTGLDNLMYMSSQSSGTGQATITLSFIAGTDPDEAV
FT                   QQVQNQLQSAMRKLPQAVQDQGVTVRKTGDTNILTIAFVSTDGSMDKQDIADYVASNIQ
FT                   DPLSRVNGVGDIDAYGSQYSMRIWLDPAKLNSFQMTAKDVTDAIASQNAQIAVGQLGGT
FT                   PSVDKQALNATINAQSLLQTPQQFRDITLRVNQDGSEVQLGDVATVEMGAEKYDHLSRF
FT                   NGNPASGLGVKLASGANEMATAKLVLDRLNELAQYFPHGLEYKIAYETTSFVKASIIDV
FT                   VKTLLEAIALVFLVMYLFLQNFRATLIPTIAVPVVLMGTFSVLYAFGYSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERIMSEEGLTPREATRKSMGQIQGALVGIAMVLSAVFVPMAF
FT                   FGGTTGAIYRQFSITIVSAMVLSVLVAMILTPALCATLLKPLRKGEQHGQTGFFGWFNR
FT                   TFNRNAERYEKSVAKILHRSLRWILIYVLLLGGMVFLFLRLPTSFLPQEDRGMFTTSIQ
FT                   LPSGSTQQQTLKVVEKVENYYFTHEKDNIMSVFSTVGSGPGGNGQNVARMFVRLKDWDA
FT                   RDPTTGTSFAIIERATKAFSQIKEARIFASSPPAISGLGSSAGFDMELQDHAGAGHDAL
FT                   MAARDQLIELAGKNSSLTRVRHNGLDDSPQLQIDIDQRKAQALGVSIDDINDTLQTAWG
FT                   SSYVNDFMDRGRVKKVYVQAAAKYRMLPDDINLWYVRNKDGGMVPFSAFATSRWETGSP
FT                   RLERYNGYSAVEIVGEAAPGVSTGTAMDTMESLVHQLPGGFGLEWTAMSYQERLSGAQA
FT                   PALYAISLLVVFLCLAALYESWSVPFSVMLVVPLGVIGALLATWMRGLENDVYFQVGLL
FT                   TVIGLSAKNAILIVEFANEMNQKGHSLLDATLHASRQRLRPILMTSLAFIFGVLPMATS
FT                   NGAGSGSQHAVGTGVMGGMISATILAIFFVPLFFVLIRRRFPLKPRPE"
FT   gene            complement(406716..408413)
FT                   /locus_tag="SARI_00402"
FT   CDS_pept        complement(406716..408413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2480 2.8e-285 narQ; sensory histidine
FT                   kinase in two-component regulatory system with NarP ( NarL)
FT                   K07674; COG: COG3850 Signal transduction histidine kinase,
FT                   nitrate/nitrite-specific; Psort location:
FT                   CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20339"
FT                   /db_xref="GOA:A9MHR1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHR1"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMPfam:IPR011712"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR003660"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="similar to AA sequence:INSD:AAL21374.1"
FT                   /protein_id="ABX20339.1"
FT                   /translation="MTVKRPVSASLAKAFFYIVLLSILSTGSALLTLTSSLRDAEAINI
FT                   AGSLRMQSYRLGYDLQSRSPQINAHRQLFQHALNSPVLRNLNAWYVPQAVKNRYARLHA
FT                   NWLEMNSRLQGGDIAWYQTNINNYVDQIDLFVLALQHYAERKVMLVVAISLAGGIGIFT
FT                   LVFFTLRRIRQQVVRPLNQLVTASQRIEHGQFAPLPLDTSLSNELGLLAKTFSQMSSEL
FT                   HKLYRSLEASVEEKTRDLHEAHRRLEVLYQCSQALNTSQIDVHCFRHILRIVREHDAAW
FT                   YLKLTVGDNWRISEGTQRPNLPVQILPVTMQDTVYGELHWQSPNVDASTPLLNSVSTML
FT                   GRGLYFNQAQKHFQQLLLMEERATIARELHDSLAQVLSYLRIQLTLLKRAIPEDNACAQ
FT                   SIMTDFSRALNDAYRQLRELLTTFRLTLQQADLPSALHEMLEDLQSQTPAKLTLDCRLP
FT                   TLALDAQMQVHLLQIVREAVLNAIKHANATEIAVSCVTAPDGDHTVYIHDNGIGIGEPH
FT                   EPVGHYGLNIMRERAERLGGTLNFSQPSGGGTLVSISFRSSSGEDIAS"
FT   gene            complement(408574..408822)
FT                   /locus_tag="SARI_00403"
FT   CDS_pept        complement(408574..408822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20340"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHR2"
FT                   /protein_id="ABX20340.1"
FT                   /translation="MSDRAVRTATGAGRILAMMTCYRAALMLMFDDSNSGLIALWRQYM
FT                   SLIIVSHYTGDLAGMAPQALLAIGHNKTIHGVLLFWL"
FT   gene            408901..410559
FT                   /locus_tag="SARI_00404"
FT   CDS_pept        408901..410559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2794 1.3e-257 aegA, yffG; putative
FT                   oxidoreductase Fe-S subunit K00264; COG: COG0493
FT                   NADPH-dependent glutamate synthase beta chain and related
FT                   oxidoreductases; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20341"
FT                   /db_xref="GOA:A9MHR3"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHR3"
FT                   /inference="protein motif:BlastProDom:IPR001327"
FT                   /inference="protein motif:FPrintScan:IPR000759"
FT                   /inference="protein motif:FPrintScan:IPR001100"
FT                   /inference="protein motif:FPrintScan:IPR013027"
FT                   /inference="protein motif:HMMPfam:IPR001327"
FT                   /inference="protein motif:HMMPfam:IPR013027"
FT                   /inference="protein motif:HMMTigr:IPR006006"
FT                   /inference="protein motif:superfamily:IPR009051"
FT                   /inference="similar to AA sequence:INSD:AAL21373.1"
FT                   /protein_id="ABX20341.1"
FT                   /translation="MQMILTPVASNQFKASAHKCDLCQGRENGPACVENCPADALQLIT
FT                   EASLTRLAKTRRLRTARQEIRPWHTVDTERSGATRSKVERMQATPPRGEPDKLAIEARK
FT                   TTFEEIYLPFRTVQAEREAARCLTCGEHSICEWTCPLHNHIPQWIELVKAGDIDAAVAL
FT                   SHQTNCLPEITGRVCPQDRLCEGACTLRDEYGAVTIGNIERYISDRALSKGWRPDLSDV
FT                   QKIDKRVAIIGAGPAGLACADVLARNGVSATVYDRHPEIGGLLTFGIPAFKLDKSLLAR
FT                   RREIFSAMGIRFELNCEVGKDISLATLLETYDAVFVGVGTYRSMKAGLPNEDAPGVYDA
FT                   LPFLIANTKQVMGLSESPDAPFIDTADLNVVVLGGGDTAMDCVRTALRHGAAKVTCAYR
FT                   RDEANMPGSKKEVKNAREEGANFEFNVQPVELVLDTQGRVSGIRFLRTQLGEPDGQGRR
FT                   RPVPVPGSEFVMPADAVIMAFGFHPHGMPWLESHGVKVDDWGRIAASVESAFRYQTSNP
FT                   KIFAGGDAVRGADLVATAMAEGRHAAQGMLDWFGK"
FT   gene            complement(410933..411357)
FT                   /pseudo
FT                   /locus_tag="SARI_00405"
FT                   /note="Pseudogene compared to gi|16765798|ref|NP_461413.1|
FT                   hypothetical protein STM2478 [Salmonella typhimurium LT2]"
FT   gene            411411..412013
FT                   /locus_tag="SARI_00406"
FT   CDS_pept        411411..412013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2793 7.2e-90 yffH; hypothetical
FT                   protein YffH K01515; COG: COG0494 NTP pyrophosphohydrolases
FT                   including oxidative damage repair enzymes; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20342"
FT                   /db_xref="GOA:A9MHR4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MHR4"
FT                   /inference="protein motif:Gene3D:IPR000086"
FT                   /inference="protein motif:HMMPfam:IPR000086"
FT                   /inference="protein motif:HMMTigr:IPR004385"
FT                   /inference="protein motif:superfamily:IPR000086"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457011.1"
FT                   /protein_id="ABX20342.1"
FT                   /translation="MFLLHPGASMSQNITLIKDKILSDNYFTLRNITYDLTRRNGKVIR
FT                   HKREVYDRGNGATILLYNSTKKTVVLVRQFRVATWVNGNEDGMLIETCAGLLDNDEPEV
FT                   CIRKEAIEETGYDVGEVRKIFELYMSPGGVTELIHFFIAEYRDSERASTGGGVEDEDIE
FT                   VLELPFSRALEMARSGEIRDGKTVLLLNYLHMSHLMG"
FT   gene            412138..413181
FT                   /locus_tag="SARI_00407"
FT   CDS_pept        412138..413181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00407"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06758 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20343"
FT                   /db_xref="InterPro:IPR009560"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHR5"
FT                   /inference="protein motif:HMMPfam:IPR009560"
FT                   /inference="similar to AA sequence:INSD:AAL21370.1"
FT                   /protein_id="ABX20343.1"
FT                   /translation="MRYRVILFCLLGLLPVQLLWAAPAQRTFSDWQVTCNNQHFCVARN
FT                   TGEHHGLVMTLSRSAGARTDAVLRIDRGGLAPPDAKEAAIAPRLLLDGKPLSFNTPHWR
FT                   VSPWHLMTDDPATIIAFLQTIQDAQAITLKNGVQTLSLAGLKAALLFIDAQQKRVGSET
FT                   AWVEKGNEPPLSVPPAPALKGIAIINPTPVPLSEEERNDLLDYAAWRVNGIRCSLDPLR
FT                   REVQVSALTDNKALLIVNCEAGAYNTIDLAWIVSRKKTLVSRAVRLRLPFNRGVESKDM
FT                   ELMNAFFDEKTHELVTLAKGRGLTDCGIQTRWRYDGDRFRLVRYAEEPSCDNWHGPDAW
FT                   PTLWITR"
FT   gene            413310..413540
FT                   /locus_tag="SARI_00408"
FT   CDS_pept        413310..413540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00408"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG31287 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20344"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHR6"
FT                   /inference="similar to AA sequence:INSD:AAL21369.1"
FT                   /protein_id="ABX20344.1"
FT                   /translation="MKINNGPVLCPHCGCLSAYYEIDRLAAIREKVNKEGGSKAWDSTL
FT                   QAHKKKAFCLMCHKSIDEAVIGQSDAPESAR"
FT   gene            complement(413603..415603)
FT                   /locus_tag="SARI_00409"
FT   CDS_pept        complement(413603..415603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2474 0. tktB; transketolase K00615;
FT                   COG: COG0021 Transketolase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20345"
FT                   /db_xref="GOA:A9MHR7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHR7"
FT                   /inference="protein motif:Gene3D:IPR009014"
FT                   /inference="protein motif:HMMPanther:IPR005478"
FT                   /inference="protein motif:HMMPfam:IPR005474"
FT                   /inference="protein motif:HMMPfam:IPR005475"
FT                   /inference="protein motif:HMMPfam:IPR005476"
FT                   /inference="protein motif:HMMPIR:IPR005478"
FT                   /inference="protein motif:HMMTigr:IPR005478"
FT                   /inference="protein motif:ScanRegExp:IPR005474"
FT                   /inference="protein motif:ScanRegExp:IPR005475"
FT                   /inference="protein motif:superfamily:IPR009014"
FT                   /protein_id="ABX20345.1"
FT                   /translation="MSRKDLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLK
FT                   HNPTDPAWYDRDRFILSNGHASMLLYSLLHLTGYDLPLEELKNFRQLHSKTPGHPEIGY
FT                   TPGVETTTGPLGQGLANAVGLAIAERTLGAQFNQPDHEIVDHYTYVFMGDGCLMEGISH
FT                   EVCSLAGTLGLGKLIGFYDHNGISIDGETEGWFTDDTAKRFEAYHWHVVHDIDGHDPEA
FT                   VKKAILEARSVKDKPSLIICRTVIGFGSPNKAGKEESHGAALGEEEVALTRQKLGWHHP
FT                   AFEIPKEIYRAWDGREKGEKAQQRWQEKFAAYEKAYPELAAEFTRRMSGGLPEAWESAT
FT                   QKFINDLQANPAKIATRKASQNTLNAYGPLLPELLGGSADLAPSNLTIWKGSTSLKEDP
FT                   AGNYIHYGVREFGMTAIANGIAHHGGFVPYTATFLMFVEYARNAARMAALMKARQIMVY
FT                   THDSIGLGEDGPTHQAVEQLASLRLTPNFSTWRPCDQVEAAVGWKLAIERHHGPTALIL
FT                   SRQNLAQVERTPEQVKAIARGGYILKDSGGKPDIILIATGSEMEITLQAAEKLTGEGHN
FT                   VRVVSLPSTDIFDAQEEAYRESVLPSHVTARVAVEAGIADYWYKYVGLKGAIIGMTGYG
FT                   ESAPADKLFPYFGFTVENIVEKARRVLSMKG"
FT   gene            complement(415624..416574)
FT                   /locus_tag="SARI_00410"
FT   CDS_pept        complement(415624..416574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2473 9.0e-163 talA; transaldolase A
FT                   K00616; COG: COG0176 Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20346"
FT                   /db_xref="GOA:A9MHR8"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHR8"
FT                   /inference="protein motif:Gene3D:IPR013785"
FT                   /inference="protein motif:HMMPanther:IPR001585"
FT                   /inference="protein motif:HMMPfam:IPR001585"
FT                   /inference="protein motif:HMMTigr:IPR004730"
FT                   /inference="protein motif:ScanRegExp:IPR001585"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZN83"
FT                   /protein_id="ABX20346.1"
FT                   /translation="MNQLDGIKQFTTVVADSGDIESIRHYQPQDATTNPSLLLKAAGLE
FT                   QYSHLIEDAIAWGKKHGGTQEQQVTAASDKLAVNFGAEILKSIPGRVSTEIDARLSFDK
FT                   EKSIEKARHLVALYQQQNIDKSRILIKLAATWEGIRAAGQLEKEGINCNLTLLFSFAQA
FT                   RACAEAGVYLISPFVGRIYDWYQARSPMDPYIVEEDPGVKSVRNIYDYFKQHRYETIVM
FT                   GASFRRTEQILALTGCDRLTISPNLLKELKEKEEPVIRKLVPSSQMFHRPTPMTEAEFR
FT                   WEHNQDAMAVEKLSEGIRLFAVDQRKLEDLLAAKL"
FT   gene            416846..419125
FT                   /locus_tag="SARI_00411"
FT   CDS_pept        416846..419125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2709 0. maeB; NADP-dependent malate
FT                   dehydrogenase (decarboxylating) K00029; COG: COG0280
FT                   Phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20347"
FT                   /db_xref="GOA:A9MIB0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIB0"
FT                   /inference="protein motif:HMMPfam:IPR002505"
FT                   /inference="protein motif:HMMPfam:IPR012301"
FT                   /inference="protein motif:HMMPfam:IPR012302"
FT                   /inference="protein motif:HMMPIR:IPR012188"
FT                   /inference="protein motif:ScanRegExp:IPR001891"
FT                   /protein_id="ABX20347.1"
FT                   /translation="MDEQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAA
FT                   PCLEIEKDPLAAYKYTARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGI
FT                   DVFDIEVDELDPDKFINVVAALEPTFGGVNLEDIKAPECFYIEQKLRERMNIPVFHDDQ
FT                   HGTAIISTAAILNGLRVVEKNISDVRMVVSGAGAAAIACMNLLVALGMQKHNIVVCDSK
FT                   GVIYKGREPNMAETKAAYAVDDSGKRTLDDVIDGADIFLGCSGPKVLTQEMVKKMARAP
FT                   MILALANPEPEILPPLAKEVRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAIN
FT                   EEMKLAAVHAIAELAHAEQSEVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKA
FT                   AMDSGVATRPIADFDAYIDKLTEFVYKTNLFMKPIFSQARKDPQRVVLPEGEEARVLHA
FT                   TQELITLGLAKPILIGRPSVIEMRIQKLGLQIKAGVDFEIVNNESDPRFKEYWSEYYQI
FT                   MKRRGVTQEQAQRAMIGNHTAIGAIMVQRGEADAMICGTIGDYHEHFGVVKAVFDYRDG
FT                   VHTAGAMNALLLPSGNTFIADTYVNEDPTPEQLAEITVMAAETVRRFGIEPKVALLSHS
FT                   NFGSSNSLSASKMRETLERVRERAPDLMIDGEMHGDAALVESIRNDRMPDSSLKGAANI
FT                   LVMPNMEAARISYNLLRVSSSEGVTVGPVLMGVSKPVHVLTPIASVRRIVNMVALAVVE
FT                   AQTTPL"
FT   gene            419583..421235
FT                   /locus_tag="SARI_00412"
FT   CDS_pept        419583..421235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecc:c4719 1.3e-264 aslA; arylsulfatase K01130;
FT                   COG: COG3119 Arylsulfatase A and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00412"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20348"
FT                   /db_xref="GOA:A9MIB1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIB1"
FT                   /inference="protein motif:HMMPfam:IPR000917"
FT                   /inference="protein motif:ScanRegExp:IPR000917"
FT                   /inference="similar to AA sequence:INSD:ABJ03257.1"
FT                   /protein_id="ABX20348.1"
FT                   /translation="MDFTFSPRQLAIAIAAAIPLAVSAAETPMVATSQNGFAGYDHPNQ
FT                   YIGVSTTKLADNMMPVISHPTQERETRQKLADIEKKTGKKPNIVVFILDDVGWMDVGFN
FT                   GGGVAVGNPTPDIDAVASQGLILTSAYSQPSSSPTRATIMTGQYSVHHGILMPPMYGMP
FT                   GGLEGLTTLPQLLHEQGYVTQAIGKWHMGENTGSQPQNVGFDDFRGFNSVSDMYTEWRD
FT                   PNMNPEVALSPSRYQYIKNLPFDKNDVHAVRGGKQEAVAEITPKYMEDLDQRWMKYGVD
FT                   FINKMAKNDKPFFLYYGTRGCHFDNYPNAHYAGRSPARTSYSDCIVEMNDVFANLYRAL
FT                   ETSGQLDNTLIVFTSDNGPEAEVPPHGRTPFRGAKGSTWEGGVRVPTFVYWKGMIQPRK
FT                   SDGIVDLADLFPTSLSLAGHPGAELAKLVPSKTFIDGVDQSSFFLGTNGQSNRKAEHYF
FT                   LNGELSAVRIDEFKYHLLIQQPFAFTQTGYQGGFTGAITKTAGTTIFNLYTNPQEDDSV
FT                   GVRHIPMGVPLQTEVHNYMEILKKYPPKVQIKL"
FT   gene            complement(421279..422520)
FT                   /locus_tag="SARI_00413"
FT   CDS_pept        complement(421279..422520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syg:sync_2368 3.1e-25 arylsulfatase regulator;
FT                   COG: COG0641 Arylsulfatase regulator (Fe-S oxidoreductase);
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20349"
FT                   /db_xref="GOA:A9MIB2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034491"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIB2"
FT                   /inference="protein motif:HMMPfam:IPR007197"
FT                   /inference="similar to AA sequence:REFSEQ:YP_026259.1"
FT                   /protein_id="ABX20349.1"
FT                   /translation="MLQNIPTQAFHAMAKPSGSDCNLNCAYCFYLEKHALYNHTPQPRM
FT                   TDAMLERYVRDYIASVAPEAEVAFTWQGGEPTLLGLEFYRHAVALQAKYGAGRQISNSF
FT                   QTNGVLLDDAWCEFFVRHHFLIGLSLDGPEEIHNEYRLTKGGRPTHKLVMRALALLQQH
FT                   GVEYNVLACVNRRSARSAEKIYDFFVASGVEFIQFIPVVERLADESAQQSGLTLHAPGD
FT                   AYGTLTDWSVIPEDYGRFLCAVFDRWITRDVGKVFVMNIEWAFANFVGAPGTVCHHQPT
FT                   CGRSVVVEHNGDVYACDHYVYPQFHLGNLNEQTFAAMLDSPQQEAFGKDKYATLPEQCR
FT                   QCPVLRACWGGCPKHRFALTKEGKPGLNYLCAGFRAYFQHLPPYLKAMADLMAMGRPAS
FT                   DIMHAHLHYARSDK"
FT   gene            422834..423169
FT                   /locus_tag="SARI_00414"
FT   CDS_pept        422834..423169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00414"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_00303 0.0048 hydroxyethylthiazole
FT                   kinase K00878; COG: COG4810 Ethanolamine utilization
FT                   protein; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20350"
FT                   /db_xref="GOA:A9MIB3"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIB3"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:HMMPIR:IPR009307"
FT                   /inference="similar to AA sequence:INSD:AAV76409.1"
FT                   /protein_id="ABX20350.1"
FT                   /translation="MNKERIIQEFVPGKQVTLAHLIAHPGEELAKKIGVPDAGAIGIMT
FT                   LTPGETAMIAGDLAMKAADVHIGFLDRFSGALVIYGTVGAVEEALLQTVSGLGRLLNFT
FT                   LCELTKS"
FT   gene            423182..423661
FT                   /locus_tag="SARI_00415"
FT   CDS_pept        423182..423661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2785 4.7e-70 eutP; ethanolamine
FT                   utilization protein EutP K04029; COG: COG4917 Ethanolamine
FT                   utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20351"
FT                   /db_xref="GOA:A9MIB4"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIB4"
FT                   /inference="protein motif:HMMPIR:IPR012381"
FT                   /inference="protein motif:HMMTigr:IPR012381"
FT                   /inference="similar to AA sequence:INSD:AAL21363.1"
FT                   /protein_id="ABX20351.1"
FT                   /translation="MKRIAFVGAVGAGKTTLFNALRGNYSLARKTQAVEFNDHGDIDTP
FT                   GEYFSHPRWYHALITTLQDVDTLIYVHAANDKESRLPAGLLDVGTRKRHIAVISKTDMP
FT                   DADIAATRQLLCEIGFREPIFELNGHDPQSVRQLVDYLAALSEQEEEAGEKTYHS"
FT   gene            423639..424328
FT                   /locus_tag="SARI_00416"
FT   CDS_pept        423639..424328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00416"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4766 Ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20352"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIB5"
FT                   /inference="protein motif:HMMPfam:IPR010424"
FT                   /inference="protein motif:superfamily:IPR011051"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461403.1"
FT                   /protein_id="ABX20352.1"
FT                   /translation="MKKLITANDIRAAHARGEQAMSVVLRASIITPEAREVAELLGFTI
FT                   TECDESVPASTSTQACKSESQRIREAIIAQLPEGQFTESLVAQLMEKVLKEKQSLELGT
FT                   MQPSFTSVTGKGGVKVIDGSSVKFGRFDGAEPHCVGLTDLVTEQDGSSMAAGFMQWDNA
FT                   FFPWTLNYDEIDMVLEGELHVRHEGETLIAKAGDVMFIPKGSSIEFGTPTSVRFLYVAW
FT                   PANWQSV"
FT   gene            424325..425128
FT                   /locus_tag="SARI_00417"
FT   CDS_pept        424325..425128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2467 2.6e-133 eutT; putative cobalamin
FT                   adenosyltransferase, ethanolamine utilization K04032; COG:
FT                   COG4812 Ethanolamine utilization cobalamin
FT                   adenosyltransferase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20353"
FT                   /db_xref="GOA:A9MIB6"
FT                   /db_xref="InterPro:IPR009194"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIB6"
FT                   /inference="protein motif:HMMPfam:IPR002779"
FT                   /inference="protein motif:HMMPIR:IPR009194"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461402.1"
FT                   /protein_id="ABX20353.1"
FT                   /translation="MNDFITETWLRANHTLSEGSEIHLPADARLTPSARELLESRRLRI
FT                   KFLDQQGRLFVDDDEQQPQSVHGLTSSDTYPQACCELCRQPVVKKPDTLTHLTADKMVA
FT                   KSDPRLGFRAALDGAIALTVWLQIELAELWQPWLLDIRSRLGNIMRADALDEPLAAQSI
FT                   VGLSEDELHRLSHQPLRYLDHDHLVPEASHGRDAALLNLLRTKVRETETLAAQVFITRS
FT                   FDVLRPDILQALNRLSSTVYVMMILSVAKHPLTVAQIQQRLGGDQ"
FT   gene            425125..426141
FT                   /locus_tag="SARI_00418"
FT   CDS_pept        425125..426141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2782 3.1e-153 eutD, ypfA, eutI;
FT                   ethanolamine utilization protein EutD acetyl/butyryl
FT                   phosphate transferase K04020; COG: COG0280
FT                   Phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00418"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20354"
FT                   /db_xref="GOA:A9MIB7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIB7"
FT                   /inference="protein motif:HMMPfam:IPR002505"
FT                   /inference="protein motif:HMMPIR:IPR012147"
FT                   /inference="protein motif:HMMTigr:IPR004614"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217449.1"
FT                   /protein_id="ABX20354.1"
FT                   /translation="MIIERARELALRAPARVVFPDALDERVLKAAHYLQQHGLARPILV
FT                   ASPFVLRQFALSHRMALDGIQVIAPPGNLPMRESFAQRWLARAGEKTPSDAVEKLNDPL
FT                   MFAAAMVSAGDADVCIAGNLSSTANVLRAGLRVIGLQPGCQTLSSIFLMLPQYAGQALG
FT                   FADCSVVPQPTAAQLADIAIASADTWRAITGEEPRVAMLSFSSNGSARHPNVANVQQAT
FT                   EIVRERAPQLLVDGELQFDAAFVPEVAAQKAPDSPLQGRANVMIFPSLEAGNIGYKIAQ
FT                   RLGGYRAVGPLIQGLAAPLHDLSRGCSVQEIIELALVAAVPRQADVSSESRLQTLVE"
FT   gene            426182..426472
FT                   /locus_tag="SARI_00419"
FT   CDS_pept        426182..426472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00419"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20355"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIB8"
FT                   /inference="protein motif:BlastProDom:IPR000249"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:ScanRegExp:IPR000249"
FT                   /inference="similar to AA sequence:INSD:AAV76414.1"
FT                   /protein_id="ABX20355.1"
FT                   /translation="MEALGMIETRGLVALIEASDAMVKAARVKLVGVKQIGGGLVTAMV
FT                   RGDVAACKAATDAGAAAAQRIGELVSVHVIPRPHGDLEEVFPISFKGDSNI"
FT   gene            426525..426872
FT                   /locus_tag="SARI_00420"
FT   CDS_pept        426525..426872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00420"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4576 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20356"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIB9"
FT                   /inference="protein motif:BlastProDom:IPR004992"
FT                   /inference="protein motif:HMMPfam:IPR004992"
FT                   /inference="similar to AA sequence:INSD:AAV76415.1"
FT                   /protein_id="ABX20356.1"
FT                   /translation="MPDGAQIQGLRPNGQSTEADMKLAVVTGQIVCTVRHQGLAHDKLL
FT                   MVEMIDAKGNPDGQCAVAIDSIGAGTGEWVLLVSGSSARQAHRSELSPVDLCVIGIVDE
FT                   VVAGGKVVFHK"
FT   gene            426884..428287
FT                   /locus_tag="SARI_00421"
FT   CDS_pept        426884..428287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A0914 5.4e-101 aldehyde dehydrogenase
FT                   K04021; COG: COG1012 NAD-dependent aldehyde dehydrogenases;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20357"
FT                   /db_xref="GOA:A9MIC0"
FT                   /db_xref="InterPro:IPR012408"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIC0"
FT                   /inference="protein motif:HMMPfam:IPR002086"
FT                   /inference="protein motif:HMMPIR:IPR012408"
FT                   /inference="similar to AA sequence:INSD:AAL21357.1"
FT                   /protein_id="ABX20357.1"
FT                   /translation="MNQQDIEQVVKAVLLKMQDSSKPTSTVHEMGVFASLDDAVAAAKL
FT                   AQQGLKSVAMRQLAIHAIREAGEKHARELAELAVSETGMGRVDDKFAKNVAQARGTPGV
FT                   ECLSPQVLTGDNGLTLIENAPWGVVASVTPSTNPAATVINNAISLIAAGNSVVFAPHPA
FT                   AKKVSQRAITLLNQAVVAAGGPENLLVTVANPDIETAQRLFKYPGIGLLVVTGGEAVVD
FT                   AARKHTNKRLIAAGAGNPPVVVDETADLSRAAQSIVKGASFDNNIICADEKVLIVVDSV
FT                   ADELMRLMEGQHAVKLTAAQAEQLQPVLLKNIDERGKGTVSRDWVGRDAGKIAAAIGLN
FT                   VPQQTRLLFVETPASHPFAVTEMMMPVLPVVRVANVEEAIALAVQLEGGCHHTAAMHSR
FT                   NIDNMNQMANAIDTSIFVKNGPCIAGLGLGGEGWTTMTITTPTGEGVTSARTFVRLRRC
FT                   VLVDAFRIV"
FT   gene            428298..429137
FT                   /locus_tag="SARI_00422"
FT   CDS_pept        428298..429137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00422"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4820 Ethanolamine utilization protein,
FT                   possible chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20358"
FT                   /db_xref="InterPro:IPR013366"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIC1"
FT                   /inference="protein motif:HMMTigr:IPR013366"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217445.1"
FT                   /protein_id="ABX20358.1"
FT                   /translation="MAHDEQLWLTPRLQKAAALCHQTPAASDTPLWLGVDLGTCDVVSI
FT                   VVDSDAQPVAVCLDWADVVRDGIVWDFFGAVTIVRRHLDTLEQQLGCRFTHAATSFPPG
FT                   TDPRISINVLESAGLEVSHALDEPTAVADLLQLDNAGVVDIGGGTTGIAIVKQGKVTWS
FT                   ADEATGGHHISLTLAGNRRIPLEEAEQYKRSNAQEIWPIVKPVYEKMAEIVARHIAGQG
FT                   VTDLWLAGGSCMQPGVEALFRQRFPELQVHLPQHSLFMTPLAIANSGRAKAEGLYAS"
FT   gene            429127..430314
FT                   /locus_tag="SARI_00423"
FT   CDS_pept        429127..430314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00423"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2777 2.3e-180 eutG, yffV;
FT                   ethanolamine utilization protein EutG iron-containing
FT                   alcohol dehydrogenase K04022; COG: COG1454 Alcohol
FT                   dehydrogenase, class IV; Psort location: Cytoplasmic,
FT                   score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20359"
FT                   /db_xref="GOA:A9MIC2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIC2"
FT                   /inference="protein motif:HMMPfam:IPR001670"
FT                   /inference="protein motif:ScanRegExp:IPR001670"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217444.1"
FT                   /protein_id="ABX20359.1"
FT                   /translation="MQAELQTALFQAFDTLNLQRVKTFSVPPVTLCGLGALSACGQEAQ
FT                   SRGLSHLFVMVDSFLHQAGMTAPLARSLAMKGVAMTVWPCPPGEPCITDVCAAVAQLRE
FT                   AACDGVVAFGGGSVLDAAKAVALLVTNPDQTLSAMTERSTLRPRLPLIAVPTTAGTGSE
FT                   TTNVTVIIDAASGRKQVLAHASLMPDVAILDAAVTEGVPPNVTAMTGIDALTHAIEAYS
FT                   ALNATPFTDSLAIGAIAMIGKSLPKAVGYGHDLTARENMLLASCMAGMAFSSAGLGLCH
FT                   AMAHQPGAALHIPHGLANAMLLPTVMGFNRMVCRERFSQIGRALTNKKSDDRDAIAAVS
FT                   ELIAEVGQSKRLADAGARPEHYSAWAQAAQDDICMRTNPRTASQVQIIELYVAAQ"
FT   gene            430360..431586
FT                   /locus_tag="SARI_00424"
FT   CDS_pept        430360..431586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00424"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3192 Ethanolamine utilization protein; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00424"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20360"
FT                   /db_xref="GOA:A9MIC3"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIC3"
FT                   /inference="protein motif:HMMPfam:IPR007441"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217443.1"
FT                   /protein_id="ABX20360.1"
FT                   /translation="MGINEIIMYIMMFFMLIAAVDRVLSQFGGSARFLGKFGKSIEGAG
FT                   GQFEEGFMAMGALGLAMVGMTALAPVLAHVLGPVIIPVYEMLGANPSMFAGTLLACDMG
FT                   GFFLAKELAGGDVAAWLYSGLILGSMMGPTIVFSIPVALGIIEPSDRRYLALGVLAGIV
FT                   TIPIGCIAGGLIAMYSGVQINGQPVEFTFTLILMNMIPVLIVAVLVALGLKFIPEKMIN
FT                   GFQIFAKFLVALITIGLAAAVVKFLLGWELIPGLDPIFMAPGDKPGEVMRAIEVIGSIS
FT                   CVLLGAYPMVLLLTRWFEKPLMNVGKLLNVNNIAAAGMVATLANNIPMFGMMKQMDTRG
FT                   KVINCAFAVSAAFALGDHLGFAAANMNAMIFPMIVGKLIGGVTAIGVAMMLVPKDDAAQ
FT                   VKTEAEAQS"
FT   unsure          430527..430561
FT                   /locus_tag="SARI_00424"
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            431583..432986
FT                   /locus_tag="SARI_00425"
FT   CDS_pept        431583..432986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00425"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4819 Ethanolamine utilization protein,
FT                   possible chaperonin protecting lyase from inhibition"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20361"
FT                   /db_xref="GOA:A9MIC4"
FT                   /db_xref="InterPro:IPR009377"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIC4"
FT                   /inference="protein motif:HMMPfam:IPR009377"
FT                   /inference="similar to AA sequence:INSD:AAL21353.1"
FT                   /protein_id="ABX20361.1"
FT                   /translation="MNTRQLLSVGIDIGTTTTQVIFSRLELVNRAAVSQVPRYEFIKRD
FT                   ISWQSPVFFTPVDKQGGLKEAELKTLILAQYQAAGIAPESVDSGAIIITGESAKTRNAR
FT                   PAVMALSQSLGDFVVASAGPHLESVIAGHGAGAQSLSELRMCRVLNIDIGGGTSNYALF
FT                   DAGKVSGTACLNVGGRLLETDGQGRVVHAHQPGQRIIDEVFGAGTDARALTVAQLGQAA
FT                   RRMAALIVEVIAGTLTPLAQSLMQTGLLPADITPEVITLSGGVGECYRHQPADPFCFSD
FT                   IGPLLATALHEHPRLREMNVQFPAQTVRATVIGAGAHTLSLSGSTIWLENVQLPLRNLP
FT                   VAIPQDDADLVNAWRQALLQLDLDPQTDAYVLALPATLPVRYAALLTVIDALTAFVARY
FT                   PNPHPLLVVAEQDLGKALGMLLRPQLPQLPLAVIDEVVVRAGDYIDIGTPLFGGSVVPV
FT                   TVKSLAFPS"
FT   gene            432998..434359
FT                   /locus_tag="SARI_00426"
FT   CDS_pept        432998..434359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0410 1.3e-241 eutB; ethanolamine
FT                   ammonia-lyase heavy chain K03735; COG: COG4303 Ethanolamine
FT                   ammonia-lyase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20362"
FT                   /db_xref="GOA:A9MIC5"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIC5"
FT                   /inference="protein motif:HMMPfam:IPR010628"
FT                   /inference="similar to AA sequence:INSD:AAL21352.1"
FT                   /protein_id="ABX20362.1"
FT                   /translation="MKLKTTLFGNVYQFKDVKEVLAKANELRSGDVLAGVAAASSQERV
FT                   AAKQVLSEMTVADIRNNPVIAYEEDCVTRLIQDDVNETAYNRIKNWSISELREYVLSDE
FT                   TSVDDIAFTRKGLSSEVVAAVAKICSNADLIYGGKKMPVIKKANTTIGIPGTFSCRLQP
FT                   NDTRDDVQSIAAQIYEGLSFGSGDAVIGVNPVTDDVENLTRVLDTVYGVIDKFNIPTQG
FT                   CVLAHVTTQIEAIRRGAPGGLIFQSICGSEKGLKEFGVELAMLDEARAVGAEFNRIAGE
FT                   NCLYFETGQGSALSAGANFGADQVTMEARNYGLARHYDPFLVNTVVGFIGPEYLYNDRQ
FT                   IIRAGLEDHFMGKLSGISMGCDCCYTNHADADQNLNENLMILLATAGCNYIMGMPLGDD
FT                   IMLNYQTTAFHDTATVRQLLNLRPSPEFERWLETMGIMANGRLTKRAGDPSLFF"
FT   gene            434378..435274
FT                   /locus_tag="SARI_00427"
FT   CDS_pept        434378..435274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2457 1.2e-149 eutC; ethanolamine
FT                   ammonia-lyase, light chain K03736; COG: COG4302
FT                   Ethanolamine ammonia-lyase, small subunit; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20363"
FT                   /db_xref="GOA:A9MIC6"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MIC6"
FT                   /inference="protein motif:HMMPfam:IPR009246"
FT                   /inference="similar to AA sequence:INSD:AAC78124.1"
FT                   /protein_id="ABX20363.1"
FT                   /translation="MDQKQIEEIVRSVMASMGQDVPQPVAPSTQEGAKPQRAAPTATES
FT                   CALDLGSAEAKAWIGVENPHRADVLTELRRSTAARVCTGRAGPRPRTQALLRFLADHSR
FT                   SKDTVLKEVPEEWVKAQGLLEVRSEISDKNRYLTRPDMGRRLSQEAIDALKSQCVMNPD
FT                   VQVVISDGLSTDAITANYEEILPPLLAGLKQAGLKVGTPFFVRYGRVKIEDQIGELLGA
FT                   KVVILLVGERPGLGQSESLSCYAVYSPRVTTTVEADRTCISNIHQGGTPPVEAAAVIVD
FT                   LAKRMLEQKASGINMTR"
FT   gene            435284..435943
FT                   /locus_tag="SARI_00428"
FT   CDS_pept        435284..435943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00428"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4816 Ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20364"
FT                   /db_xref="GOA:A9MIC7"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030983"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIC7"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:HMMPIR:IPR009193"
FT                   /inference="similar to AA sequence:INSD:AAX66360.1"
FT                   /protein_id="ABX20364.1"
FT                   /translation="MPALDLIRPSVTAMRVIASVNDGFARELKLPPHIRSLGLITADSD
FT                   DVTYIAADEATKQAMVEVVYGRSLYAGAAHGPSPTAGEVLIMLGGPNPAEVRAGLDAMV
FT                   ASIENGAAFQWANDAENTAFLAHVVSRTGSYLSSTAGIALGDPMAYLVAPPLEATFGID
FT                   AAMKSADVQLVTYVPPPSETNYSAAFLTGSQAACKAACNAFADAVLDIARNPVQRA"
FT   gene            435956..436450
FT                   /locus_tag="SARI_00429"
FT   CDS_pept        435956..436450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00429"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00429"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20365"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR032298"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIC8"
FT                   /inference="protein motif:BlastProDom:IPR000249"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:ScanRegExp:IPR000249"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461390.1"
FT                   /protein_id="ABX20365.1"
FT                   /translation="MNNALGLLEVDGMVAAVDAADAMLKAANVRLLSHQVLDPGRLTLV
FT                   VEGDLAACRAALDAGSAAAQRAGRVISRKEIGRPEEDTQWLIGGFTRAPTSPEKTSDVP
FT                   ATPEFAEALLALLASVRQGMTAGEVAAHFGWPLEQARNVLESLFSDGVLRKRSSRYRIK
FT                   N"
FT   gene            436498..437550
FT                   /locus_tag="SARI_00430"
FT   CDS_pept        436498..437550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00430"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2207 AraC-type DNA-binding domain-containing
FT                   proteins; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20366"
FT                   /db_xref="GOA:A9MIC9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIC9"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR000005"
FT                   /inference="protein motif:HMMSmart:IPR000005"
FT                   /inference="protein motif:ScanRegExp:IPR000005"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:INSD:AAL21348.1"
FT                   /protein_id="ABX20366.1"
FT                   /translation="MKKTRTANLHHLYHEALPEDVKLTPRVEVDNVHQRRTTDVYEHAL
FT                   TITAWQQIYDQLHPGKFHGEFTEILLDDLQVFREYTGLALRQSCVVWPNSFWFGIPATR
FT                   GEQGFIGAQGLGSAEIATRPGGTEFELSTPDDYTILGVVISEDVISRQATFLHNPERVL
FT                   HMLRNQLALEVKEQHKAALWGFVQQALATFSESPETLHQPAVRKVLSDNLLLAMGTMLE
FT                   EAKPIHSAESISHQGYRRLLSRAREYVLENMSEPLTVLDLCNQLHVSRRTMQNAFHAIL
FT                   GIGPNAWLKRIRLNAVRRELISPWSQSTTVKDAAMQWGFWHLGQFATDYQQLFAEKPSL
FT                   TLHQRMRQWA"
FT   gene            complement(437664..438563)
FT                   /locus_tag="SARI_00431"
FT   CDS_pept        complement(437664..438563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0415 1.3e-161 hemF; coproporphyrinogen
FT                   III oxidase K00228; COG: COG0408 Coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20367"
FT                   /db_xref="GOA:A9MID0"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MID0"
FT                   /inference="protein motif:HMMPanther:IPR001260"
FT                   /inference="protein motif:HMMPfam:IPR001260"
FT                   /inference="protein motif:HMMPIR:IPR001260"
FT                   /inference="protein motif:ScanRegExp:IPR001260"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456986.1"
FT                   /protein_id="ABX20367.1"
FT                   /translation="MKPDAQHVKQFLLRLQDDICQTLSAVDGANFIEDSWRREAGGGGR
FT                   SRVLRNGGIFEQAGVNFSHVNGDAMPASATAHRPELVGRSFEAMGVSLVVHPRNPYIPT
FT                   SHANVRFFIAEKPGADPVWWFGGGFDLTPYYGFEEDAVHWHRTARDLCQPFGEDVYPRY
FT                   KKWCDDYFFIKHRNEQRGIGGLFFDDLNTPDFASCFAFMQAVGKGYTEAYLPIVERRKT
FT                   MAWGERERSFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRWEYDYQPK
FT                   EGSPEAALSEFIQVRDWV"
FT   gene            complement(438566..439435)
FT                   /locus_tag="SARI_00432"
FT   CDS_pept        complement(438566..439435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2687 1.0e-147 amiA; probable
FT                   N-acetylmuramoyl-L-alanine amidase K01448; COG: COG0860
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20368"
FT                   /db_xref="GOA:A9MID1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID1"
FT                   /inference="protein motif:HMMPfam:IPR002508"
FT                   /inference="protein motif:HMMSmart:IPR002508"
FT                   /inference="similar to AA sequence:INSD:CAD07681.1"
FT                   /protein_id="ABX20368.1"
FT                   /translation="MSNFKLLKTLTSRRQVLKTGLAALTLSGMSHALAKEDTLKTSNGH
FT                   SKPKTKKTGNKRLVMLDPGHGGIDTGAIGRNGSQEKHVVLAIAKNVRAILRNHGIDARL
FT                   TRTGDTFIPLYDRVEIAHKHGADLFMSIHADGFTNPKAAGASVFALSNRGASSAMAKYL
FT                   SERENRADEVAGKKATDRDHLLQQVLFDLVQTDTIKNSLTLGSHIIKKIKPIHKLHSRT
FT                   TEQAAFVVLKSPSIPSVLVETSFITNPEEERLLGTTAFRQKIATAIANGIISYFHWFDN
FT                   QKAHTKKR"
FT   gene            439648..440073
FT                   /locus_tag="SARI_00433"
FT   CDS_pept        439648..440073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2767 4.7e-70 ypeA; hypothetical
FT                   protein YpeA K00680; COG: COG0456 Acetyltransferases; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20369"
FT                   /db_xref="GOA:A9MID2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="InterPro:IPR023072"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID2"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="similar to AA sequence:SwissProt:P63423"
FT                   /protein_id="ABX20369.1"
FT                   /translation="MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKVNHDVSLF
FT                   LVAEVSGEVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQ
FT                   IMVRDDNDVVLGMYERLGYEHSDALSLGKRLIEDEEY"
FT   gene            440060..440509
FT                   /locus_tag="SARI_00434"
FT   CDS_pept        440060..440509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00434"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG08687 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20370"
FT                   /db_xref="GOA:A9MID3"
FT                   /db_xref="InterPro:IPR021318"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID3"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217434.1"
FT                   /protein_id="ABX20370.1"
FT                   /translation="MKSTEFHPADYDVHGRLRLPFLFWCVLLLQARAWILFVIAGSSRE
FT                   QGNTLLNFFYPDHDNFWLGLLPGVPAVVAFLLSGRREAFPGMWRMLRGWLILAQLVLLC
FT                   WQPALWLSGESVNGAGMALFVVDIVALIWLVTHRRCRACFVSGKE"
FT   gene            440570..441145
FT                   /locus_tag="SARI_00435"
FT   CDS_pept        440570..441145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00435"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06776 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20371"
FT                   /db_xref="InterPro:IPR010938"
FT                   /db_xref="InterPro:IPR038714"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID4"
FT                   /inference="protein motif:HMMPfam:IPR010938"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149742.1"
FT                   /protein_id="ABX20371.1"
FT                   /translation="MKSLRLTLLALPLALTGCSTLSSVNWSAANPWNWFGSSTKVTEQG
FT                   VGDLTAATPLEKQAIAEALDGDYRLRSGMKTDNGNVVRFFEAMKGDNVAMVINGEQGTV
FT                   SRIDVLDSDIPSAAGVKIGTPFSDLYSKAFGHCESASSDSHTNVECKAEGSQHISYVFS
FT                   GEWSGPEGLMPSDDALKNWVVRKIIWRR"
FT   gene            441240..442136
FT                   /locus_tag="SARI_00436"
FT   CDS_pept        441240..442136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B0946 1.3e-42 predicted iron-dependent
FT                   peroxidase K00430; COG: COG2837 Predicted iron-dependent
FT                   peroxidase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20372"
FT                   /db_xref="GOA:A9MID5"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID5"
FT                   /inference="protein motif:HMMPfam:IPR006314"
FT                   /inference="protein motif:HMMTigr:IPR006314"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804281.1"
FT                   /protein_id="ABX20372.1"
FT                   /translation="MSQVQSGILPEHCRAAIWIEANVKGDVDALRAASRTFADKLATFE
FT                   VKFPDANLGAVVAFGNNTWRALSGVGAEELKDFIPYGKGLAPATQYDVLIHILSLRHDV
FT                   NFSVAQAAMEAFGDCIDVKEEVHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGV
FT                   DAGGSYVFVQRWEHNLKQLNRMSIHDQEMMIGRTKEANEEIDGDSRPATSHLSRVDLKE
FT                   EGKGLKIVRQSLPYGTASGTHGLYFCAYCARLHNIEQQLLSMFGDTDGKRDAMLRFTKP
FT                   VTGGYYFAPSLDRLLAL"
FT   gene            complement(442193..443491)
FT                   /locus_tag="SARI_00437"
FT   CDS_pept        complement(442193..443491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oih:OB0667 1.5e-50 beta-lactamase K01467; COG:
FT                   COG1680 Beta-lactamase class C and other penicillin binding
FT                   proteins; Psort location: Periplasmic, score:9.76"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20373"
FT                   /db_xref="GOA:A9MID6"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID6"
FT                   /inference="protein motif:HMMPfam:IPR001466"
FT                   /inference="protein motif:superfamily:IPR012338"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00700450.1"
FT                   /protein_id="ABX20373.1"
FT                   /translation="MNIKLLFASLLAFSCAASATSYPVLTESTPEKVGLNIERLNRLES
FT                   WIAQQVDAGYPSVNLLIIKDNHIVYRKAWGDAKKYDGNTLMRQPIKATTETLYDLASNS
FT                   KMYATNFALQKLMSEGKLKPDDLISKYIPGFVDRPGEAIKGKSMLRVADLLHHSGGFPA
FT                   DPQYPNKTVAGELYSQDKSTTLEMIKRTPLEYRPGTQHIYSDVDYMLLGFIVEAVTGQP
FT                   LDRYVEEAIYRPLGLTHTVFNPLKKGFQPQQIAATELNGNTRDGIIHFPNIRTTTVWGQ
FT                   VHDEKAFYSMGGVSGHAGLFSNTADIAVLMQTMLNGGSYGNVTLFSPETVKMFTRRSPE
FT                   DATFGLGWRVNGNASMTSTFGTLASAEAYGHTGWTGTLTVIDPVNHMAIVMLSNKPHSP
FT                   VADPQKNPNMFKSGLMPVATYGWVVDQIYAALK"
FT   gene            complement(443496..444926)
FT                   /locus_tag="SARI_00438"
FT   CDS_pept        complement(443496..444926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_2451 3.4e-218 putative PTS system IIBC
FT                   component YfdV K02809:K02810; COG: COG1263
FT                   Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00438"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20374"
FT                   /db_xref="GOA:A9MID7"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID7"
FT                   /inference="protein motif:HMMPfam:IPR001996"
FT                   /inference="protein motif:HMMPfam:IPR003352"
FT                   /inference="protein motif:ScanRegExp:IPR001996"
FT                   /inference="similar to AA sequence:REFSEQ:YP_670341.1"
FT                   /protein_id="ABX20374.1"
FT                   /translation="MAKEISNDLLKAILARVGGPANIATCGNCMTRLRLSVHDSTQVDP
FT                   AIRTLEGVKGVVLSDNQVQVIFGPGKAQRAADAMNALLANSGETLMQAADIAAKTKSQL
FT                   KAKQTSGVQQFLSKFATIFTPLIPGFIAAGLLLGIATLIGTVMHLPADAQGMLADALNL
FT                   MKVFSKGLFTFLVILIGYNAAQAFGGTGVNGAIIASLFLLGYNPAATTGYFSGIQDFFG
FT                   LPIDPRGNIIGVLIAAWASARIECIIRRFMPDDLDMLLTSMLTLLVTAALAYLIIMPLG
FT                   GWLFEGMSWLFIHLNSNPLGCAVLAGLFLVSVVFGVHQGFIPVYLALMSSQGFNSLFPI
FT                   LSMAGAGQVGAALALYWRAERHSALRSQVRGAIIPGLLGVGEPLIYGVTLPRMKPFITA
FT                   CLGGAAGGLFIGLVAWSGLPMGLNSAFGPSGLVALPLMTSAQGILPAMAVYAAGMAISY
FT                   LGGFIFTVLFGCRNVNLD"
FT   gene            complement(444932..445828)
FT                   /locus_tag="SARI_00439"
FT   CDS_pept        complement(444932..445828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_2606 6.0e-06
FT                   glucosamine--fructose-6-phosphate aminotransferase,
FT                   isomerizing K00820; COG: COG2103 Predicted sugar phosphate
FT                   isomerase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20375"
FT                   /db_xref="GOA:A9MID8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID8"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="protein motif:HMMTigr:IPR005488"
FT                   /inference="protein motif:ScanRegExp:IPR005486"
FT                   /inference="similar to AA sequence:REFSEQ:NP_311326.1"
FT                   /protein_id="ABX20375.1"
FT                   /translation="MQLENLMTESVNRASLEIDRVSTLDMCRIINNEDKTVPLAVEKVL
FT                   PAIATAIDVIYAQVSAGGRMIYIGAGTSGRLGILDASECPPTYGVSPGLVIGLIAGGEQ
FT                   AIQHAIEGAEDDGEGGETDLQHIALSENDVVIGIAASGRTPYVIAGLEYARSLGCRTVG
FT                   ISCNPGSAVANAAEIAITPVVGPEVVSGSSRMKAGTAQKLILNMLSTGLMIKSGKVFGN
FT                   LMVDVVATNEKLHLRQITIVKNATGCTRQEAEAALSACGRHCKTAIVMLLKNLNAAEAS
FT                   LRLEQHGGFIRQVLEKE"
FT   gene            complement(445842..446432)
FT                   /locus_tag="SARI_00440"
FT   CDS_pept        complement(445842..446432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20376"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID9"
FT                   /inference="similar to AA sequence:REFSEQ:YP_854939.1"
FT                   /protein_id="ABX20376.1"
FT                   /translation="MNNSFIPAAALLFCSQALAAPHLFIGDNVNVLAARSAKVSIFSKD
FT                   VVLPDGVQKMVVKFDSPVNPESVNNNRGRVTSNPYILSFNASGNVDIQLSAGKPLDEKE
FT                   ASQMAQKPAFTLIAGGKPVPFDIKMLDRDSITVFTDLSAIVNEDSVMIPSPARSTAPAT
FT                   APLAHNELSKLQQLYLKADDTQKKAFLKWALNL"
FT   gene            complement(446458..447543)
FT                   /locus_tag="SARI_00441"
FT   CDS_pept        complement(446458..447543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00441"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3203 Outer membrane protein (porin); Psort
FT                   location: OuterMembrane, score:9.93"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20377"
FT                   /db_xref="GOA:A9MIE0"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE0"
FT                   /inference="protein motif:HMMPfam:IPR001702"
FT                   /inference="similar to AA sequence:REFSEQ:YP_854940.1"
FT                   /protein_id="ABX20377.1"
FT                   /translation="MKLTLKSLATLTLLATSASHAAVIYQANDGSNIDLYGRLGFNISD
FT                   KKTGDTSGDFDARIGFSARQAINDKLAVIGFTQYQVNAAEYANNISAEDPDDFTARYVW
FT                   AGIDFSEYGKLTGGRVSSGLIMFTDIGDVFASSDVAMARQANFVDPTAVQVFRQDGTIQ
FT                   YQNTFGNLDFSTAYILGNNTSDLDYGYNAALRYTLDMGEFGRLQPVIAGQTEKASHDKT
FT                   SAQSDDNADKYTFYGIGTRYYLGDVMLGLLVAQDKVSYLDGSPDSTDTDYEATLVWNVS
FT                   PDWALRTGYRHLKNEDGDGLKLRDTTFEAQYKLTVRSSVFASYSWRNGEKGTKRTNGSD
FT                   VSFGGSNPADDYFHLGLRYEF"
FT   gene            447746..448609
FT                   /locus_tag="SARI_00442"
FT   CDS_pept        447746..448609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0825 3.2e-22 glucokinase K00845; COG:
FT                   COG1737 Transcriptional regulators; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20378"
FT                   /db_xref="GOA:A9MIE1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR022821"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MIE1"
FT                   /inference="protein motif:HMMPfam:IPR000281"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00737907.1"
FT                   /protein_id="ABX20378.1"
FT                   /translation="MLYLAKMRNAEGEFTENEQKIATFLLAHVGELKTVSSRNMAKQLE
FT                   ISQSSIVKFAQKLGANGFTELRMALIEEHSVSREKKRDKAVHLHSSITSEDSLEMMARK
FT                   LNREKIVALEETYNLMDYERLEQVINLISKAPLIQITGVGGSALVGRDLSFKLMKIGFR
FT                   VACEVDTHVQATIAQALRQGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSP
FT                   LRRLADYTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGMVQLNDVESLRMIERSSELI
FT                   TLLDRS"
FT   gene            448727..449518
FT                   /locus_tag="SARI_00443"
FT   CDS_pept        448727..449518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2445 6.1e-132 ucpA; putative
FT                   oxidoreductase; COG: COG1028 Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases); Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20379"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE2"
FT                   /inference="protein motif:HMMPanther:IPR002347"
FT                   /inference="protein motif:HMMPfam:IPR002198"
FT                   /inference="similar to AA sequence:INSD:AAO68131.1"
FT                   /protein_id="ABX20379.1"
FT                   /translation="MGKLTGKTALVTGASQGIGEGIVRVFARHGANLILLDISDEIEKL
FT                   ADELGGRGHRCTAVKADVRDFASVQAAVARAKEIEGRIDILVNNAGVCRLGNFLDMSEE
FT                   DRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTGDIVADPGETAYALSKAAIV
FT                   GLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPEDPESVLTEMAKAIPLRRLA
FT                   DPLEVGELAAFLASDESSYLTGTQNVIDGGSTLPESVSVGV"
FT   gene            449675..450691
FT                   /locus_tag="SARI_00444"
FT   CDS_pept        449675..450691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00444"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4150 ABC-type sulfate transport system,
FT                   periplasmic component; Psort location: Periplasmic,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20380"
FT                   /db_xref="GOA:A9MIE3"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE3"
FT                   /inference="protein motif:HMMPfam:IPR006059"
FT                   /inference="protein motif:HMMTigr:IPR005669"
FT                   /inference="protein motif:ScanRegExp:IPR000957"
FT                   /inference="protein motif:ScanRegExp:IPR002052"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217430.1"
FT                   /protein_id="ABX20380.1"
FT                   /translation="MAVNFLKKSYLMLAASLLMVGQAQALALLNSSYDVSRELFAALNP
FT                   PFEQQWEKDNGGDKLTIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDKGKLLP
FT                   AGWQRRLPNNSSPFYSTMGFLVRKGNPKNIHDWNDLVRPDVKLIFPNPKTSGNARYTYL
FT                   AAWGAADNADGGDKAKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVN
FT                   NIRKQYEAQGFEVVIPKTNILAEFPVAWVDKNVKANGTEKAAKAYLNYLYTPQAQTIIT
FT                   DYYYRVNNPEVMSKQTDKFPQTELFRVEEKFGSWPEVMKTHFASGGELDKLLAAGRK"
FT   gene            450691..451524
FT                   /locus_tag="SARI_00445"
FT   CDS_pept        450691..451524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syn:sll0739 1.3e-29 modBC; ABC-type molybdate
FT                   transport system permease/ATP-binding protein K02018; COG:
FT                   COG0555 ABC-type sulfate transport system, permease
FT                   component; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20381"
FT                   /db_xref="GOA:A9MIE4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE4"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR005667"
FT                   /inference="protein motif:HMMTigr:IPR011865"
FT                   /inference="similar to AA sequence:SwissProt:P41032"
FT                   /protein_id="ABX20381.1"
FT                   /translation="MLAMSSRRVLPGFTLSLGTSLLFVCLILLLPLSALVMQLSQMSWA
FT                   QYWDVVTNPQVVAAYKVTLLAAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPF
FT                   ALPTAVAGLTLASLFSVNGFYGQFLAQFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVL
FT                   EELGPEYEEAAQTLGATRLQSFRKVVLPELSPALVAGIALSFTRSLGEFGAVIFIAGNI
FT                   AWKTEVTSLMIFVRLQEFDYPAASAIASVILAASLLLLFSINTLQSRFGRRVVGH"
FT   gene            451524..452399
FT                   /locus_tag="SARI_00446"
FT   CDS_pept        451524..452399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pac:PPA0505 2.3e-27 ABC transporter, putative
FT                   molybdenum transport system K02017:K02018; COG: COG4208
FT                   ABC-type sulfate transport system, permease component;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20382"
FT                   /db_xref="GOA:A9MIE5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE5"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR005667"
FT                   /inference="protein motif:HMMTigr:IPR011866"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149747.1"
FT                   /protein_id="ABX20382.1"
FT                   /translation="MAEVTQLTRYDAPRINWGKWFLIIIGMLVSAFILLVPMIYIFVQA
FT                   FSKGLMPVLQNLADPDMLRAIWLTVLIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLT
FT                   LLDIPFAVSPVVAGLVYLLFYGSNGPLGGWLDEHNLQIMFSWPGMVLVTIFVTCPFVVR
FT                   ELVPVMLSQGSQEDEGAILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVS
FT                   VVSGSIRGETLSLPLQIELLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWRLEHQEK
FT                   RAQQEENHEH"
FT   gene            452389..453483
FT                   /locus_tag="SARI_00447"
FT   CDS_pept        452389..453483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0417 2.0e-188 cysA; sulphate transport
FT                   ATP-binding protein CysA K02045; COG: COG1118 ABC-type
FT                   sulfate/molybdate transport systems, ATPase component;
FT                   Psort location: Cytoplasmic, score:9.12"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20383"
FT                   /db_xref="GOA:A9MIE6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE6"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR005666"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="protein motif:superfamily:IPR008995"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456976.1"
FT                   /protein_id="ABX20383.1"
FT                   /translation="MSIEIARIKKSFGRTLVLNDISLDIPSGQMVALLGPSGSGKTTLL
FT                   RIIAGLEHQSSGHIRFHGTDVSRLHARERKVGFVFQHYALFRHMTVFDNIAFGLTVLPR
FT                   RERPNAAAIKTKVTQLLEMVQLAHLADRFPAQLSGGQKQRVALARALAVEPQILLLDEP
FT                   FGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPD
FT                   RVWREPATRFVLEFMGEVNRLQGTIRGGQFHVGAHRWPLGYTPAYQGPVDLFLRPWEVD
FT                   ISRRTSLDSPLPVQVIEASPKGHYTQLVVQPQGWYHDPLTVVMAGDDAPQRGERLFVGL
FT                   QHARLYHGDERIEPYEALALAQSA"
FT   gene            453605..454462
FT                   /locus_tag="SARI_00448"
FT   CDS_pept        453605..454462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2440 3.7e-141 cysM; cysteine synthase B
FT                   (O-acetylserine sulfhydrolase B) K01738; COG: COG0031
FT                   Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20384"
FT                   /db_xref="GOA:A9MIE7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005858"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE7"
FT                   /inference="protein motif:HMMPfam:IPR001926"
FT                   /inference="protein motif:HMMTigr:IPR005856"
FT                   /inference="protein motif:HMMTigr:IPR005858"
FT                   /inference="protein motif:ScanRegExp:IPR001216"
FT                   /inference="similar to AA sequence:INSD:AAL21334.1"
FT                   /protein_id="ABX20384.1"
FT                   /translation="MTPDNGSEIWVKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPGDV
FT                   LIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRSAMRAYGAELVLVTKEQGMEGA
FT                   RDLALSMAERGEGKLLDQFNNPDNPYAHYATTGPEIWRQTAGRITHFVSSMGTTGTITG
FT                   VSRFLREQDKAVTIVGLQPEEGSCIPGIRRWPADYMPGIFSAPLVDEVLDIHQQEAENT
FT                   MRELAVREGIFCGVSSGGAVAGAIRIAKANPGALVVAIICDRGDRYLSTGVFGEEHFSQ
FT                   GAGI"
FT   gene            complement(454546..455262)
FT                   /locus_tag="SARI_00449"
FT   CDS_pept        complement(454546..455262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_2237 3.9e-27 glutamine
FT                   amidotransferase class-I K01951; COG: COG0518 GMP synthase
FT                   - Glutamine amidotransferase domain; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20385"
FT                   /db_xref="GOA:A9MIE8"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE8"
FT                   /inference="protein motif:HMMPfam:IPR000991"
FT                   /inference="similar to AA sequence:SwissProt:P40194"
FT                   /protein_id="ABX20385.1"
FT                   /translation="MRIHFVVHESFESTGAYLQWAEDRGYAISWSRVNAGEALPLNADG
FT                   FDMLVIFGGPQSPRTTREECPYFDSRAEQHLINQAITARRMVIGICLGSQLIGEALGAA
FT                   VCQSPEKEIGHYPITLTEAGLRHPFIDHFGSPLTVGHWHNDMPGLTDQATVLAESEGCP
FT                   RQIVQYGNFIYGFQCHMEFTVEAVEGLIQHSQQELADAQGKRFIRSVAEMRTWNYQEMN
FT                   RKLWQFLDRLVENHQQ"
FT   gene            complement(455277..456569)
FT                   /locus_tag="SARI_00450"
FT   CDS_pept        complement(455277..456569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0881 2.0e-25 transcriptional
FT                   regulatory protein GntR family K00825; COG: COG1167
FT                   Transcriptional regulators containing a DNA-binding HTH
FT                   domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20386"
FT                   /db_xref="GOA:A9MIE9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE9"
FT                   /inference="protein motif:Gene3D:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR004839"
FT                   /inference="protein motif:HMMSmart:IPR000524"
FT                   /inference="similar to AA sequence:SwissProt:P40193"
FT                   /protein_id="ABX20386.1"
FT                   /translation="MINGKTASEIFNSIRQHITAGTLRAEDSLPPVRELASELKVNRNT
FT                   VAAAYKRLITAGLAQSLGRNGTVIKGSPSPVALEGGDPHTPLRDLSGGNPDPQRLPDLS
FT                   RYFARLSRTPHLYGDAPVSPELHAWAVRWLQDAMPVAGEIDITSGAIDAIERLLCAHLL
FT                   PGDSVAVEDPCFLSSINMLRYAGFSASPVSVDSEGMQPEKLEQALSQGARAVILTPRAH
FT                   NPTGCSLSALRAAALQNILARYPQILVIIDDHFALLSSSPWQPVIAQATQHWAVIRSVS
FT                   KTLGPDLRLAIIASDSATSAKLRLRLNAGSQWVSHLLQDLVCACLTDPEYQHRLTQTRL
FT                   FYAAQQQKLACALQQHGIAISPGDGLNAWLPLETHSQATAFALAKSGWLVREGEAFGVS
FT                   TSSHGLRITLSTLNDSEINMLAADIHQALNR"
FT   gene            456652..457518
FT                   /locus_tag="SARI_00451"
FT   CDS_pept        456652..457518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2435 1.2e-144 pdxK;
FT                   pyridoxal-pyridoxamine kinase/hydroxymethylpyrimidine
FT                   kinase K00868; COG: COG2240
FT                   Pyridoxal/pyridoxine/pyridoxamine kinase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20387"
FT                   /db_xref="GOA:A9MIF0"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIF0"
FT                   /inference="protein motif:HMMPfam:IPR011611"
FT                   /inference="protein motif:HMMTigr:IPR004625"
FT                   /inference="similar to AA sequence:INSD:AAO68140.1"
FT                   /protein_id="ABX20387.1"
FT                   /translation="MGQESDIQSVLFDDNHRALQTDIVAVQSQVVYGSVGNSIAVPAIK
FT                   AQGLRVTAVPTVLFSNTPHYKTFYGGILPAEWFAGYLTALNERDALRELKAITTGYMGS
FT                   ADQIVLLSEWLMAVRASHPEVCILVDPVIGDTDSGMYVQAEIPQAYRTHLLPQAQGLTP
FT                   NVFELEILSGKPCRTQEEAVAAAQSLLSDTLKWVVITSAPGESLETITVAVVTAQAVEV
FT                   FDHPRVATELKGTGDLFCAELVCGIVQGKNLTNAARDAAQRVLEVMTWTQRCGCDELIL
FT                   PPAGEAR"
FT   gene            457515..457754
FT                   /locus_tag="SARI_00452"
FT   CDS_pept        457515..457754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00452"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG31214 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20388"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIF1"
FT                   /inference="similar to AA sequence:INSD:CAD07666.1"
FT                   /protein_id="ABX20388.1"
FT                   /translation="MKSYRLVVRQQGRMVGHFETSGTEALEDICVARAMFGIAGGYDCE
FT                   LLVADSERRLLESGPEGMKILMREACYRPVTSPL"
FT   gene            complement(457727..457870)
FT                   /locus_tag="SARI_00453"
FT   CDS_pept        complement(457727..457870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00453"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20389"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIF2"
FT                   /protein_id="ABX20389.1"
FT                   /translation="MAPIGAIFLSVGLISVAHQAIAGWRRKRLTRPTIFDPTVYNGEVT
FT                   GR"
FT   unsure          457786..457800
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            complement(457889..458398)
FT                   /locus_tag="SARI_00454"
FT   CDS_pept        complement(457889..458398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0424 4.9e-84 crr; glucose-specific IIA
FT                   component of PTS system K02777; COG: COG2190
FT                   Phosphotransferase system IIA components; Psort location:
FT                   Cytoplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20390"
FT                   /db_xref="GOA:A9MIF3"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIF3"
FT                   /inference="protein motif:BlastProDom:IPR001127"
FT                   /inference="protein motif:HMMPfam:IPR001127"
FT                   /inference="protein motif:HMMTigr:IPR001127"
FT                   /inference="protein motif:ScanRegExp:IPR001127"
FT                   /inference="protein motif:superfamily:IPR011055"
FT                   /inference="similar to AA sequence:INSD:AAV76443.1"
FT                   /protein_id="ABX20390.1"
FT                   /translation="MGLFDKLKSLVSDDKKDTGTIEIVAPLSGEIVNIEDVPDVVFAEK
FT                   IVGDGIAIKPTGNKMVAPVDGTIGKIFETNHAFSIESDSGIELFVHFGIDTVELKGEGF
FT                   KRIAEEGQRVKVGDPVIEFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSVTVGETP
FT                   VIRIKK"
FT   unsure          457914..458167
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            complement(458439..460166)
FT                   /locus_tag="SARI_00455"
FT   CDS_pept        complement(458439..460166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2432 1.5e-295 ptsI; General PTS family
FT                   (Enzyme I) PEP-protein phosphotransferase K08483; COG:
FT                   COG1080 Phosphoenolpyruvate-protein kinase (PTS system EI
FT                   component in bacteria); Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20391"
FT                   /db_xref="GOA:A9MIF4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIF4"
FT                   /inference="protein motif:BlastProDom:IPR000121"
FT                   /inference="protein motif:HMMPfam:IPR000121"
FT                   /inference="protein motif:HMMPfam:IPR008279"
FT                   /inference="protein motif:HMMPfam:IPR008731"
FT                   /inference="protein motif:HMMTigr:IPR006318"
FT                   /inference="protein motif:ScanRegExp:IPR000121"
FT                   /inference="protein motif:ScanRegExp:IPR008279"
FT                   /inference="protein motif:superfamily:IPR008279"
FT                   /inference="protein motif:superfamily:IPR008731"
FT                   /inference="similar to AA sequence:INSD:AAO68143.1"
FT                   /protein_id="ABX20391.1"
FT                   /translation="MISGILASPGIAFGKALLLKEDEIVIDRKKISADKVDQEVERFLS
FT                   GRAKASAQLEAIKTKAGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAA
FT                   HEVIEGQATALEELDDEYLKERAADVRDIGKRLLRNILGLAIIDLSAIQEEVILVAADL
FT                   TPSETAQLNLQKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNGDFIILDA
FT                   VNNQVYVNPTNDVIEQLRAVQEQVASEKAELAKLKDLPAITLDGHQVEVCANIGTVRDV
FT                   EGAERNGAEGVGLYRTEFLFMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDK
FT                   ELPYMNFPKEENPFLGWRAVRIAMDRKEILRDQVRAILRASAFGKLRIMFPMIISVEEV
FT                   RALRKEIEIYKQELRDEGKAFDESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQ
FT                   YTLAVDRGNDMISHLYQPMSPSVLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLG
FT                   MGLDEFSMSAISIPRIKKIIRNTNFEDAKVLAEQALAQPTTDELMTLVNKFIEEKTIC"
FT   gene            complement(460215..460472)
FT                   /locus_tag="SARI_00456"
FT   CDS_pept        complement(460215..460472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bci:BCI_0069 1.5e-32 ptsH; phosphocarrier
FT                   protein HPr K00890; COG: COG1925 Phosphotransferase system,
FT                   HPr-related proteins; Psort location: Cytoplasmic,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00456"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20392"
FT                   /db_xref="GOA:A9MIF5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIF5"
FT                   /inference="protein motif:BlastProDom:IPR000032"
FT                   /inference="protein motif:Gene3D:IPR000032"
FT                   /inference="protein motif:HMMPfam:IPR000032"
FT                   /inference="protein motif:HMMTigr:IPR005698"
FT                   /inference="protein motif:ScanRegExp:IPR001020"
FT                   /inference="protein motif:ScanRegExp:IPR002114"
FT                   /inference="protein motif:superfamily:IPR000032"
FT                   /inference="similar to AA sequence:INSD:ABG70428.1"
FT                   /protein_id="ABX20392.1"
FT                   /translation="MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAK
FT                   SLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE"
FT   unsure          460548..461017
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            460581..460736
FT                   /locus_tag="SARI_00457"
FT   CDS_pept        460581..460736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00457"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20393"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIF6"
FT                   /inference="similar to AA sequence:INSD:EAY45857.1"
FT                   /protein_id="ABX20393.1"
FT                   /translation="MFYAIRCWQLMAADVSLVIKHYAAKGRFEPNHKIDSANALPVTIN
FT                   FAHQNN"
FT   gene            complement(460855..461826)
FT                   /locus_tag="SARI_00458"
FT   CDS_pept        complement(460855..461826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2666 9.7e-166 cysK; cysteine synthase A
FT                   K01738; COG: COG0031 Cysteine synthase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00458"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20394"
FT                   /db_xref="GOA:A9MIF7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIF7"
FT                   /inference="protein motif:HMMPfam:IPR001926"
FT                   /inference="protein motif:HMMTigr:IPR005856"
FT                   /inference="protein motif:HMMTigr:IPR005859"
FT                   /inference="protein motif:ScanRegExp:IPR001216"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX20394.1"
FT                   /translation="MSKIYEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRI
FT                   GANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLL
FT                   KALGANLVLTEGAKGMKGAIQKAEEIVASNPQKYLLLQQFSNPANPEIHEKTTGPEIWE
FT                   DTDGQVDVFISGVGTGGTLTGVTRYIKGTKGKTDLITVAVEPTDSPVIAQALAGEELKP
FT                   GPHKIQGIGAGFIPGNLDLKLIDKVVGITNEEAISTARRLMEEEGILAGISSGAAVAAA
FT                   LKLQEDESFTNKNIVVILPSSGERYLSTALFADLFTEKELQQ"
FT   gene            complement(461990..462625)
FT                   /locus_tag="SARI_00459"
FT   CDS_pept        complement(461990..462625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH03674 3.1e-06 hypothetical protein
FT                   K01954; COG: COG2981 Uncharacterized protein involved in
FT                   cysteine biosynthesis; Psort location: CytoplasmicMembrane,
FT                   score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00459"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20395"
FT                   /db_xref="GOA:A9MIF8"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIF8"
FT                   /inference="protein motif:HMMPfam:IPR007496"
FT                   /inference="similar to AA sequence:SwissProt:Q5PND3"
FT                   /protein_id="ABX20395.1"
FT                   /translation="MGGAFWWLFTQLDAWIPSLMSHVPDWLQWLSYLLWPIAVISVLLV
FT                   FGYFFSTLANWIAAPFNGLLAEQLEARLTGATPPDTGVLGIMKDVPRIMKREWQKLAWY
FT                   LPRAIVLLVLYFIPGIGQTIAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKTMRAALRTQ
FT                   KVANMQFGALTSLFTMIPVLNLFIMPVAVCGATAMWVDCWRAKHALWK"
FT   unsure          462035..462367
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            462985..463965
FT                   /locus_tag="SARI_00460"
FT   CDS_pept        462985..463965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2744 8.5e-135 zipA; cell division
FT                   protein ZipA K03528; COG: COG3115 Cell division protein;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20396"
FT                   /db_xref="GOA:A9MIF9"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR011919"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MIF9"
FT                   /inference="protein motif:HMMPfam:IPR007449"
FT                   /inference="protein motif:HMMSmart:IPR007449"
FT                   /inference="protein motif:HMMTigr:IPR011919"
FT                   /inference="similar to AA sequence:INSD:AAV76448.1"
FT                   /protein_id="ABX20396.1"
FT                   /translation="MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMK
FT                   SKRDDDSYDDDVDADEGVGEVRVHRVNHAPGQPQEHDAPRQSPQHQYQPPYASAQPRPA
FT                   TPPQPQAPQQQPVQQPPQPVPPPQQVQPSAPPVQPQQPAQPSQAPQPVAQPAPPLAEQT
FT                   FQPADPAVEAEPVVEEAPVVEKPQRKEVVIIMNVAAHHGSELNGEVLLNSIQQSGFKFG
FT                   DMNIFHRHLSPDGSGPALFSLANMVNPGTFDPEMTDFTTPGVTIFMQVPSYGDALQNFK
FT                   LMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDRIREVMDANA"
FT   gene            464037..466052
FT                   /locus_tag="SARI_00461"
FT   CDS_pept        464037..466052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0431 0. ligA; DNA ligase K01972; COG:
FT                   COG0272 NAD-dependent DNA ligase (contains BRCT domain type
FT                   II); Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20397"
FT                   /db_xref="GOA:A9MIG0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MIG0"
FT                   /inference="protein motif:BlastProDom:IPR004150"
FT                   /inference="protein motif:Gene3D:IPR004150"
FT                   /inference="protein motif:HMMPfam:IPR000445"
FT                   /inference="protein motif:HMMPfam:IPR001357"
FT                   /inference="protein motif:HMMPfam:IPR004149"
FT                   /inference="protein motif:HMMPfam:IPR004150"
FT                   /inference="protein motif:HMMPfam:IPR013839"
FT                   /inference="protein motif:HMMSmart:IPR001357"
FT                   /inference="protein motif:HMMSmart:IPR013840"
FT                   /inference="protein motif:HMMTigr:IPR001679"
FT                   /inference="protein motif:ScanRegExp:IPR001679"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /inference="protein motif:superfamily:IPR010994"
FT                   /protein_id="ABX20397.1"
FT                   /translation="MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRAL
FT                   EAQRPDLITPDSPTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKS
FT                   TENVTWCCELKLDGLAVSILYENGVLVRAATRGDGTTGEDITSNVRTIRAIPLKLRGDN
FT                   IPARLEVRGEVFLPQAGFEKINEEARRSGGKVFANPRNAAAGSLRQLDPRITAKRPLTF
FT                   FCYGVGILEGGELPDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLAFYHNVEEDRPTLG
FT                   FDIDGVVIKVNSLALQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPV
FT                   ARLEPVQVAGVLVSNATLHNADEIDRLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEET
FT                   RPIVFPTHCPVCGSDVERVEGEAVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI
FT                   IDQLVEREYVHTPADLFRLTAGKLTGLDRMGPKSAQNVVNALEKAKATIFARFLYALGI
FT                   REVGEATAAGLAAYFGTLEALQAASIDELQKVPDVGIVVATHVFNFFAEESNREVIGQL
FT                   LAEGVHWPAPVVINAQEIDSPFAGKTVVLTGSLSQMSRDDAKARLVELGAKVAGSVSKK
FT                   TDLVIAGEAAGSKLAKAQELGIDVIDEAEMLRLLGV"
FT   unsure          464296..464415
FT                   /locus_tag="SARI_00461"
FT                   /note="Sequence derived from one plasmid subclone"
FT   unsure          465174..465320
FT                   /locus_tag="SARI_00461"
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            466054..466272
FT                   /locus_tag="SARI_00462"
FT   CDS_pept        466054..466272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cmu:TC0823 0.00043 DNA polymerase III, epsilon
FT                   subunit, putative K02342; COG: COG3530 Uncharacterized
FT                   protein conserved in bacteria; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20398"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIG1"
FT                   /inference="similar to AA sequence:INSD:AAL21320.1"
FT                   /protein_id="ABX20398.1"
FT                   /translation="MEKAQLIAIANTLMPFGKYQGRRLIDLPEEYLLWFARKEQFPAGK
FT                   LGELMQITLLIKTEGLTQLVQPLKRPL"
FT   unsure          466210..466327
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            complement(466269..467267)
FT                   /locus_tag="SARI_00463"
FT   CDS_pept        complement(466269..467267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00463"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0385 Predicted Na+-dependent transporter;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20399"
FT                   /db_xref="GOA:A9MIG2"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIG2"
FT                   /inference="protein motif:HMMPfam:IPR002657"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217410.1"
FT                   /protein_id="ABX20399.1"
FT                   /translation="MKLFRILDPFTLTLITVVLLASFFPAEGGFVPVVEGITTAAIALL
FT                   FFMHGAKLSRDAIIAGGSHWRLHLWVMCSTFVLFPVLGVLFAWWAPVNVDPMLYSGFLY
FT                   LCILPATVQSAIAFTSLAGGNVAAAVCSASASSLLGIFLSPLLVGLVMNIHGAQGSLEE
FT                   VGRIMLQLLLPFVLGHLSRPWIGNWVARNKKWIAKTDQTSILLVVYSAFSEAVVNGIWH
FT                   KVGWGSLLFIVVVSLVLLAIVIAINVFVARKCGFNKADEITIVFCGSKKSLANGIPMAN
FT                   ILFPTSVLGMMVLPLMIFHQIQLMVCAELARRYKRQTEKLQAQQESCAAKA"
FT   gene            467357..467949
FT                   /pseudo
FT                   /locus_tag="SARI_00464"
FT                   /note="Pseudogene compared to gi|16765744|ref|NP_461359.1|
FT                   putative transcriptional regulator [Salmonella typhimurium
FT                   LT2]"
FT   unsure          467503..467521
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            complement(468126..468198)
FT                   /locus_tag="SARI_00465"
FT   tRNA            complement(468126..468198)
FT                   /locus_tag="SARI_00465"
FT                   /product="tRNA-Lys"
FT   gene            complement(468206..468278)
FT                   /locus_tag="SARI_00466"
FT   tRNA            complement(468206..468278)
FT                   /locus_tag="SARI_00466"
FT                   /product="tRNA-Val"
FT   gene            complement(468323..468395)
FT                   /locus_tag="SARI_00467"
FT   tRNA            complement(468323..468395)
FT                   /locus_tag="SARI_00467"
FT                   /product="tRNA-Val"
FT   gene            complement(468444..468516)
FT                   /locus_tag="SARI_00468"
FT   tRNA            complement(468444..468516)
FT                   /locus_tag="SARI_00468"
FT                   /product="tRNA-Val"
FT   gene            468775..470190
FT                   /locus_tag="SARI_00469"
FT   CDS_pept        468775..470190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2415 3.4e-257 gltX; glutamate tRNA
FT                   synthetase, catalytic subunit K01885; COG: COG0008
FT                   Glutamyl- and glutaminyl-tRNA synthetases; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20400"
FT                   /db_xref="GOA:A9MIG3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MIG3"
FT                   /inference="protein motif:FPrintScan:IPR000924"
FT                   /inference="protein motif:Gene3D:IPR008925"
FT                   /inference="protein motif:HMMPanther:IPR000924"
FT                   /inference="protein motif:HMMPfam:IPR000924"
FT                   /inference="protein motif:HMMTigr:IPR004527"
FT                   /inference="protein motif:ScanRegExp:IPR001412"
FT                   /inference="protein motif:superfamily:IPR008925"
FT                   /inference="similar to AA sequence:SwissProt:P0A2K4"
FT                   /protein_id="ABX20400.1"
FT                   /translation="MKIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTD
FT                   LERSTPEAIEAIMDGMNWLNLEWDEGPYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKER
FT                   LDQLREEQMAKGEKPRYDGRCRHSHEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFS
FT                   NQELDDLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVP
FT                   MYAHVSMINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWSNGDQEIFTREE
FT                   MINLFSLGAVSKSSSAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQL
FT                   AELVKLLGERCKTLKEMAQSCRYFYEDFSEFDADAAKKHLRPVARQPLEVVRDKLSAIT
FT                   DWSAENVHHAIQSTAEELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERIN
FT                   KALGFIAERESQQ"
FT   gene            complement(470244..470636)
FT                   /locus_tag="SARI_00470"
FT   CDS_pept        complement(470244..470636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00470"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09785 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20401"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010749"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIG4"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR010749"
FT                   /inference="protein motif:superfamily:IPR009061"
FT                   /inference="similar to AA sequence:INSD:AAV76454.1"
FT                   /protein_id="ABX20401.1"
FT                   /translation="MKRLRSKMTTEELAECLGVARQTVNRWIREQSWKTEKFPGVKGGR
FT                   ARLIHIDAGVREFILNIPAFRKLPAFYQAEEPFAEYANAAHSHAYRQIIDAVENMSAQE
FT                   QEKLALFLSREGIRGFLTRLGINASD"
FT   gene            complement(470638..471000)
FT                   /locus_tag="SARI_00471"
FT   CDS_pept        complement(470638..471000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1823 0.0055 tail-specific protease
FT                   K03797; COG: NOG09771 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20402"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010749"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIG5"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR010749"
FT                   /inference="protein motif:superfamily:IPR009061"
FT                   /inference="similar to AA sequence:INSD:AAL21311.1"
FT                   /protein_id="ABX20402.1"
FT                   /translation="MFKERMTPEELANLTGYSRQTINKWVRKEGWATSPKPGVQGGKAR
FT                   LVHVNEQVREYIRSAERSVDHHTDTFMPASDASLEALLMTLAKEMTSSEQKQFTSLLVR
FT                   EGITGLLQRLGIRDSK"
FT   unsure          470733..471253
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            471222..471294
FT                   /locus_tag="SARI_00472"
FT   tRNA            471222..471294
FT                   /locus_tag="SARI_00472"
FT                   /product="tRNA-Ala"
FT   gene            471340..471412
FT                   /locus_tag="SARI_00473"
FT   tRNA            471340..471412
FT                   /locus_tag="SARI_00473"
FT                   /product="tRNA-Ala"
FT   unsure          471393..471585
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            471605..473794
FT                   /locus_tag="SARI_00474"
FT   CDS_pept        471605..473794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3829 6.7e-23 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s) K01745;
FT                   COG: COG2199 FOG: GGDEF domain; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20403"
FT                   /db_xref="GOA:A9MIG6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIG6"
FT                   /inference="protein motif:HMMPfam:IPR001633"
FT                   /inference="protein motif:HMMPfam:IPR007895"
FT                   /inference="protein motif:HMMSmart:IPR000160"
FT                   /inference="protein motif:HMMSmart:IPR001633"
FT                   /protein_id="ABX20403.1"
FT                   /translation="MPDKCNLLENIKIFLLALSLTVPAILVSRVISPRATIDSSYIFLA
FT                   WLPLCVMFAVLFLFGRRGVAPMAGGMMLTNEWNFHLPLPQAMVLLFCQTFPVLLACAIV
FT                   RWQLGARWRYGIPNKDIWLRVFWLGLMTPLGIKISMHLAGHYLAFPVTISTFFGGGTAI
FT                   FLIVDLLSLISAVLIFTLFFYYPMRMIVSPHYIRIFWRRNVAPYLAKEKRLFTLIWFAT
FT                   LATLLTVLCTPFETKYIAGYLVPVLFIGFTLGVGKISYPLLNFSWAITTLFLLIYNRNF
FT                   LQGVGSEYSLAFILSVLISFSICLLYMARINQRSEWLNRQWHSRALTEPLTQLPNLRAL
FT                   EQFLLQGAGQSVCYLRMENLEFLSRHYGMLMRVHCEREVFRALQPLLQEKEKVFHLPGS
FT                   ELLLVLAGPETEARLQYMINVLNNRKIYWNNTGLEMEYGASWGTFDGRQETLQPLLGQL
FT                   SWLAEQSCSHRRVLSLTHSIEAASGQTTERVLRLQKIRQALERGALVLYAQPIRDAQGK
FT                   GYDEILTRLRCDEGIMMPNQFIPLIAQFNLSVRFDMQVVEALLQWLSVHPSAEQGARFS
FT                   VNLMPLTLLQKETASRIIQLFKRYGVPPASVIIEITEEQAFSHSEISMYNINQLRKFGL
FT                   KIAIDDFGTGYANYERLKRLKADIIKIDGCFVKDILTDSLDAMIVKSITDLAKAKSLSV
FT                   VAEFVETPEQRDLLLQLGVHSLQGYLIGRPRPLGE"
FT   unsure          471923..471969
FT                   /locus_tag="SARI_00474"
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            complement(473857..475059)
FT                   /locus_tag="SARI_00475"
FT   CDS_pept        complement(473857..475059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00475"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1972 Nucleoside permease; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20404"
FT                   /db_xref="GOA:A9MIG7"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIG7"
FT                   /inference="protein motif:BlastProDom:IPR008276"
FT                   /inference="protein motif:HMMPanther:IPR008276"
FT                   /inference="protein motif:HMMPfam:IPR002668"
FT                   /inference="protein motif:HMMPfam:IPR011642"
FT                   /inference="protein motif:HMMPfam:IPR011657"
FT                   /inference="protein motif:HMMTigr:IPR008276"
FT                   /inference="similar to AA sequence:INSD:ABB66979.1"
FT                   /protein_id="ABX20404.1"
FT                   /translation="MDRVLHFVLALAVVAVLALLVSSDRKKIRIRYVIQLLIIEVLLAW
FT                   FFLNSDVGLGFVKGFSEMFEKLLGFANEGTNFVFGSMNDQGLAFFFLKVLCPIVFISAL
FT                   IGILQHIRVLPMVIRAIGFLLSKVNGMGKLESFNAVSSLILGQSENFIAYKDILGKMSR
FT                   NRMYTMAATAMSTVSMSIVGAYMTMLEPKYVVAALVLNMFSTFIVLSLINPYRVDASEE
FT                   NIQMSNLHEGQSFFEMLGEYILAGFKVAVIVAAMLIGFIALIAALNALFATVTGWFGHS
FT                   ISFQGILGYIFYPVAWVMGVPSSEALQVGSIMATKLVSNEFVAMMDLQKIAATLSPRAV
FT                   GIISVFLVSFANFSSIGIIAGAIKGLNEEQGNVVSRFGLKLVYGSTLVSVLSASIAALV
FT                   L"
FT   gene            475384..476643
FT                   /locus_tag="SARI_00476"
FT   CDS_pept        475384..476643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00476"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1914 Mn2+ and Fe2+ transporters of the NRAMP
FT                   family; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20405"
FT                   /db_xref="GOA:A9MIG8"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIG8"
FT                   /inference="protein motif:BlastProDom:IPR001046"
FT                   /inference="protein motif:HMMPanther:IPR001046"
FT                   /inference="protein motif:HMMPfam:IPR001046"
FT                   /inference="protein motif:HMMTigr:IPR001046"
FT                   /inference="protein motif:superfamily:IPR008928"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461349.1"
FT                   /protein_id="ABX20405.1"
FT                   /translation="MFLRQKMTDNRVENSSGRAGRKLRLALMGPAFIAAIGYIDPGNFA
FT                   TNIQAGASFGYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRPVVWFYW
FT                   VQAEIIAMATDLAEFIGAAIGFRLILGVSLLQGAVLTGIATFLILMLQRRGQKPLEKVI
FT                   GGLLLFVAAAYIVELFFSQPDMAQLGKGMVIPALPNSEAVFLAAGVLGATIMPHVIYLH
FT                   SSLTQHLHGGTRQQRYSATKWDVAIAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQA
FT                   YLTLEPLLSHAAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRTITMLP
FT                   SFIVIFMGLDPTRILVMSQVLLSFGIALALVPLLIFTSNSTLMGELVNTRRVKQVGWII
FT                   VVLVVALNIWLLVGTVMGLS"
FT   gene            complement(476705..477031)
FT                   /locus_tag="SARI_00477"
FT   CDS_pept        complement(476705..477031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vpa:VP2751 0.00021 penicillin-binding protein
FT                   1A K05366; COG: NOG09770 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20406"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIG9"
FT                   /inference="similar to AA sequence:INSD:AAL21307.1"
FT                   /protein_id="ABX20406.1"
FT                   /translation="MFRSLILAAALLAFTPLAANAGEITLLPSIKLQIGDRDDYGNYWD
FT                   GGRWRDRDYWHNHYQWRKNRWWRHDNGYHRGWDKRNAYERGYREGWRDRDDHHRRGHGH
FT                   KHHH"
FT   gene            complement(477145..478143)
FT                   /locus_tag="SARI_00478"
FT   CDS_pept        complement(477145..478143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00478"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02454 5.5e-108 probable
FT                   oxidoreductase protein K05882; COG: COG0667 Predicted
FT                   oxidoreductases (related to aryl-alcohol dehydrogenases);
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20407"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIH0"
FT                   /inference="protein motif:BlastProDom:IPR001395"
FT                   /inference="protein motif:Gene3D:IPR001395"
FT                   /inference="protein motif:HMMPanther:IPR001395"
FT                   /inference="protein motif:HMMPanther:IPR005399"
FT                   /inference="protein motif:HMMPfam:IPR001395"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149771.1"
FT                   /protein_id="ABX20407.1"
FT                   /translation="MVYQPDENRYHTMEYRRCGRSGVKLPAISLGLWHNFGDATRVENS
FT                   RALLQRAFDLGITHFDLANNYGPPPGSAECNFGRILQEDFLPWRDELVISTKAGYTMWD
FT                   GPYGDWGSRKYLIASLDQSLKRMGLEYVDIFYHHRPDPETPLKETMKALDHLVRQGKAL
FT                   YVGISNYPADLARQAIDILEDLGTPCLIHQPKYSLFERWVEDGLLALLQEKGVGSIAFS
FT                   PLAGGQLTDRYLNGIPEDSRAASGSRFLKPEHITADKLEKVRQLNELAARRGQKLSQMA
FT                   LAWVLRNDNVTSVLIGASKPSQIEDAVGMLANRRFSATECAEIDAILDGRF"
FT   gene            478323..479975
FT                   /locus_tag="SARI_00479"
FT   CDS_pept        478323..479975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2405 2.6e-284 indolepyruvate
FT                   decarboxylase K01568; COG: COG3961 Pyruvate decarboxylase
FT                   and related thiamine pyrophosphate-requiring enzymes; Psort
FT                   location: CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00479"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20408"
FT                   /db_xref="GOA:A9MIH1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIH1"
FT                   /inference="protein motif:HMMPfam:IPR011766"
FT                   /inference="protein motif:HMMPfam:IPR012000"
FT                   /inference="protein motif:HMMPfam:IPR012001"
FT                   /inference="protein motif:HMMPIR:IPR012110"
FT                   /inference="protein motif:ScanRegExp:IPR000399"
FT                   /inference="protein motif:ScanRegExp:IPR000408"
FT                   /inference="similar to AA sequence:INSD:CAC48239.1"
FT                   /protein_id="ABX20408.1"
FT                   /translation="MQTPYTVADYLLDRLAGCGIGHLFGVPGDYNLQFLDHVIDHPTLR
FT                   WVGCANELNAAYAADGYARMSGAGALLTTFGVGELSAINGIAGSYAEYVPVLHIVGAPC
FT                   SAAQQRGELMHHTLGDGDFHHFYRMSQAISAGSAILNEQNACFEIDRVLGEMVAARRPG
FT                   YIMLPADVAKKTAIPPIEALTLPAHETQNGVETAFRYRARQCLMNSRRIALLADFLARR
FT                   FGLRPLLQRWMAETSIAHATLLMGKGLFDEQHPNFVGTYSAGASSKAVRQAIEDADMVI
FT                   CVGTRFVDTLTAGFTQQLPAERTLEIQPYASRIGETWFNLPMAQAVSTLRELCLECAFA
FT                   PPPTRPVCQPVQIEKGELTQENFWQTLQQYLKPGDIILVDQGTAAFGAAALSLPDGAEV
FT                   VVQPLWGSIGYSLPAAFGAQTACPDRRVILIIGDGAAQLTIQEMGSMLRDGQAPIILLL
FT                   NNDGYTVERAIHGAAQRYNDIASWNWTQIPQALNAAQQAECWRVTQAIQLAEVLERLAR
FT                   PQRLSFIEVMLPKADLPELLRTVTRALEARNGG"
FT   gene            complement(479995..481287)
FT                   /locus_tag="SARI_00480"
FT   CDS_pept        complement(479995..481287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpr:CPR_1400 1.4e-09 chloride channel protein
FT                   K01529; COG: COG0038 Chloride channel protein EriC; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20409"
FT                   /db_xref="GOA:A9MIH2"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR022969"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIH2"
FT                   /inference="protein motif:HMMPanther:IPR001807"
FT                   /inference="protein motif:HMMPfam:IPR001807"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149773.1"
FT                   /protein_id="ABX20409.1"
FT                   /translation="MPLGRLCKNRYTTPCKEEIMFHPRARAMLLLSIPALIIGVASSLV
FT                   LIAAMKVASIFQQFLWQRLPASIGIAYDSPFWIVGMLTLTGVVVGLIIRYSPGHAGPDP
FT                   AIEPLISMPVSPSALPGLLLALIIGLAGGVSLGPEHPIMTINIALAVAFGSRLFPRITT
FT                   LDWMILASAGTIGALFGTPVAAALIFSQTLSGSNDVPMWDRLFAPLMAAAAGSLTTSLF
FT                   FHPHFSLPIAHYTQMRLMDIASGAIVAAIAIAAGMVAVWCLPRLHELLHRLKNPVLILG
FT                   FGGFILGILGVIGGPLTLFKGLDEMQQMAFSQTLDAGDYFTLAIVKLTALVIAAASGFR
FT                   GGRIFPAVFIGAALGLMLHAHVETVPAAITVSCAILGLVLVVTRDGWLSLFMATVVVPD
FT                   TNLLPLLCIVMLPAWLLLAGKPLLAANRHEP"
FT   gene            481435..482400
FT                   /locus_tag="SARI_00481"
FT   CDS_pept        481435..482400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2403 2.3e-171 glk; glucokinase K00845;
FT                   COG: COG0837 Glucokinase; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20410"
FT                   /db_xref="GOA:A9MIH3"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MIH3"
FT                   /inference="protein motif:HMMPfam:IPR003836"
FT                   /inference="protein motif:HMMTigr:IPR003836"
FT                   /inference="similar to AA sequence:SwissProt:Q5PNF2"
FT                   /protein_id="ABX20410.1"
FT                   /translation="MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVV
FT                   RVYLDEHSVSVEDGCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAV
FT                   SMAIPMLKKEHLIQFGGGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDF
FT                   APNSEEEAMILEILRAEIGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITARA
FT                   LADSCIDCRRALSLFCVIMGRFGGDLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGF
FT                   EDKGRFKDYVHSIPVYLIVHDNPGLLGSGAHLRQTLGHIL"
FT   gene            482661..482987
FT                   /locus_tag="SARI_00482"
FT   CDS_pept        482661..482987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbo:SBO_2413 5.8e-49 putative PTS system
FT                   enzyme IIB component K02769; COG: COG1445
FT                   Phosphotransferase system fructose-specific component IIB"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20411"
FT                   /db_xref="GOA:A9MIH4"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIH4"
FT                   /inference="protein motif:HMMPfam:IPR003353"
FT                   /inference="protein motif:HMMTigr:IPR003353"
FT                   /inference="similar to AA sequence:INSD:BAA16257.2"
FT                   /protein_id="ABX20411.1"
FT                   /translation="MTKKLIAVCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADG
FT                   IQNRLTAQDIAEATLIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIKEIEEMTA
FT                   AEQP"
FT   gene            483008..484255
FT                   /locus_tag="SARI_00483"
FT   CDS_pept        483008..484255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecc:c2925 3.1e-201 putative PTS system IIC
FT                   component ypdG K02770; COG: COG1299 Phosphotransferase
FT                   system, fructose-specific IIC component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20412"
FT                   /db_xref="GOA:A9MIH5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIH5"
FT                   /inference="protein motif:HMMPfam:IPR003352"
FT                   /inference="protein motif:HMMTigr:IPR006327"
FT                   /inference="similar to AA sequence:INSD:AAN81375.1"
FT                   /protein_id="ABX20412.1"
FT                   /translation="MAIKKRSATIVSGVSGAATTIKKTEASRNSFWGELPQHVMSGISR
FT                   MVPTLIMGGVILAFSQLIAYSWLDIPADTGIMDALNSGKFAGFNLSLLKFAWLSQSFGG
FT                   VLFGFAIPMFAAFVANSIGGKLAFPAGFIGGLMSTQPTQVLNFDSASLYWVTSAPVPST
FT                   FIGALIISIVAGYLVKWMNQKIQLPDFLLAFKTTFLLPILSAIFVMLAMYYVITPFGGW
FT                   INGGIRTLLTAAGEKGALMYAMGIAAATAIDLGGPINKAAGFVAFSFTTDHVLPVTARS
FT                   IAIVIPPIGLGLATLLDRRLTGKRLFNAQLYPQGKTAMFLAFMGISEGAIPFALESPVT
FT                   AIPSYMVGAIVGSTFAVWLGAVQWFPESAIWAWPLVSHLSVYIAGILLGAVITALMVVF
FT                   LRHMMYRRGKLLIESL"
FT   gene            484252..485355
FT                   /locus_tag="SARI_00484"
FT   CDS_pept        484252..485355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b2385 1.2e-142 ypdF; putative peptidase
FT                   K08326; COG: COG0006 Xaa-Pro aminopeptidase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20413"
FT                   /db_xref="GOA:A9MIH6"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIH6"
FT                   /inference="protein motif:Gene3D:IPR000994"
FT                   /inference="protein motif:HMMPanther:IPR000994"
FT                   /inference="protein motif:HMMPfam:IPR000994"
FT                   /inference="similar to AA sequence:INSD:EAY49463.1"
FT                   /protein_id="ABX20413.1"
FT                   /translation="MKIRTDTMTRLTSLRQWLNERQLDAVLISSRPNKQPHLGISSGSG
FT                   FVLISRQHAHILVDARYYADVKARANGYCIHLLGGQQRLTSLVNQIISAENLQTVGFEG
FT                   AQVSWETARRWQTELRATMVSVSIDALRRIKTAAEIDRIREACRIADASAEHIRRFIAP
FT                   GQSEREIAAELEWFMRQRGAEKAAFDTIVASGWRGALPHGKASDKIVAAGEWITLDFGA
FT                   LYQGYCSDMTRTFLISGAGAPQEHPLFPIYHIVLEAQLAAIAAIRPGVRCLAVDAAARD
FT                   VIERAGYGEFFAHNTGHSIGIEVHEEPRFSPDDNTVLAPGMLLTVEPGIYLPEQGGVRI
FT                   EDVVLVTPEGAEVLYSMPKTVLLTGVA"
FT   gene            485352..486395
FT                   /locus_tag="SARI_00485"
FT   CDS_pept        485352..486395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b2384 1.3e-161 ypdE; predicted peptidase
FT                   K01269; COG: COG1363 Cellulase M and related proteins;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20414"
FT                   /db_xref="GOA:A9MIH7"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIH7"
FT                   /inference="protein motif:HMMPfam:IPR008007"
FT                   /inference="similar to AA sequence:INSD:EAY49462.1"
FT                   /protein_id="ABX20414.1"
FT                   /translation="MMDLSLLKALCEADAIAASEQEVRQILLDEADRLHKEVRFDGLGS
FT                   VLIRLNASDGPKVMICAHMDEVGFMVRSISGEGAIDVLPVGNVRMAARQLQPVRITTRE
FT                   ECKIPGLLEGERSGNEVSGLRVDIGARSHDEVIQAGIRPGDRVTFDSAFQVLPHQRVMG
FT                   KAFDDRLGCYLLIALLREWHDAELPAEIWLAASSSEEVGLRGGQTAARAIAPDLAIVLD
FT                   TACWAKNFDYGAANHRQIGQGPMLVLSDKSLIAPPKLTAWIESIAAQAGIPLQLDMFSN
FT                   GGTDGGVVHLSGTGIPTVVLGPATRHGHCAASIADCRDILQTQQLLSALITGFTRDTVA
FT                   RLTDFRC"
FT   gene            486417..488912
FT                   /locus_tag="SARI_00486"
FT   CDS_pept        486417..488912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfx:S2588 0. putative PTS system enzyme IIA
FT                   component, enzyme I K02766:K02768; COG: COG1762
FT                   Phosphotransferase system mannitol/fructose-specific IIA
FT                   domain (Ntr-type); Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00486"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20415"
FT                   /db_xref="GOA:A9MIH8"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIH8"
FT                   /inference="protein motif:BlastProDom:IPR000032"
FT                   /inference="protein motif:BlastProDom:IPR000121"
FT                   /inference="protein motif:BlastProDom:IPR002178"
FT                   /inference="protein motif:Gene3D:IPR000032"
FT                   /inference="protein motif:Gene3D:IPR002178"
FT                   /inference="protein motif:HMMPfam:IPR000032"
FT                   /inference="protein motif:HMMPfam:IPR000121"
FT                   /inference="protein motif:HMMPfam:IPR002178"
FT                   /inference="protein motif:HMMPfam:IPR008279"
FT                   /inference="protein motif:HMMPfam:IPR008731"
FT                   /inference="protein motif:HMMTigr:IPR004715"
FT                   /inference="protein motif:HMMTigr:IPR006318"
FT                   /inference="protein motif:ScanRegExp:IPR000121"
FT                   /inference="protein motif:superfamily:IPR000032"
FT                   /inference="protein motif:superfamily:IPR008279"
FT                   /inference="protein motif:superfamily:IPR008731"
FT                   /protein_id="ABX20415.1"
FT                   /translation="MLTIEFLCPLPNGIHARPAWELKEQCSQWQSDITFINRRQNVRAD
FT                   AKSSLALIGTGTLFNDSCMLNISGRDEEQAKRSLEVWLAHHFIDSDSVQPGPAELAARP
FT                   LPRSLLRLNPDLLYGDVLASGVGEGMLTLWQSDNLEGYRTIPASAEDLTRLENSLATLA
FT                   EQLNQQLRERDGESKTILSAHLSLIQDDEFAGNIRRLMVERHLALGAAIIANMEQVCSQ
FT                   LSASASDYLRERVSDIRDISEQLLHITWPEKQPRNALVLTRPTILVAEDLTPSQFLSLD
FT                   LQYLSGMILEKTGRTSHTLILARASAIPVLSGLSAEAIGRYATRPAVLDAQCGVLAINP
FT                   NSSVRGYYAVAEKLADKRQQRQACDAALLACTQDNQRIDIAANIGTALEAPGAFSNGAE
FT                   GIGLFRTEMLFMDRDSAPDEQEQFEAYQQVLLAAGEKPVIFRTMDIGGDKNIRYLNIPQ
FT                   EDNPFLGYRAVRIYPEFSGLFRTQLRAILRAAVFGHAQLMIPMVHSLDQILWVKSELKK
FT                   AIAELKEERLRHAQDIPLGIMVEVPSVCYIIDHFCDEVDFFSIGSNDMTQYLYAVDRNN
FT                   PRVSPLYNPITPSFLRMLRQIIHVAHERGKWVGICGELGGESRYLPLLLGLGLDELSMS
FT                   SPRIPAVKSQLRHLDSQACRTLARQACECRSAQEIEALLNQFAPEKEVRPLLALENIFV
FT                   GEPLNNKEQVIQFLCGNLGVNGRTEHPFELEEDVWQREEIVTTAVGFGVAIPHTKSQWI
FT                   RHSSISIARLAQPVDWQSEMGDVELVIMLTLGADEGINHVKVFSQLARKLVNKNFRQSL
FT                   FAASDTDSILALLEAELTF"
FT   gene            complement(489017..489871)
FT                   /locus_tag="SARI_00487"
FT   CDS_pept        complement(489017..489871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bat:BAS3585 3.1e-08 Ada regulatory
FT                   protein/6-O-methylguanine-DNA methyltransferase K00567;
FT                   COG: COG2207 AraC-type DNA-binding domain-containing
FT                   proteins; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00487"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20416"
FT                   /db_xref="GOA:A9MIH9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIH9"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR000005"
FT                   /inference="protein motif:HMMSmart:IPR000005"
FT                   /inference="protein motif:ScanRegExp:IPR000005"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="protein motif:superfamily:IPR011051"
FT                   /inference="similar to AA sequence:INSD:CAJ31227.1"
FT                   /protein_id="ABX20416.1"
FT                   /translation="MNKSDLPADQQFFADLFSGLVLNPHQLGRVWFASHPSTLPSGSLC
FT                   IDLPRLDIVLRGEYGNQLEKTQRRLTEGEMLFIPARAANLPVSDKPVMLLSLVFAPSWL
FT                   GLSFYENRTASLLRPVRRIELPHLQRGEGEAMLTALTHLSRSPQEQNIIQPLVLSLLHL
FT                   CRNVVNTRPDIYRPRTEFLYQSICNWVQDNYAQPLSRESVAQFFNITANHLSRLFTQHG
FT                   TMSFVEYVRWVRMAKARIVLQKYHLPINEVALRCGYQDSDYFCRLFRRQFGLTPGDYGA
FT                   RFQ"
FT   gene            490457..491695
FT                   /locus_tag="SARI_00488"
FT   CDS_pept        490457..491695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2402 4.1e-222 yfdZ; putative
FT                   aminotransferase; COG: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20417"
FT                   /db_xref="GOA:A9MII0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9MII0"
FT                   /inference="protein motif:HMMPfam:IPR004839"
FT                   /inference="similar to AA sequence:INSD:AAX66311.1"
FT                   /protein_id="ABX20417.1"
FT                   /translation="MADFRPDRRFTRIDRLPPYVFNITAELKMAARRRGEDIIDFSMGN
FT                   PDGATPPHIVEKLCTVAQRPDTHGYSTSRGIPRLRRAISHWYQERYDVDIDPETEAIVT
FT                   IGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVEGVDFFNELER
FT                   AIRESYPKPKMMILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVYDGWK
FT                   APSIMQVPGARDVAVEFFTLSKSYNMAGWRIGFMVGNKTLVSALARIKSYHDYGTFTPL
FT                   QVAAIAALEGDQQCVRDIAEQYKRRRDVLVKGLYEAGWMVEMPKASMYVWAKIPEQYAA
FT                   MGSLEFAKKLLNEAKVCVSPGIGFGDYGDTHVRFALIENRDRIRQAVRGIKAMFRADGV
FT                   LPSHPKPVEASTE"
FT   gene            complement(492218..493138)
FT                   /locus_tag="SARI_00489"
FT   CDS_pept        complement(492218..493138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_2404 1.5e-151 putative acyltransferase
FT                   K00680; COG: COG1560 Lauroyl/myristoyl acyltransferase;
FT                   Psort location: CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20418"
FT                   /db_xref="GOA:A9MII1"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="InterPro:IPR030857"
FT                   /db_xref="UniProtKB/TrEMBL:A9MII1"
FT                   /inference="protein motif:HMMPfam:IPR004960"
FT                   /inference="protein motif:HMMTigr:IPR011920"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456943.1"
FT                   /protein_id="ABX20418.1"
FT                   /translation="MFPQSKFSRAFLHPRYWLTWFGVGVLWLLVQLPYPVLRFLGTRTG
FT                   KLARPFLKRRESIAQKNIELCFPALSWEEREKLLAENFHSLGMALLETGMAWFWPDSRV
FT                   RKWFDVDGLDNLTRAQAQNRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNPLMEW
FT                   VQTRGRMRSNKAMIGRNNLRGIVGALKKGEAVWFAPDQDYGPKGSSFAPFFAVENVATT
FT                   NGTYVLSRLSGAAMLTVTMVRKTDNSGYRLYITPEMEGYPADENQAAAYMNKIIEKEIM
FT                   RAPEQYLWIHRRFKTRPLGEASLYI"
FT   gene            493719..493961
FT                   /locus_tag="SARI_00490"
FT   CDS_pept        493719..493961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00490"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13898 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20419"
FT                   /db_xref="GOA:A9MII2"
FT                   /db_xref="InterPro:IPR024470"
FT                   /db_xref="UniProtKB/TrEMBL:A9MII2"
FT                   /inference="similar to AA sequence:INSD:AAL21300.1"
FT                   /protein_id="ABX20419.1"
FT                   /translation="MIYLWTFLVISILAVSCYIGQVMGAFSAVSSFTGMVILVALIYLL
FT                   NVWLQDGDEIGSGLLLFLSPACGLIIRFMVGYGKR"
FT   gene            complement(493923..494048)
FT                   /locus_tag="SARI_00491"
FT   CDS_pept        complement(493923..494048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20420"
FT                   /db_xref="UniProtKB/TrEMBL:A9MII3"
FT                   /protein_id="ABX20420.1"
FT                   /translation="MPMRNNRLAFPGKISADVIGAIYLLTLCMLTLAVPYHKAND"
FT   gene            complement(494032..495339)
FT                   /locus_tag="SARI_00492"
FT   CDS_pept        complement(494032..495339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:30298 1.7e-05 jak2b; Janus kinase 2b
FT                   K04447; COG: COG2271 Sugar phosphate permease; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20421"
FT                   /db_xref="GOA:A9MII4"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9MII4"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="protein motif:HMMTigr:IPR000849"
FT                   /inference="protein motif:ScanRegExp:IPR000849"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217387.1"
FT                   /protein_id="ABX20421.1"
FT                   /translation="MQALLSVFLGYLAYYIVRNNFTLSTPYLKEQLDLSATQIGLLSSC
FT                   MLIAYGISKGVMSSLADKASPKVFMACGLVLCAIVNVGLGFSGAFLIFAALVVFNGLFQ
FT                   GMGVGPSFIIIANWFPRRERGRVGAFWNISHNVGGGIVAPIVGTAFAILGSEHWQSASY
FT                   IVPACVAVIFALVVLLLGKGSPREEGLPSLEQMIPEEKIILKTKNTAKAPENMSAFQIF
FT                   CTYVLRNKNAWYISLVDVFVYMVRFGMISWLPIYLLTVKHFSKEQMSVAFLSFEWVAVL
FT                   STLLAGWLSDKLFKGRRMPLAMICMALIFVCLIGYWKSESLVMVTIFAAIVGCLIYVPQ
FT                   FQASVQKMEIVPGFAVGSAVGLRGFMSYIFGASLGTSLFGVMVDKLGWYGGFYLLMGGI
FT                   VCCILFCYLFHRGALELERQRHALHNQDSLQLADAQ"
FT   gene            495761..496165
FT                   /locus_tag="SARI_00493"
FT   CDS_pept        495761..496165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00493"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1840 ABC-type Fe3+ transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20422"
FT                   /db_xref="UniProtKB/TrEMBL:A9MII5"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217386.1"
FT                   /protein_id="ABX20422.1"
FT                   /translation="MSIFMNGITNRFFPCCSRFARVSGFTLWLAAMLVSCQAYSCELVM
FT                   ATTFSPGATAWIIQRWQTEPGSVMIRTLNRTSGSLEQLLDTANAEDVDLILTSSPMLLQ
FT                   HLQEHQKLALFDSAPAASQKLVPRSIRSTY"
FT   gene            496150..497068
FT                   /pseudo
FT                   /locus_tag="SARI_00494"
FT                   /note="Pseudogene compared to gi|16765722|ref|NP_461337.1|
FT                   activator [Salmonella typhimurium LT2]"
FT   gene            497232..498275
FT                   /locus_tag="SARI_00495"
FT   CDS_pept        497232..498275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2396 1.6e-154 pgtE; phosphoglycerate
FT                   transport: outer membrane protein E K08477; COG: COG4571
FT                   Outer membrane protease; Psort location: OuterMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20423"
FT                   /db_xref="GOA:A9MII6"
FT                   /db_xref="InterPro:IPR000036"
FT                   /db_xref="InterPro:IPR020079"
FT                   /db_xref="InterPro:IPR020080"
FT                   /db_xref="UniProtKB/TrEMBL:A9MII6"
FT                   /inference="protein motif:BlastProDom:IPR000036"
FT                   /inference="protein motif:FPrintScan:IPR000036"
FT                   /inference="protein motif:HMMPfam:IPR000036"
FT                   /inference="protein motif:ScanRegExp:IPR000036"
FT                   /inference="protein motif:ScanRegExp:IPR002048"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217383.1"
FT                   /protein_id="ABX20423.1"
FT                   /translation="MRQVFWRNKCTLVRRFDKIKLHHLSRLYLNIRVREMKTHVIAVMI
FT                   IAVFSESVYAESTLFIPDFSPDSVTTSLSAGVLNGKSRELVYDIDTGRKLSQLDWKIKN
FT                   VAILQGDLSWDPYSFVTLNARGWTSLASGSGHLVDRDWMNSEQSGWTDRSIHPDTSVNH
FT                   ANEYDLNVKGWLLQGDNFKAGVTAGYQETRFSWTARGGSYSYDNGQYIGNFPPGKRVIG
FT                   YSQRFEMPYIGLAGHYRINDFEGNVMFKYSDWVHAHDNDEHYMRKLTFREKTGSSRYYG
FT                   ASVNAGYYITNNAKIFAEFAYSKYEEGKGGTQIIDKTSGDSEYFGGDVAGIANNNYTVT
FT                   AGLQYRF"
FT   gene            complement(498455..499575)
FT                   /pseudo
FT                   /locus_tag="SARI_00496"
FT                   /note="Pseudogene compared to gi|16764594|ref|NP_460209.1|
FT                   putative cytoplasmic protein [Salmonella typhimurium LT2]"
FT   gene            complement(499674..499892)
FT                   /locus_tag="SARI_00497"
FT   CDS_pept        complement(499674..499892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20424"
FT                   /db_xref="UniProtKB/TrEMBL:A9MII7"
FT                   /protein_id="ABX20424.1"
FT                   /translation="MKKFDCNSFLYDVQFGDFLKVSRGVYCYDNVLIKSYDLLTSNTGQ
FT                   LKYFYENISIFYLYFYKAVIERKNAKM"
FT   gene            500499..500741
FT                   /locus_tag="SARI_00498"
FT   CDS_pept        500499..500741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00498"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2801 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20425"
FT                   /db_xref="GOA:A9MII8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A9MII8"
FT                   /inference="protein motif:HMMPfam:IPR001584"
FT                   /inference="protein motif:superfamily:IPR012337"
FT                   /inference="similar to AA sequence:REFSEQ:NP_085444.1"
FT                   /protein_id="ABX20425.1"
FT                   /translation="MSRRGNCWDNSLMDRFFRSLKNEWMPVTGYINFSEAAHAITNIIV
FT                   GYYSSLRPHEYNGGLPPNESEYRYWKNSKAVASFR"
FT   gene            501213..501725
FT                   /locus_tag="SARI_00499"
FT   CDS_pept        501213..501725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00499"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20426"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:A9MII9"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:REFSEQ:YP_049192.1"
FT                   /protein_id="ABX20426.1"
FT                   /translation="MLSYDIVAAVKNQMANLGIVADSTQLNGLASLPFSYDELVVFAPA
FT                   KGRWHDTESTTFEEIVAAEFIGLSEGSALQEHIEDHAKKLGRRLNYRVRMTTFDAMMQI
FT                   VSSGVGIAIIPKHAAERYYHHHNYKIIRLSERWADRKLIFCARDFADLPDYIKEVVDFL
FT                   AQPPVDS"
FT   gene            complement(501729..502133)
FT                   /locus_tag="SARI_00500"
FT   CDS_pept        complement(501729..502133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00500"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0730 Predicted permeases; Psort location:
FT                   CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20427"
FT                   /db_xref="GOA:A9MIJ0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIJ0"
FT                   /inference="protein motif:HMMPfam:IPR002781"
FT                   /inference="similar to AA sequence:REFSEQ:YP_049191.1"
FT                   /protein_id="ABX20427.1"
FT                   /translation="MVCGGLIATKFPSPDEAEKWLSPLVSYITGAITAATGVFIIPAAP
FT                   YLQSLQLNKNDLVQALGLAFTASTIALAMRLSLGSKLDHVDYYLSAIALIPTIAGMCAG
FT                   QYLRKVISELTFRYYFFIGLIAPGAYMALK"
FT   gene            complement(502087..502446)
FT                   /locus_tag="SARI_00501"
FT   CDS_pept        complement(502087..502446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH3153 0.00026 cytochrome C oxidase heme
FT                   b and copper-binding subunit K00404; COG: COG0730 Predicted
FT                   permeases; Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20428"
FT                   /db_xref="GOA:A9MIJ1"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIJ1"
FT                   /inference="protein motif:HMMPfam:IPR002781"
FT                   /inference="similar to AA sequence:REFSEQ:YP_049191.1"
FT                   /protein_id="ABX20428.1"
FT                   /translation="MITIMSVFLLAGIVKGVVGLGLPTISMGLLTVVMAQASAASLLII
FT                   PSLATNIWQLFTGPAFLSLIKRLWGFIAGIFIGTLFSVLPGLTSTSSWTEAVPGIVLIM
FT                   YGLWGAYCHEVPVPG"
FT   gene            502717..503895
FT                   /locus_tag="SARI_00502"
FT   CDS_pept        502717..503895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C7499 2.4e-91 acyl-CoA
FT                   dehydrogenase K00253; COG: COG1960 Acyl-CoA dehydrogenases;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20429"
FT                   /db_xref="GOA:A9MIJ2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIJ2"
FT                   /inference="protein motif:Gene3D:IPR006091"
FT                   /inference="protein motif:Gene3D:IPR013764"
FT                   /inference="protein motif:Gene3D:IPR013786"
FT                   /inference="protein motif:HMMPfam:IPR006091"
FT                   /inference="protein motif:HMMPfam:IPR013107"
FT                   /inference="protein motif:superfamily:IPR009075"
FT                   /inference="protein motif:superfamily:IPR009100"
FT                   /inference="similar to AA sequence:INSD:CAG67369.1"
FT                   /protein_id="ABX20429.1"
FT                   /translation="MKSMISPQLSKLLSDANDIAQWLRHSASERDQTRHISTEQVDAYA
FT                   SSGLWAVTVPKEYGGPDLGYKVLSQITRLIAAADPSIAQIPRGHFHIIDLLKAVALPSQ
FT                   KMFFFREILAGKKFAQAASEIGGKNVADIQTMLTQERGGWRLNGKKYYATGCIHADWIG
FT                   IVAKDDIGVFMHAFVPKDAPGMDIKADWSGFGQKVTASGTVLLNDVVVNEEHIIPFTEA
FT                   FLDVHPIGAVSQLIHASIDIGIARESIDETIKYIRQTARPWIDSGVEQASDDPYLISGV
FT                   GDLEIRYAAAVAMLDQVAGELDETVISTDADLARLSVRVGIAKVLANDIALLASNKLFE
FT                   FAGTSSTRESLNLHRHWRNARTHTLHDPVRWKVNAIGQYYLNGVYPKRHNYI"
FT   gene            complement(503906..504076)
FT                   /locus_tag="SARI_00503"
FT   CDS_pept        complement(503906..504076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00503"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2963 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20430"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIJ3"
FT                   /protein_id="ABX20430.1"
FT                   /translation="MWFFLIYWLMWSCELPRSGKPHTPELRQEALKLAEHIGVTAAAGD
FT                   LCLYESQPYAG"
FT   gene            504246..504656
FT                   /locus_tag="SARI_00504"
FT   CDS_pept        504246..504656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_3275 7.1e-16 L-lysine
FT                   6-monooxygenase (NADPH) K03897; COG: COG3486
FT                   Lysine/ornithine N-monooxygenase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20431"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIJ4"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01649190.1"
FT                   /protein_id="ABX20431.1"
FT                   /translation="MACYSEYFSKLLLHLCQKNNRENILTSDGISGAMLRAIYQKLYCL
FT                   QFITPGELEFDLMTSRSVSNVVQTPSGRCRVYYKHPDVERAEHIEADIIILATDYVAAE
FT                   KNLLNGLKERIHYENDVFVIDDDFAIVWVGPR"
FT   gene            complement(505191..505262)
FT                   /locus_tag="SARI_00505"
FT   tRNA            complement(505191..505262)
FT                   /locus_tag="SARI_00505"
FT                   /product="tRNA-Arg"
FT   gene            complement(505338..506279)
FT                   /locus_tag="SARI_00506"
FT   CDS_pept        complement(505338..506279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00506"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_4690 8.2e-10 formate transporter
FT                   K00122; COG: COG2116 Formate/nitrite family of
FT                   transporters; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20432"
FT                   /db_xref="GOA:A9MIJ5"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIJ5"
FT                   /inference="similar to AA sequence:INSD:CAD07625.1"
FT                   /protein_id="ABX20432.1"
FT                   /translation="MDSLNNDKIKQHSSDLEVESEEKQSGKEIEVDEDRLPSRAMAIHE
FT                   HIRQDGEKEMERDAMALLWSAIAAGLSMGASLLAKGVFHVQLAGVPGGFLLENLGYTFG
FT                   FIIVIMARQQLFTENTVTAVLPVMQNLTLSNVGLLMRLWGVVLLGNLIGTGVAAWAFEY
FT                   MPIFDEETRDAFVKIGMEVMKNSPTEMFANAIISGWIIATMVWMFPAAGGAKIVVIILM
FT                   TWLIALGDTTHIVVGSVEILYLVFNGALPWHDFIWPFALPTLAGNICGGTFIFALMSHA
FT                   QIRNDMSNKRKEEARLRGERIEKARKKEEKQC"
FT   gene            506472..507323
FT                   /locus_tag="SARI_00507"
FT   CDS_pept        506472..507323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00507"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2853 Surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20433"
FT                   /db_xref="GOA:A9MIJ6"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIJ6"
FT                   /inference="protein motif:FPrintScan:IPR007428"
FT                   /inference="protein motif:HMMPfam:IPR007428"
FT                   /inference="similar to AA sequence:INSD:AAV76474.1"
FT                   /protein_id="ABX20433.1"
FT                   /translation="MLLKSLTPKQADTVAFRHGWQSAIAIIYRETFMKLRLSALALGTT
FT                   LLVGCASSGTEQQGRSDPFEGFNRTMYNFNFNVLDPYVVRPVAVAWRDYVPQPARNGLS
FT                   NFTGNLEEPAIMVNYFLQGDPYQGMVHFTRFFLNTLLGMGGFVDVAGMANPKLQRVEPH
FT                   RFGSTLGHYGVGYGPYVQLPFYGSFTLREDGGDMADTLYPVLSWLTWPMSVGKWAIEGI
FT                   ETRAQLLDSDGLLRQSSDPYIMVREAYFQRHDFIANGGKLKPQENPNAQEIQDELKEID
FT                   SE"
FT   gene            complement(507384..508697)
FT                   /locus_tag="SARI_00508"
FT   CDS_pept        complement(507384..508697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00508"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2067 Long-chain fatty acid transport
FT                   protein; Psort location: OuterMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20434"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIJ7"
FT                   /inference="protein motif:HMMPfam:IPR005017"
FT                   /inference="similar to AA sequence:INSD:AAV76475.1"
FT                   /protein_id="ABX20434.1"
FT                   /translation="MVMSQKTLFTKSALAVAVAIISTQAWSAGFQLNEFSSSGLGRAYS
FT                   GEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRTLDADNIAPTA
FT                   WVPNVHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRL
FT                   NDAWSFGLGFDAVYARAKIERYAGDLGQLIAAQSPALAPIASRIPSDTKIAHLNGNQWG
FT                   FGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLPLVVNNYNLPIPTATAGATQSG
FT                   YLTLNLPEMWEVSGYNRVAPQWAIHYSLAYTSWSQFQQLKAKSTAGDTLFEKHEGFKDA
FT                   YRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASV
FT                   DVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF"
FT   gene            509104..509346
FT                   /locus_tag="SARI_00509"
FT   CDS_pept        509104..509346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00509"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3691 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20435"
FT                   /db_xref="InterPro:IPR005272"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ35"
FT                   /inference="protein motif:HMMPfam:IPR005272"
FT                   /inference="protein motif:HMMTigr:IPR005272"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456931.1"
FT                   /protein_id="ABX20435.1"
FT                   /translation="MDVGTIMDNSDCTASYSRVFATRAEAEETLAALTEKARSVESEPC
FT                   QITPTFTEESDGVRLDIDFVFACEAETLIFQLGLR"
FT   gene            509522..510832
FT                   /locus_tag="SARI_00510"
FT   CDS_pept        509522..510832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2391 4.5e-223 yfcY; paral putative
FT                   acetyl-CoA acetyltransferase K00632; COG: COG0183
FT                   Acetyl-CoA acetyltransferase; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20436"
FT                   /db_xref="GOA:A9MJ36"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012806"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MJ36"
FT                   /inference="protein motif:HMMPanther:IPR002155"
FT                   /inference="protein motif:HMMPfam:IPR002155"
FT                   /inference="protein motif:HMMTigr:IPR002155"
FT                   /inference="protein motif:HMMTigr:IPR012806"
FT                   /inference="protein motif:ScanRegExp:IPR002155"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217378.1"
FT                   /protein_id="ABX20436.1"
FT                   /translation="MRQALPLVTRQGDRIAIVSGLRTPFARQATAFHGIPAVDLGKMVV
FT                   SELLARSEIPADAIEQLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQ
FT                   AVANVAESLMAGTIRAGIAGGADSSSVLPIGVSKALARVLVDVNKARTTRQRLTLFSRL
FT                   RLRDLLPVPPAVAEYSTGLRMGDTAEQMAKTYGITREQQDALAYRSHQRAAQAWAEGKL
FT                   AEEVMTTYAPPYKNPFSEDNNIRGNSTLADYAKLRPAFDRKHGSVTAANSTPLTDGAAA
FT                   VILMTESRAKELGLRPLGYLRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTMADLTLF
FT                   DMHEAFAAQTLANLQLLGSERFARDVLGRAQATGEVDDTKFNVLGGSIAYGHPFAATGA
FT                   RMITQTLHELRRRGGGFGLVTACAAGGLGAAMVLEAE"
FT   gene            510832..512976
FT                   /locus_tag="SARI_00511"
FT   CDS_pept        510832..512976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2390 0. yfcX; paral putative
FT                   dehydrogenase K00022:K01692:K01782; COG: COG1250
FT                   3-hydroxyacyl-CoA dehydrogenase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20437"
FT                   /db_xref="GOA:A9MJ37"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012802"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ37"
FT                   /inference="protein motif:Gene3D:IPR006108"
FT                   /inference="protein motif:HMMPfam:IPR001753"
FT                   /inference="protein motif:HMMPfam:IPR006108"
FT                   /inference="protein motif:HMMPfam:IPR006176"
FT                   /inference="protein motif:HMMTigr:IPR012802"
FT                   /inference="protein motif:ScanRegExp:IPR006180"
FT                   /inference="protein motif:superfamily:IPR008927"
FT                   /protein_id="ABX20437.1"
FT                   /translation="MTTSAFTLNVRLDNVAVVSIDVPGEKVNTLKAEFAAQARAILKQI
FT                   RENKVLQGVVFISAKADNFIAGADINMIGRCQSAQEAETLARQGQQLMAEIQALPVPVI
FT                   AAIHGACLGGGLEMALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTA
FT                   LDMILTGKQLRARQALKTGLVDDVVPQTILLEAAVELAKKDRLAQRTLPVRERILAGAL
FT                   GRTLLFRLVRKKTAQKTQGNYPATERIIDVIETGLAQGSGNGYDAEACAFGELAMTPQS
FT                   QALRNLFFASTQVKKDPGSDAPSGPLNSVGILGGGLMGGGIALVTACKGGLPVRIKDIN
FT                   AKGINHALKYSWDQLETKVRRRHIKASERDKQLALISGSTDYRGFSHRDLIIEAVFEDL
FT                   SLKQQMVAEVEQNCASHTIFASNTSSLPIGDIAAYAGRPEQVIGLHFFSPVEKMPLVEV
FT                   IPHASTSAQTIATTVKLAKKQGKTPIVVSDKAGFYVNRILAPYINEAIRMLTEGERVEH
FT                   IDAALVKFGFPVGPIQLLDEVGIDTGTKIIPVLEAAYGERFSAPANVVASILNDGRKGR
FT                   KNGRGFYLYGEKGRESKKKVDNAIYKVIGVQGQSRLSAHQVAERCVMLMLNEAARCFDE
FT                   KVIRSARDGDIGAVFGIGFPPFLGGPFRYMDALGPGEVVATLQRLAALYGPRYAPCEQL
FT                   MRMAERGEHFWMNEETDQGN"
FT   gene            513185..513670
FT                   /locus_tag="SARI_00512"
FT   CDS_pept        513185..513670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2619 1.7e-81 phosphohistidine
FT                   phosphatase K08296; COG: COG2062 Phosphohistidine
FT                   phosphatase SixA; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20438"
FT                   /db_xref="GOA:A9MJ38"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ38"
FT                   /inference="protein motif:HMMPfam:IPR013078"
FT                   /inference="protein motif:HMMTigr:IPR004449"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456928.1"
FT                   /protein_id="ABX20438.1"
FT                   /translation="MQVFIMRHGDAALDAASDSVRPLTSCGCDESRLMANWLKGQKVDI
FT                   ERVLVSPFLRAEQTLDVVGDCMNLPAQVDVLPELTPCGDVGLVSAYLHALANEEIESVL
FT                   VISHLPLVGYLVSELCPGETPPMFTTSAIANVTLDESGKGTFNWQMSPCNLKMAKAI"
FT   gene            complement(513718..514269)
FT                   /locus_tag="SARI_00513"
FT   CDS_pept        complement(513718..514269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00513"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2840 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20439"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR022990"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MJ39"
FT                   /inference="protein motif:HMMPfam:IPR002625"
FT                   /inference="protein motif:HMMSmart:IPR002625"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149792.1"
FT                   /protein_id="ABX20439.1"
FT                   /translation="MKKKASLSEEDQTLFRQLMVGTRQIKQDTIVHRPQRKKITEVPTR
FT                   RLIQEQADASHYFSDEFQPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLDLHGLT
FT                   QLQAKQELGALITACRREHIFCACVMHGHGKHILKQQTPLWLAQHPHVMAFHQAPKEYG
FT                   GDAALLVLIEVEEWQPPELP"
FT   gene            complement(514372..515346)
FT                   /locus_tag="SARI_00515"
FT   CDS_pept        complement(514372..515346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20441"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ40"
FT                   /inference="similar to AA sequence:INSD:CAE55836.1"
FT                   /protein_id="ABX20441.1"
FT                   /translation="MFTGREQLRFGQHKDAIAAVVKLQPGERHIRVLLHQMYHAVSDFT
FT                   NQNARIGQIIRRIPQDTAGQFKAVSAGRQPQLRFVAIFVWQIGHIFRIDIGRVSDNQIV
FT                   LNFRQIAEQIGADWRHVMDKTVLFNVMLGDSQRIRRNIDRINLSVRKSISTGDGDTAAA
FT                   GTHIQNIFRLLANKTCKVVINQLANGRTRHQHALIDIKFVAAEPGLIGQVGYRNTLVDT
FT                   TNHSLNNAMFFAGRQPRGTHIFRNIQRQIKRRQHQLHRLIPRVIGAVSIPDIRRAKTAY
FT                   RPAQHVLNGMQFIHCFIDENFIHVFLQGMLALNSAASLPRRQG"
FT   gene            514435..515367
FT                   /locus_tag="SARI_00514"
FT   CDS_pept        514435..515367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2385 3.5e-168 yfcB; putative methylase
FT                   K07320; COG: COG2890 Methylase of polypeptide chain release
FT                   factors; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00514"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20440"
FT                   /db_xref="GOA:A9MJ41"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017127"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ41"
FT                   /inference="protein motif:HMMPfam:IPR013217"
FT                   /inference="protein motif:HMMTigr:IPR004556"
FT                   /inference="protein motif:ScanRegExp:IPR002052"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456926.1"
FT                   /protein_id="ABX20440.1"
FT                   /translation="MDKIFVDEAVNELHTIQDMLRWAVSRFSAANIWYGHGTDNPWDEA
FT                   VQLVLPSLYLPLDIPEDMRTARLTSSEKHRIVERVIRRVNERIPVAYLTNKAWFCGHEF
FT                   YVDERVLVPRSPIGELINNHFAGLISQQPKYILDMCTGSGCIAIACAYAFPDAEVDAVD
FT                   ISPDALAVAEHNIEEHGLIHHVTPIRSDLFRDLPKVQYDLIVTNPPYVDAEDMSDLPNE
FT                   YRHEPELGLASGTDGLKLTRRILGNAPDYLSDAGVLICEVGNSMVHLMEQYPDVPFTWL
FT                   EFDNGGDGVFMLTKAQLLAAREHFNIYKD"
FT   gene            515403..516488
FT                   /locus_tag="SARI_00516"
FT   CDS_pept        515403..516488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0480 1.5e-190 aroC; chorismate synthase
FT                   K01736; COG: COG0082 Chorismate synthase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00516"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20442"
FT                   /db_xref="GOA:A9MJ42"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MJ42"
FT                   /inference="protein motif:BlastProDom:IPR000453"
FT                   /inference="protein motif:HMMPfam:IPR000453"
FT                   /inference="protein motif:HMMTigr:IPR000453"
FT                   /inference="protein motif:ScanRegExp:IPR000453"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149794.1"
FT                   /protein_id="ABX20442.1"
FT                   /translation="MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDL
FT                   DRRRPGTSRYTTQRREPDQVKILSGVFDGVTTGTSIGLLIENTDQRSQDYSAIKDVFRP
FT                   GHADYTYEQKYGLRDYRGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDI
FT                   PLEIKDWQQVERNPFFCPDADKLDALDELMRALKKEGDSIGAKVTVIASGVPAGLGEPV
FT                   FDRLDADIAHALMSINAVKGVEIGEGFKVVALRGSQNRDEITAQGFQSNHAGGILGGIS
FT                   SGQHIVAHMALKPTSSITVPGRTINRMGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVL
FT                   MDHLLRHRAQNADVKTEIPRW"
FT   gene            516492..517316
FT                   /locus_tag="SARI_00517"
FT   CDS_pept        516492..517316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0481 2.2e-150 mepA;
FT                   penicillin-insensitive murein endopeptidase precursor
FT                   K07261; COG: COG3770 Murein endopeptidase; Psort location:
FT                   Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20443"
FT                   /db_xref="GOA:A9MJ43"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MJ43"
FT                   /inference="protein motif:BlastProDom:IPR005073"
FT                   /inference="protein motif:HMMPfam:IPR005073"
FT                   /inference="protein motif:HMMPIR:IPR005073"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456924.1"
FT                   /protein_id="ABX20443.1"
FT                   /translation="MKKTAIALLAWFVSSASLAATPWQKITHPVPGAAQSVGSFANGCI
FT                   IGADTLPVQSDNYQVMRTDQRRYFGHPDLVMFIQRLSHQAHQRGLGTVLIGDMGMPAGG
FT                   RFNGGHASHQTGLDVDIFLQLPKTRWSQAQLLRPQALDLVSRDGKHVVPSRWSSDIASL
FT                   IKLAAEDNDVTRIFVNPAIKQQLCLDAGSDRDWLRKVRPWFQHRAHMHVRLRCPADSLE
FT                   CEDQPLPPPGDGCGAELQSWFEPPKPGTTKPEKKTPPPLPPSCQALLDEHVL"
FT   gene            517316..518125
FT                   /locus_tag="SARI_00518"
FT   CDS_pept        517316..518125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00518"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0730 Predicted permeases; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00518"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20444"
FT                   /db_xref="GOA:A9MJ44"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ44"
FT                   /inference="protein motif:HMMPfam:IPR002781"
FT                   /inference="similar to AA sequence:INSD:AAV76484.1"
FT                   /protein_id="ABX20444.1"
FT                   /translation="MDNFYELFMVSPLLLVVLFFVAVLAGFIDSIAGGGGLLTIPALMA
FT                   AGMSPANALATNKLQACGGSLSSSLYFIRRKVVNLAEQKLNILMTFIGSMSGALLVQHV
FT                   QADILRQILPILVIFIGLYFLLMPKLGEEDRQRRLYGLPFALIAGGCVGFYDGFFGPAA
FT                   GSFYALAFVTLCGYNLAKSTAHAKVLNATSNVGGLLLFIIGGKVIWATGFVMLVGQFLG
FT                   ARMGSRLVLSKGQKLIRPMIVIVSAVMSAKLLYDSHGQEILHWLGMN"
FT   gene            518125..518673
FT                   /locus_tag="SARI_00519"
FT   CDS_pept        518125..518673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00519"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3101 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00519"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20445"
FT                   /db_xref="InterPro:IPR007411"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ45"
FT                   /inference="protein motif:HMMPfam:IPR007411"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149797.1"
FT                   /protein_id="ABX20445.1"
FT                   /translation="MNSTHHYEQLIEIFNGCFAAEFNTRLIKGDDEPIYLPANAQVPYH
FT                   RIVFAHGFYASALHEISHWCIAGKARRELVDFGYWYCPDGRDAQTQSQFEDVEVKPQAF
FT                   DWLFCVAAGYPFNVSCDNLEGDIEPDRVAFQRRVHAQVMAYLEQGIPERPARFIKALQN
FT                   YYHTPELKAEQFPWPEELN"
FT   gene            518706..518978
FT                   /locus_tag="SARI_00520"
FT   CDS_pept        518706..518978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00520"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13546 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20446"
FT                   /db_xref="InterPro:IPR014987"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ46"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456922.1"
FT                   /protein_id="ABX20446.1"
FT                   /translation="MIAEFESRILALIDDMVEHASDDELFASGYLRGHLTLAIAELESG
FT                   VDHSVEAVYANVSQSLEKAIGAGELSPRDQALVKAMWDNLFDKAK"
FT   gene            complement(519029..521029)
FT                   /locus_tag="SARI_00521"
FT   CDS_pept        complement(519029..521029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF1701 1.7e-184 hypothetical protein
FT                   K00599; COG: COG0665 Glycine/D-amino acid oxidases
FT                   (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20447"
FT                   /db_xref="GOA:A9MJ47"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MJ47"
FT                   /inference="protein motif:HMMPfam:IPR006076"
FT                   /inference="protein motif:HMMPfam:IPR008471"
FT                   /protein_id="ABX20447.1"
FT                   /translation="MKQYAIQPATLEFNAEGTPVSRDFDDVYFSNDNGLEETRYVFLGG
FT                   NRLAERFPVHSHPLFIVAESGFGTGLNFLTLWQAFNNFRSEHPQATLQRLHFVSFEKFP
FT                   LTRDDLALTHQHWPELAPWAEQLQAQWPLPLAGCHRLLLDQGRVTLDLWFGDINELTDQ
FT                   LDATLNQKVDAWFLDGFAPAKNPDMWTPNLFNTMARLARPGATLATFTSAGFVRRGLQE
FT                   AGFTMQKRKGFGRKREMLCGVMERCLTPTISAPWFYRSGSEKRETAIIGGGIASALLSL
FT                   ALLRRGWQVTLYCADDKPARGASGNQQGALYPLLSKHDAAINRFFPTAFTFARRLYDAL
FT                   PVSFDHDWCGVTQLGWDEKSQQKIARMLSLALPAGLASALNAEETTQAVGVTTRCGGIT
FT                   YPAGGWLCPEQLTRAVIALATEQGLQTRFRHTLTSLAAQKSQWQLRFASGEAASHDTVV
FT                   LANGHQINRFDQTQPLPVYAVGGQVSHIPTTPALSALRQVLCYDGYLTPQNPNNRQHCI
FT                   GASYHRGNESTVWREEDQRQNRQRLLDCFPDADWAKEVDVSDNSARCGVRCATRDHLPM
FT                   VGNVPDYHATLTHYADLADNKASAVPAPVYPGLFMLGALGSRGLCSAPLCAEILAAQMS
FT                   NEPIPLDASTLAALNPNRLWVRKLLKGKAVK"
FT   gene            521189..522409
FT                   /locus_tag="SARI_00522"
FT   CDS_pept        521189..522409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0486 8.9e-211 fabB;
FT                   3-oxoacyl-[acyl-carrier-protein] synthase I K00647; COG:
FT                   COG0304 3-oxoacyl-(acyl-carrier-protein) synthase; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20448"
FT                   /db_xref="GOA:A9MJ48"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ48"
FT                   /inference="protein motif:HMMPanther:IPR000794"
FT                   /inference="protein motif:HMMPfam:IPR000794"
FT                   /inference="protein motif:ScanRegExp:IPR000794"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149800.1"
FT                   /protein_id="ABX20448.1"
FT                   /translation="MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMR
FT                   SQVWGNVKLDTTGLIDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAG
FT                   SGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIFGVNYSISSAC
FT                   ATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTY
FT                   DAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM
FT                   QMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDKSPAISATKAMTGHSLGAAGV
FT                   QEAIYSLLMLEHGFIAPSINIEQMDEQAAGLNIVTETTERGLTTVMSNSFGFGGTNATL
FT                   VMRKLKG"
FT   gene            complement(522576..523094)
FT                   /locus_tag="SARI_00523"
FT   CDS_pept        complement(522576..523094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00523"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG26784 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20449"
FT                   /db_xref="InterPro:IPR024289"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ49"
FT                   /inference="similar to AA sequence:INSD:AAV76490.1"
FT                   /protein_id="ABX20449.1"
FT                   /translation="MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFTNDVNTP
FT                   DDTTALMQRYVAKEVIHRLALIQSLYEQAIVGADYFMYAQDYAPEWIPQLRVGKAHPFL
FT                   GGEKVDVLLGTESTPIHLEVYTRWEEGRWKIYRVRDADKGYEQPIYDAGAITQAEAWSA
FT                   KIATEYEKY"
FT   gene            complement(523094..523462)
FT                   /locus_tag="SARI_00524"
FT   CDS_pept        complement(523094..523462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00524"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG18512 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00524"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20450"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ50"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217364.1"
FT                   /protein_id="ABX20450.1"
FT                   /translation="MSWDKRMAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHA
FT                   KDYGPMLRSAGFTAIGTYEMPREGDVIIIQPYAGGNPSGHMAIYDGAEWYSDFKQRDMW
FT                   AGPGYRAARPSYTIYRKN"
FT   gene            complement(523631..523879)
FT                   /locus_tag="SARI_00525"
FT   CDS_pept        complement(523631..523879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00525"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3423 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20451"
FT                   /db_xref="GOA:A9MJ51"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ51"
FT                   /inference="protein motif:HMMPfam:IPR001387"
FT                   /inference="protein motif:HMMSmart:IPR001387"
FT                   /inference="protein motif:superfamily:IPR010982"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456916.1"
FT                   /protein_id="ABX20451.1"
FT                   /translation="MEPKSQDWHRADIKSALEKRGITLRDLSRQAGLSPDSLRNVFTRS
FT                   WPRAERIIADALGITPQEIWPSRYGDMQIKNDADTAE"
FT   gene            524052..524426
FT                   /locus_tag="SARI_00526"
FT   CDS_pept        524052..524426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00526"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG28278 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00526"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20452"
FT                   /db_xref="GOA:A9MJ52"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ52"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:superfamily:IPR009061"
FT                   /inference="similar to AA sequence:INSD:AAV76493.1"
FT                   /protein_id="ABX20452.1"
FT                   /translation="MAKEWFTVKECLGLPGFPGSEPAVRERLYKYSEGKEGVRRKRLKS
FT                   KAEEFHISVFPLYVHRYLDEGGEEPVSDHISVQEAEPKDIWEMMFRLLTPEQRKQVTGL
FT                   FRVKGMKAVFPFLFDGKPPR"
FT   gene            524604..525782
FT                   /locus_tag="SARI_00527"
FT   CDS_pept        524604..525782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll2324 0.00030
FT                   long-chain-fatty-acid--[acyl-carrier-protein] ligase /
FT                   acyl-[acyl-carrier-protein]-phospholipid O-acyltransferase
FT                   K05939:K01909; COG: COG0477 Permeases of the major
FT                   facilitator superfamily; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20453"
FT                   /db_xref="GOA:A9MJ53"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR037541"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MJ53"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149806.1"
FT                   /protein_id="ABX20453.1"
FT                   /translation="MTAVSQKTHTPPANFLLFRIAFAVFLTYMTVGLPLPVIPLFVRHE
FT                   LGYSNTMVGIAVGIQFFATVLTRGYAGRLADQYGAKRSALQGMLACGLAGAAWLLAALL
FT                   PVSASVKFALLIVGRLILGFGESQLLTGTLTWGMGLVGPARSGKVMSWNGMAIYGALAA
FT                   GAPLGLLIHSHFGFAALAVTTMALPLLAWAFNGTVRKVPAHAGERPSLWSVVGLIWKPG
FT                   LGLALQGVGFAVIGTFISLYFASNGWAMAGFTLTAFGGAFVLMRMLFGWMPDRFGGVKV
FT                   AIVSLLVETAGLLLLWLAPMAWIALVGAALTGAGCSLIFPALGVEVVKRVPSQVRGTAL
FT                   GGYAAFQDISYGVTGPLAGVLATSCGYSSVFLAGALSAVVGILVTILSFRRG"
FT   gene            complement(525779..526780)
FT                   /locus_tag="SARI_00528"
FT   CDS_pept        complement(525779..526780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00528"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06277 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20454"
FT                   /db_xref="GOA:A9MJ54"
FT                   /db_xref="InterPro:IPR023597"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ54"
FT                   /inference="similar to AA sequence:INSD:AAV76495.1"
FT                   /protein_id="ABX20454.1"
FT                   /translation="MHPISGAPAQPPGEGQNPLSAAGEQPLSMQQRTVLERLITRLISL
FT                   SQQQSAEVWAGMKHDLGIKNDAPLLSRHFPAAEQNLTQRLGVAQQNHANRQVLSQLTEL
FT                   LGVGNNRQAVSDFIRQQYGQTALSQLTPDQLKNVLTLLQQGQLSIPQPQQRPATDRPLL
FT                   PAEHNTLNQLVTKLAAATGESSKLIWQSMLELSGVKSGELIPAKQFTHLVTWLQARQTL
FT                   SLQHAPTLHTLQAALKQPLEPDELTAIKEYAQHMYQIQPQTVLTTAQVQDLLNHIFLRR
FT                   VEREADELEPLSIQPVYRPFAPMIETVKNLSARPGLLFIALMIVLALFWLVS"
FT   gene            526884..528020
FT                   /locus_tag="SARI_00529"
FT   CDS_pept        526884..528020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2372 3.5e-193 pdxB;
FT                   erythronate-4-phosphate dehyrogenase K03473; COG: COG0111
FT                   Phosphoglycerate dehydrogenase and related dehydrogenases;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20455"
FT                   /db_xref="GOA:A9MJ55"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR020921"
FT                   /db_xref="InterPro:IPR024531"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038251"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MJ55"
FT                   /inference="protein motif:HMMPfam:IPR006139"
FT                   /inference="protein motif:HMMPfam:IPR006140"
FT                   /inference="protein motif:ScanRegExp:IPR006140"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217359.1"
FT                   /protein_id="ABX20455.1"
FT                   /translation="MKILVDENMPYARELFSRLGEVKTVPGRPIPVEELNHADALMVRS
FT                   VTKVNESLLSGTPIKFVGTATAGTDHVDEAWLKQEGIGFSAAPGCNAIAVVEYVFSALL
FT                   MLAERDGFSLRDRTVGIVGVGNVGSRLQTRLEALGIRTLLCDPPRAARGDEGDFRTMDE
FT                   VVEEADVLTFHTPLYKDGPYKTLHLVDETLIRRLKPGAILINACRGPVVDNAALLARLT
FT                   AGQPISVVLDVWEGEPDLNVALLDAVDIGTSHIAGYTLEGKARGTTQVFEAYSAFIGRE
FT                   QHVALETLLPAPEFGRITLHGPLDQPTLKRLAHLVYDVRRDDAPLRKVAGIPGEFDKLR
FT                   KNYLERREWSSLYVMCDDASAAALLQKLGFNAVHHPAR"
FT   gene            528080..529093
FT                   /locus_tag="SARI_00530"
FT   CDS_pept        528080..529093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2604 1.6e-158 usg; USG-1 protein
FT                   K00133; COG: COG0136 Aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20456"
FT                   /db_xref="GOA:A9MJ56"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ56"
FT                   /inference="protein motif:HMMPfam:IPR000534"
FT                   /inference="protein motif:HMMPfam:IPR012280"
FT                   /inference="protein motif:HMMPIR:IPR012080"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456911.1"
FT                   /protein_id="ABX20456.1"
FT                   /translation="MSEGWNIAVLGATGAVGEALLETLAERQFPVGEIYALARHESAGE
FT                   HLRFGGKSVIVQDAADFDWTQAQLAFFVAGAEASAAWVEDATNAGCLVIDSSGLFALEP
FT                   DVPLVVPEVNPYVLADYRNRNLIAVADSLTSQLLAALKPLIDQGGLSRIAVTSMLSASA
FT                   QGKKAVDALAGQSAKLLNGIPIDEDDFFGRQLAFNMLPLLPDREGSVRQERRIVDEVRK
FT                   ILQDDGVMISASVVQSPVFYGHAQMVSFEALRPLAAEEAREALSRGEDIVLSEETDYPT
FT                   QVGDASGNPQLSIGCVHNDYGMPEQIQFWSVADNIRFGGALMAVKTAEKLVQEYLY"
FT   gene            529093..529905
FT                   /locus_tag="SARI_00531"
FT   CDS_pept        529093..529905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0496 4.6e-143 truA; tRNA pseudouridine
FT                   synthase A K06173; COG: COG0101 Pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20457"
FT                   /db_xref="GOA:A9MJ57"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MJ57"
FT                   /inference="protein motif:Gene3D:IPR001406"
FT                   /inference="protein motif:HMMPanther:IPR001406"
FT                   /inference="protein motif:HMMPfam:IPR001406"
FT                   /inference="protein motif:HMMTigr:IPR001406"
FT                   /inference="similar to AA sequence:INSD:AAV76498.1"
FT                   /protein_id="ABX20457.1"
FT                   /translation="MSGQQSSPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ
FT                   VANEPINVFCAGRTDAGVHGTGQVVHFETTALRKDVAWTLGVNANLPGDIAVRWVKAVA
FT                   DDFHARFSATARRYRYIIYNHRLRPAVLAKGVTHYYKPLDAERMHRAAQCLIGENDFTS
FT                   FRAVQCQSRTPWRNVMHISVTRHGPYVVVDIKANAFVHHMVRNIVGSLLEVGAHNQPES
FT                   WIAELLAAKDRTLAAATAKAEGLYLVAVDYPDRFDLPKPPMGPLFLAD"
FT   gene            529954..530613
FT                   /locus_tag="SARI_00532"
FT   CDS_pept        529954..530613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsl:LSL_1322 1.6e-14 alkaline phosphatase
FT                   K01077; COG: COG0586 Uncharacterized membrane-associated
FT                   protein; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20458"
FT                   /db_xref="GOA:A9MJ58"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ58"
FT                   /inference="similar to AA sequence:INSD:AAO68203.1"
FT                   /protein_id="ABX20458.1"
FT                   /translation="MDLIYFIIDFILHIDVHLAELVAEYGVWVYAILFLILFCETGLVV
FT                   TPFLPGDSLLFVAGALASLETNDLNVHIMVALMLIAAIVGDAVNYTIGRLFGEKLFSNP
FT                   DSKIFRRSYLDKTHQFYEKHGGKTIILARFVPIIRTFAPFVAGMGHMSYRHFAAYNVIG
FT                   ALLWVLLFTYAGYFFGTIPFIQDNLKLLIVGIIVVSILPGVIEIIRHKRAASRAAK"
FT   gene            530685..531677
FT                   /locus_tag="SARI_00533"
FT   CDS_pept        530685..531677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2368 1.1e-173 accD; acetylCoA
FT                   carboxylase, beta subunit K01963; COG: COG0777 Acetyl-CoA
FT                   carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20459"
FT                   /db_xref="GOA:A9MJ59"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MJ59"
FT                   /inference="protein motif:HMMPfam:IPR000022"
FT                   /inference="protein motif:HMMTigr:IPR000438"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217355.1"
FT                   /protein_id="ABX20459.1"
FT                   /translation="MVCWGQKWHYAPLIIKLTKVQAERSPMSWIERIKSNITPTRKASI
FT                   PEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHSLLDEGSLVELGSELE
FT                   PKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
FT                   VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYIS
FT                   VLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKG
FT                   AIDMIVRRPEMRLKLASILAKLMNLPAPNPDAPREGVVVPPAPGQESEA"
FT   unsure          530976..531110
FT                   /locus_tag="SARI_00533"
FT                   /note="Sequence derived from one plasmid subclone"
FT   gene            531745..533013
FT                   /locus_tag="SARI_00534"
FT   CDS_pept        531745..533013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2596 6.2e-219 folC; folylpolyglutamate
FT                   synthase K01927:K01930; COG: COG0285 Folylpolyglutamate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20460"
FT                   /db_xref="GOA:A9MJ60"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ60"
FT                   /inference="protein motif:HMMPanther:IPR001645"
FT                   /inference="protein motif:HMMPfam:IPR004101"
FT                   /inference="protein motif:HMMPfam:IPR013221"
FT                   /inference="protein motif:HMMTigr:IPR001645"
FT                   /inference="protein motif:ScanRegExp:IPR001645"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456907.1"
FT                   /protein_id="ABX20460.1"
FT                   /translation="MKNKSIPQAASPLASWLSYLENLHSKSIDLGLERVSQVAERLGIL
FT                   KPAPFVFTVAGTNGKGTTCQTLESVLIAAGYRVGVYSSPHLVRYTERVRVQGEELAESA
FT                   HTTSFAEIEAARGDISLTYFEYGTLSALWLFKQANLDVVILEVGLGGRLDATNIVDADV
FT                   SVITSIALDHTDWLGPDRESIGREKAGIFRAEKPAVVGEPEMPATIADVAQETGALLRR
FT                   RGVDWRYEATATHWAFTDGDGTLAGLPLPQVPQPNAATALAALRASGLNIDEQAIRDGI
FT                   AQATLPGRFQIVSESPRVIFDVAHNPHAAEYLTGRLKTLPKRGRMLAVIGMLHDKDIAG
FT                   TLAWLKSVVDDWYCAPLEGPRGATAEQLLEHLGKGNVYDSVAQAWQAAIDAAQPEDTVL
FT                   VCGSFHTVAHVMEVIDAGRIGGE"
FT   gene            533003..533653
FT                   /locus_tag="SARI_00535"
FT   CDS_pept        533003..533653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_1900 4.3e-12 argininosuccinate
FT                   synthase K03749; COG: COG3147 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20461"
FT                   /db_xref="GOA:A9MJ61"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032898"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ61"
FT                   /inference="protein motif:HMMPfam:IPR007730"
FT                   /inference="similar to AA sequence:INSD:AAL21265.1"
FT                   /protein_id="ABX20461.1"
FT                   /translation="MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVP
FT                   KPGDRDEPDMMPAATQALPTQPPEGAAEEVQAGDAAAPSLDPSRMASNNIELDPIPVET
FT                   PKPKSQPKPQQSVAAVSTPAQKPLADDKPAPTGKAYVVQLGALKNADKVNEIVGKLRSA
FT                   GFRVYTSPSTPVQGKITRILVGPDASKDKMKGSLGELKQISGLSGVVMGYSPN"
FT   gene            533862..534350
FT                   /locus_tag="SARI_00536"
FT   CDS_pept        533862..534350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:CaalfMp14 0.0043 NAD4; NADH dehydrogenase
FT                   subunit 4 K03881; COG: COG1286 Uncharacterized membrane
FT                   protein, required for colicin V production; Psort location:
FT                   CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20462"
FT                   /db_xref="GOA:A9MJ62"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ62"
FT                   /inference="protein motif:HMMPfam:IPR003825"
FT                   /inference="similar to AA sequence:INSD:ABI37070.1"
FT                   /protein_id="ABX20462.1"
FT                   /translation="MVWIDYAIIAVIAFSCLVSLIRGFVREALSLVTWGCAFFVASHYY
FT                   TYLSVWFTGFEDELVRNGIAIAVLFIATLIVGAIVNFVIGQLVEKTGLSGTDRVLGICF
FT                   GALRGALIVAAILFFLDTFTGLSKSEDWSKSQLIPQFSFIIRWFFDYLQSSSSFLPRT"
FT   gene            534388..535905
FT                   /locus_tag="SARI_00537"
FT   CDS_pept        534388..535905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0502 2.5e-270 purF;
FT                   amidophosphoribosyltransferase K00764; COG: COG0034
FT                   Glutamine phosphoribosylpyrophosphate amidotransferase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20463"
FT                   /db_xref="GOA:A9MJ63"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ63"
FT                   /inference="protein motif:HMMPanther:IPR005854"
FT                   /inference="protein motif:HMMPfam:IPR000583"
FT                   /inference="protein motif:HMMPfam:IPR000836"
FT                   /inference="protein motif:HMMTigr:IPR005854"
FT                   /inference="protein motif:ScanRegExp:IPR000583"
FT                   /inference="protein motif:ScanRegExp:IPR002375"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149816.1"
FT                   /protein_id="ABX20463.1"
FT                   /translation="MCGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGIITIDANNCFRL
FT                   RKANGLVNDIFEARHMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGN
FT                   LTNAHELRKKLFEEKRRHINTTSDSEILLNIFASELDNFRHYPLEADNIFAAIAATNRQ
FT                   IRGAYACVAMIIGHGMVAFRDPHGIRPLVLGKRDVGDGRTEYMVASESVALDTLGFEFL
FT                   RDVAPGEAIYITEKGQLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGT
FT                   KLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMPGQ
FT                   QLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPE
FT                   IRFPNVYGIDMPTANELIAHGREVDEIRQIIGADGLIFQDLDDLIEAVRAENPDIQQFE
FT                   CSVFNGVYVTKDVDQQYLDFLDSLRNDDAKAVLFQNEMENLEMHNEG"
FT   gene            complement(535942..537384)
FT                   /locus_tag="SARI_00538"
FT   CDS_pept        complement(535942..537384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2502 3.4e-60 atoC; acetoacetate
FT                   metabolism regulatory protein AtoC K07714; COG: COG3829
FT                   Transcriptional regulator containing PAS, AAA-type ATPase,
FT                   and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20464"
FT                   /db_xref="GOA:A9MJ64"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ64"
FT                   /inference="protein motif:HMMPfam:IPR002078"
FT                   /inference="protein motif:HMMPfam:IPR002197"
FT                   /inference="protein motif:HMMPfam:IPR013656"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR000014"
FT                   /inference="protein motif:ScanRegExp:IPR002078"
FT                   /inference="protein motif:superfamily:IPR008931"
FT                   /inference="similar to AA sequence:INSD:AAL21262.1"
FT                   /protein_id="ABX20464.1"
FT                   /translation="MRNARMASTNQELASALRMFSRFFDLIHQPLAVINERGEYVYYNQ
FT                   ESADLDGYSIERAMGKHMLDVYPGMKEAQSTMLSSLKKGVEYIGHYQIYYNARGQAVDY
FT                   QHTTAPLYARDGGMVGVIEIGRNMSGVRRLQEQVVELNQLLYADHHEKHHAIITENPEM
FT                   LSNIAKAKRLAASNIPVTIVGETGTGKELFSRLIHQCSKRANKPFIALNCGALPPTLIE
FT                   STLFGTVRGAYTGAENSQGYLELANGGTLFLDELNAMPIEMQSKLLRFLQDKTFWRLGG
FT                   QQQLHSDVRIVAAMNEAPVKLIQQERLRTDLFYRLSVGMLTLPPLRARPEDIPLLANYF
FT                   IDKYRNDVPQDIHGLSETARADLLNHAWPGNVRMLENAIVRSMIMQEKDGLLKHIIFEQ
FT                   DELNLGVPETAPENPLPSSPDPQYEGSLEARVANYERHLIETALDTHQGNIAAAARSLN
FT                   VSRTTLQYKVQKYGIRFGVVRN"
FT   gene            537580..538977
FT                   /locus_tag="SARI_00539"
FT   CDS_pept        537580..538977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0504 7.3e-255 putative amino acid
FT                   decarboxylase K01586; COG: COG0019 Diaminopimelate
FT                   decarboxylase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20465"
FT                   /db_xref="GOA:A9MJ65"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ65"
FT                   /inference="protein motif:HMMPfam:IPR000183"
FT                   /inference="protein motif:superfamily:IPR009006"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456902.1"
FT                   /protein_id="ABX20465.1"
FT                   /translation="MTDSIMQNYNQLREQVINGDRRFQHKDGHLCFEGVDLDALARQYP
FT                   TPFYVFSEPEIIRNIHEIQQAFAAHKNTKTFFASKTCSVMGVLKAIRDAGICAEANSQY
FT                   EVRKCLEIGFRGDQIVFNGVVKKPADLEYAIANDLYLINVDSLYELEHIDAISRKLKKV
FT                   ANVCVRVEPNVPSATHAELVTAFHAKSGLDLEQAEETCRRILAMPYVHLRGLHMHVGDQ
FT                   VPESEPFAKATKVLVDESRRLEEVLGIKFDLINVGGGIPVPYKYDDENGDPLKDNMYAG
FT                   ITAQDFADAVIREVHKWRTDVEICIEPGRKVTGSAAVLLTEVSCEKRKTNYDLNGNVEC
FT                   HVEWKFVDAGYSVLSDSQHFDWFFYVYNASRITAAHDAWIKLAGPLCDGGDYFHMGVKG
FT                   EEFLLPKETHVGDIVAFLDAGAYTIESQTVYNNRPRTGVVMIDKNGETRLIRREDSYED
FT                   MVKYDIY"
FT   gene            539062..540489
FT                   /locus_tag="SARI_00540"
FT   CDS_pept        539062..540489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00540"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0120 1.3e-05 aroP; aromatic amino
FT                   acid transport protein AroP K03293; COG: COG0531 Amino acid
FT                   transporters; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20466"
FT                   /db_xref="GOA:A9MJ66"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ66"
FT                   /inference="protein motif:HMMPanther:IPR002293"
FT                   /inference="protein motif:HMMPfam:IPR004841"
FT                   /inference="similar to AA sequence:INSD:AAL21260.1"
FT                   /protein_id="ABX20466.1"
FT                   /translation="MAMSNTNSGLLGIKDIVFMNVIAILSLRQIPNVAPYGASAMLLWV
FT                   IAAFCLFFPLAMVCGELSTGWPKDGGIFVWIKEAFGKRIAWIVVVCFLFSCVLFFPLML
FT                   QFGFTALGYMIGGGLAENKAFIGIGSAVIFWLLTLMNIRGMEWTKIINSISAWCGVFIP
FT                   SAILILLAVVWLCTGHQMQTDYATAKNWIPDLGHWDTIVFLSSMMFAFAGLEVAPMIAG
FT                   RTRNPQRDFPRAMAVSAAVIVGIYMVGTWAINTLLPAGKTDIVAGVMQAMHAAADTLHM
FT                   PWLIPVMAICMFFGALGQINSWLVGPIYMLQEASREDNLLGDRIGKLHPVWKTPAFALT
FT                   VQAIIVTVLCFSTFISPSVAAAYWMLTALTTITYFIPYLVMFPAFWRLRKTQPDTPRSF
FT                   KIPGKVLPAILPALGFLSIAFAVALLFIPPSQIDMGGYFQYAGKIIGGAVLAVVVAEFI
FT                   YHRAQKRNARLGMAGGK"
FT   gene            540491..541594
FT                   /locus_tag="SARI_00541"
FT   CDS_pept        540491..541594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bce:BC2063 4.0e-05 alanine racemase K01775;
FT                   COG: COG3457 Predicted amino acid racemase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20467"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ67"
FT                   /inference="protein motif:HMMPfam:IPR001608"
FT                   /inference="similar to AA sequence:INSD:AAV76508.1"
FT                   /protein_id="ABX20467.1"
FT                   /translation="MYMPVLEINLRKLEENARTEKALLASSGIEVMAVNKVFDGCVETA
FT                   QAVFNGGITVIAESRTYNLKKIRETGCTTCLLRSPCLSEIEDVVRYADISLNSEPVVLR
FT                   ALSHEAQRQGKTHQVLLMVDMGDLREGIWFSEYQRILETITLIADLPALELYGLGTNFN
FT                   CYGTVLPTVKNGEDFLALAARLEADSGIPVRRLSAGNCTSYHLLDKGIWPHGLNHLRIG
FT                   GLHEFGIEYVDMKYLNEFHHSAKPVDKACSDMYILEAEIIELNSKPTVPVGELGVDAFL
FT                   QSKTFVDRGIRRRALLAFGRQDVPSDNCVPCDDAITILGQTSDHTLVDIEDCRQPLKVG
FT                   DVVRFELDYTGLLMACQTKGIAWRFTR"
FT   gene            541633..542961
FT                   /locus_tag="SARI_00542"
FT   CDS_pept        541633..542961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0120 2.6e-53 aroP; aromatic amino
FT                   acid transport protein AroP K03293; COG: COG0833 Amino acid
FT                   transporters; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20468"
FT                   /db_xref="GOA:A9MJ68"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ68"
FT                   /inference="protein motif:HMMPanther:IPR002293"
FT                   /inference="protein motif:HMMPfam:IPR004841"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149821.1"
FT                   /protein_id="ABX20468.1"
FT                   /translation="MMSLGGTIGTGLFIGIAEPLSSVGPARALLAYLFAGAIMLATMMC
FT                   LGELSCAFPHSGSFQHYALMFMPSPVWSYTIGWLYWFSWGFSLAADLTAAGFIAHQFFP
FT                   AVPVYIFCLAILLILTVINFTSAKSFGECEYWLSAIKVFAIVLFICAGGVMIYSLMGHS
FT                   DWHPTLKTNGMWFPHGWEQIVVCMTIVIYSFQGGELVGNAAGETESPHAILPKVILGIG
FT                   LRIILFYGLAIAVLALVYPHKLAPNGQSPFVWVFSHAGIPGADTLMTLVIFSAAVSAAN
FT                   SAIYASSRMLWSMAGDRFAPACFGKTNGGGVPVYAILITVLLALVSLLTRYIPAQQFYL
FT                   YLIASTGQVGCLAWITIGWCQYRFRQSVCNGTYASDLLRYRSPLFPWTARFVIITNFAI
FT                   MVGTWFSEQGGVIMLVELAFMTGILLSWYLFRPTLSRLRNTVG"
FT   gene            542988..543557
FT                   /locus_tag="SARI_00543"
FT   CDS_pept        542988..543557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0508 4.6e-95 ubiX; putative decarboxylase
FT                   K03186; COG: COG0163 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20469"
FT                   /db_xref="GOA:A9MJ69"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ69"
FT                   /inference="protein motif:Gene3D:IPR003382"
FT                   /inference="protein motif:HMMPfam:IPR003382"
FT                   /inference="protein motif:HMMTigr:IPR004507"
FT                   /inference="protein motif:superfamily:IPR003382"
FT                   /inference="similar to AA sequence:INSD:AAX66264.1"
FT                   /protein_id="ABX20469.1"
FT                   /translation="MKRLIVGISGASGAIYGVRLLQILRDVESVETHLVMSQAARQTLA
FT                   LETHFSLREVQALADVTHDARDIAASISSGSYPTAGMVILPCSIKTLSGIVHSYTDGLL
FT                   TRAADVILKERRPLVLCVRETPLHIGHLRLMTQAAEIGAVIMPPVPAFYHLPKTLDDVI
FT                   NQTVNRVLDQFDIPLPHDLFVRWQGA"
FT   gene            543844..544626
FT                   /locus_tag="SARI_00544"
FT   CDS_pept        543844..544626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4695 3.4e-28 ABC polar amino
FT                   acid transporter, periplasmic ligand binding protein
FT                   K01713; COG: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain; Psort
FT                   location: Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20470"
FT                   /db_xref="GOA:A9MJ70"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ70"
FT                   /inference="protein motif:HMMPfam:IPR001638"
FT                   /inference="protein motif:HMMSmart:IPR001638"
FT                   /inference="protein motif:HMMTigr:IPR005768"
FT                   /inference="protein motif:ScanRegExp:IPR001638"
FT                   /inference="similar to AA sequence:INSD:AAV76511.1"
FT                   /protein_id="ABX20470.1"
FT                   /translation="MKKTVLALSLLIGLGATAASYAALPQTVRIGTDTTYAPFSSKDAK
FT                   GDFVGFDIDVGNEMCQRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIA
FT                   FSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVNVVAYA
FT                   NQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLR
FT                   KDDTELKAAFDKALAELREDGTYDKMAKKYFDFNVYGD"
FT   gene            544864..545646
FT                   /locus_tag="SARI_00545"
FT   CDS_pept        544864..545646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4695 6.8e-30 ABC polar amino
FT                   acid transporter, periplasmic ligand binding protein
FT                   K01713; COG: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain; Psort
FT                   location: Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20471"
FT                   /db_xref="GOA:A9MJ71"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ71"
FT                   /inference="protein motif:HMMPfam:IPR001638"
FT                   /inference="protein motif:HMMSmart:IPR001638"
FT                   /inference="protein motif:HMMTigr:IPR005768"
FT                   /inference="protein motif:ScanRegExp:IPR001638"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX20471.1"
FT                   /translation="MKKLALSLSLVLAFSSATAAFAAIPQKIRIGTDPTYAPFESKNAQ
FT                   GELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIA
FT                   FTDKLYAADSRLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQ
FT                   GQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKTYKFGGPSVKDEKLFGVGTGMGLR
FT                   KEDNELRETLNKAFAEMRADGTYEKLAKKYFDFDVYGG"
FT   gene            545829..546515
FT                   /locus_tag="SARI_00546"
FT   CDS_pept        545829..546515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00546"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV6546 1.6e-23 putative ABC transporter
FT                   permease K02028; COG: COG4215 ABC-type arginine transport
FT                   system, permease component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20472"
FT                   /db_xref="GOA:A9MJ72"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030199"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ72"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR010065"
FT                   /inference="similar to AA sequence:INSD:AAL21254.1"
FT                   /protein_id="ABX20472.1"
FT                   /translation="MLYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRVT
FT                   GLIFEGYTTLIRGVPDLVLMLLIFYGLQIALNVVTDSLGIEQIDIDPMVAGIITLGFIY
FT                   GAYFTETFRGAFMAVPKGHIEAATAFGFTRWQTFRRIMFPAMMRYALPGIGNNWQVILK
FT                   ATALVSLLGLEDVVKATQLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVG
FT                   VKRADL"
FT   gene            546512..547219
FT                   /locus_tag="SARI_00547"
FT   CDS_pept        546512..547219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00547"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV6546 6.5e-25 putative ABC transporter
FT                   permease K02028; COG: COG4160 ABC-type arginine/histidine
FT                   transport system, permease component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20473"
FT                   /db_xref="GOA:A9MJ73"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ73"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR010065"
FT                   /inference="similar to AA sequence:INSD:AAO68218.1"
FT                   /protein_id="ABX20473.1"
FT                   /translation="MIEIIQEYWKSLLWTDGYRFTGVAITLWLLISSVVMGGLLAVILA
FT                   VGRVSSNKFIRFPIWLFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTDFLNAFFRSGLNC
FT                   TVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFKMYRCIILPSALRIALPAY
FT                   SNEVILMLHSTALAFTATVPDLLKIARDINSATYQPFTAFGIAAVLYLLISYVLISLFR
FT                   RAERRWLQHVSSK"
FT   gene            547230..548006
FT                   /locus_tag="SARI_00548"
FT   CDS_pept        547230..548006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00548"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2351 1.0e-131 hisP; ABC superfamily
FT                   (atp_bind), histidine and lysine/arginine/ornithine
FT                   transport protein K02028; COG: COG4598 ABC-type histidine
FT                   transport system, ATPase component; Psort location:
FT                   CytoplasmicMembrane, score:7.88"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20474"
FT                   /db_xref="GOA:A9MJ74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ74"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="similar to AA sequence:INSD:AAL21252.1"
FT                   /protein_id="ABX20474.1"
FT                   /translation="MMSENKLNVIDLHKRYGGHEVLKGVSLQASAGDVISIIGSSGSGK
FT                   STFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNL
FT                   WSHMTVLENVMEAPVQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVS
FT                   IARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSH
FT                   VIFLHQGKIEEEGEPEQVFGNPQSPRLQQFLKGSLK"
FT   gene            complement(548047..548940)
FT                   /locus_tag="SARI_00549"
FT   CDS_pept        complement(548047..548940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_0206 9.2e-58 hypothetical protein;
FT                   COG: COG1090 Predicted nucleoside-diphosphate sugar
FT                   epimerase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20475"
FT                   /db_xref="GOA:A9MJ75"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ75"
FT                   /inference="protein motif:HMMPanther:IPR010099"
FT                   /inference="protein motif:HMMPfam:IPR001509"
FT                   /inference="protein motif:HMMPfam:IPR013549"
FT                   /inference="protein motif:HMMTigr:IPR010099"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461292.1"
FT                   /protein_id="ABX20475.1"
FT                   /translation="MQILITGGTGLIGRHLIPRLLTLGHQVTVVTRNPYNARQIFDSRV
FT                   ALWKGLAEREHLNEIDAIVNLAGEPIADKRWTPQQKERLCQSRWAITQKLVDLIHASAT
FT                   PPAVLISGSATGYYGDLGDVVVTEDEPPHNEFTHKLCALWEQIACRAQSDQTRVCLLRT
FT                   GVVLAPQGGILGKMVPPFRLGLGGPVGNGRQYLPWIHIDDMVNGILWLLDNDLRGPFNM
FT                   VSPYPVHNEQFAHALGRALRRPAIIRIPATAIRLLMGESSVLVLGGQRALPKRLEAAGF
FT                   AFRWYDLEEALADVIR"
FT   gene            complement(549070..549717)
FT                   /locus_tag="SARI_00550"
FT   CDS_pept        complement(549070..549717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00550"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2586 4.3e-92 yfcG; putative
FT                   S-transferase K00799; COG: COG0625 Glutathione
FT                   S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20476"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ76"
FT                   /inference="protein motif:HMMPfam:IPR004045"
FT                   /inference="protein motif:HMMPfam:IPR004046"
FT                   /inference="protein motif:superfamily:IPR010987"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461291.1"
FT                   /protein_id="ABX20476.1"
FT                   /translation="MIDLYYAPTPNGHKITLFLEEAELAYRLLKVDISRGNQFRPDFLA
FT                   ISPNNKIPAIVDHAPADGGQPLSLFESGEILLYLAEKSGKLLSGELRERHITLQWLFWQ
FT                   VGGLGPMLGQNHHFNHFAPQTIPYAIERYQVETQRLYNVLNKRLEASPWLGGDHYSIAD
FT                   IASWPWVNAHQRQRIDLDTYPAVYNWFERIRTRPATARAMLKAQLHCNSTEE"
FT   gene            549860..550504
FT                   /locus_tag="SARI_00551"
FT   CDS_pept        549860..550504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2585 6.3e-91 yfcF; hypothetical
FT                   protein K00799; COG: COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20477"
FT                   /db_xref="GOA:A9MJ77"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034338"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ77"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR004045"
FT                   /inference="protein motif:superfamily:IPR010987"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461290.1"
FT                   /protein_id="ABX20477.1"
FT                   /translation="MSKPVIVLWSDASFFSPYVLSAWVALQEKGLSFMLKTRDLGKGEH
FT                   LQPSWRGYALTQRVPVLETDDFELSESSAIAEYLEERFAPPQWERIYPHDLQKRARARQ
FT                   IQAWLRSDLLPLREERPTDVVFSGAKKAPLSEAGKASAAKLFATAEALLGQGTQNLFGE
FT                   WCIADTDLALMINRLALHGDDVPASLAEYATFQWQRASVQRFIALSAKRSG"
FT   gene            550560..551111
FT                   /locus_tag="SARI_00552"
FT   CDS_pept        550560..551111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2584 9.4e-81 yfcE; hypothetical
FT                   protein; COG: COG0622 Predicted phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20478"
FT                   /db_xref="GOA:A9MJ78"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ78"
FT                   /inference="protein motif:HMMPfam:IPR004843"
FT                   /inference="protein motif:HMMPIR:IPR000979"
FT                   /inference="protein motif:HMMTigr:IPR000979"
FT                   /inference="protein motif:ScanRegExp:IPR000979"
FT                   /inference="similar to AA sequence:INSD:AAV76519.1"
FT                   /protein_id="ABX20478.1"
FT                   /translation="MKLMFASDIHGSLPATERVLERFAQSGARWLVILGDVLNHGPRNA
FT                   LPEGYAPIQVAERLNAVATQIIAVRGNCDSEVDQMLLHFPITAPWQQILTQERRLFLTH
FT                   GHLFGPTNLPALNAGDVVVYGHTHLPVAQQQEGLYHFNPGSVSIPKGGYTASYGILDDN
FT                   VLSVIALNDQSIIAQVAINS"
FT   gene            551169..551723
FT                   /locus_tag="SARI_00553"
FT   CDS_pept        551169..551723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssn:SSO_2356 4.7e-86 putative regulator; COG:
FT                   COG0494 NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00553"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20479"
FT                   /db_xref="GOA:A9MJ79"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR024195"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ79"
FT                   /inference="protein motif:BlastProDom:IPR002667"
FT                   /inference="protein motif:Gene3D:IPR000086"
FT                   /inference="protein motif:HMMPfam:IPR000086"
FT                   /inference="protein motif:superfamily:IPR000086"
FT                   /inference="similar to AA sequence:INSD:AAL21247.1"
FT                   /protein_id="ABX20479.1"
FT                   /translation="MVEQRRLAGTEWVDIVNEDNEVIAQSSREQMRAQRLRHRATYIVV
FT                   HDGMGKILVQRRTETKDFLPGMLDATAGGVVQADEQLLESARREAEEELGIAGVPFAEH
FT                   GLFYFEDQYCRVWGALFSCVSHGPFALQEDEVSEVCWLTPEEITARCDEFTPDSLKALA
FT                   LWMTRNAKNEAALQEKPEETE"
FT   gene            complement(551729..552748)
FT                   /locus_tag="SARI_00554"
FT   CDS_pept        complement(551729..552748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EF1922 1.4e-06 transcriptional regulator,
FT                   LacI family/carbohydrate kinase, PfkB family protein
FT                   K00852; COG: COG1609 Transcriptional regulators; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20480"
FT                   /db_xref="GOA:A9MJ80"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ80"
FT                   /inference="protein motif:HMMPfam:IPR000843"
FT                   /inference="protein motif:HMMPfam:IPR001761"
FT                   /inference="protein motif:HMMSmart:IPR000843"
FT                   /inference="protein motif:ScanRegExp:IPR000843"
FT                   /inference="protein motif:superfamily:IPR010982"
FT                   /inference="similar to AA sequence:INSD:AAL21246.1"
FT                   /protein_id="ABX20480.1"
FT                   /translation="MSIPRKRRSTGKVTIADVAQLAGVGTMTVSRALRTPDQVSAKLRE
FT                   KIEAAVHELGYMPNLAASALASASSHTIAMVVPNLAEAGCSEMFAGLQQILQPAGYQIM
FT                   LAESQHRVEQEEKLLETLLASNIAAAILLSVEHSDTVRQWLKNASIPVMEMGAIRSDPI
FT                   DMNIGIDNVAAMYELTEMLIQRGYQNIGLLCANQEQWIFQQHLHGWYKAMLRYHMSPSR
FT                   VINAALPPNFSTGASQLPEFLLAWPELDALVCVSDELACGVLYECQRRRIKVPDDLAVV
FT                   GFGDSDVSRVCQPPLTTMTVPHRKIGSEAGRALLERLNQGNWSDRKSIASSLCMRESC"
FT   gene            complement(552829..553002)
FT                   /locus_tag="SARI_00556"
FT   CDS_pept        complement(552829..553002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20482"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ81"
FT                   /protein_id="ABX20482.1"
FT                   /translation="MLFAPTVYQIMNKLYSSHSILAAIVITKIALPETITQNCDSAIKL
FT                   KSSCEITAKKRI"
FT   gene            553001..553444
FT                   /locus_tag="SARI_00555"
FT   CDS_pept        553001..553444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0520 1.9e-73 putative sugar
FT                   phosphotransferase component II A K02821; COG: COG1762
FT                   Phosphotransferase system mannitol/fructose-specific IIA
FT                   domain (Ntr-type); Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20481"
FT                   /db_xref="GOA:A9MJ82"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ82"
FT                   /inference="protein motif:BlastProDom:IPR002178"
FT                   /inference="protein motif:Gene3D:IPR002178"
FT                   /inference="protein motif:HMMPfam:IPR002178"
FT                   /inference="similar to AA sequence:INSD:AAV76522.1"
FT                   /protein_id="ABX20481.1"
FT                   /translation="MLGTWLSDATITLQESVETWQQALEICGKPLLDAGVITPEYITAI
FT                   VQQHQKLGPYYVLAPGLAMPHARPEEGAKGLGLSLLKLQRGVSFGADEFDPVDIIIMLA
FT                   APDKHSHIEMISALAELFSSDVDMEKLHQAKNLEDIKKIIDRF"
FT   gene            553526..553798
FT                   /locus_tag="SARI_00557"
FT   CDS_pept        553526..553798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0521 1.9e-41 putative sugar
FT                   phosphotransferase component II B K02822; COG: COG3414
FT                   Phosphotransferase system, galactitol-specific IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20483"
FT                   /db_xref="GOA:A9MJ83"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ83"
FT                   /inference="protein motif:HMMPfam:IPR003501"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX20483.1"
FT                   /translation="MKIMAICGSGLGSSFMVEMNIKKILKKLNIDAEVEHSDLSSATPG
FT                   AADLFVMAKDIAASASVPESQLVVINNIIDINELETQLRAWFAKQ"
FT   gene            553819..555210
FT                   /locus_tag="SARI_00558"
FT   CDS_pept        553819..555210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mcp:MCAP_0590 5.6e-90 PTS system, IIBC
FT                   component, putative K02822:K03475; COG: COG3037
FT                   Uncharacterized protein conserved in bacteria; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00558"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20484"
FT                   /db_xref="GOA:A9MJ84"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ84"
FT                   /inference="protein motif:HMMPfam:IPR007333"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461284.1"
FT                   /protein_id="ABX20484.1"
FT                   /translation="MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIK
FT                   TILGFIVLGGGATVLVGSLNPLGGMFEHAFNIQGIIPNNEAIVSIALEKYGASTALIMA
FT                   FGMVANIVVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVGLVFTGSLILGLVMA
FT                   FFPALAQRYMRQITGTDDIAFGHFGTLGYVLSGWIGSLCGKGSRSTEEMNLPKNLSFLR
FT                   DSSISISLTMMIIYLIMAVSAGRDYVEATFSGGQNYLVYAIIMAITFAAGVFIILQGVR
FT                   LILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVLIGFLFSFLGGLVGLFLLGQM
FT                   KLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGF
FT                   ANTTFSDADFGAIGILLGNLARYLSPMAITGLVVALFALLVAYNVLAKNKKANAEVQEN
FT                   SGAKE"
FT   gene            555207..556037
FT                   /locus_tag="SARI_00559"
FT   CDS_pept        555207..556037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00559"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2341 3.0e-146 putative transketolase
FT                   K00615; COG: COG3959 Transketolase, N-terminal subunit;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20485"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ85"
FT                   /inference="protein motif:HMMPfam:IPR005474"
FT                   /inference="protein motif:HMMPIR:IPR012058"
FT                   /inference="similar to AA sequence:INSD:AAL21242.1"
FT                   /protein_id="ABX20485.1"
FT                   /translation="MNVTEITQLAREIRVATLKSLTHLGFGHYGGSMSVVETLAVLYGA
FT                   VMKIDPADPDWPERDYFVLSKGHAGPALYSTLAIKGYFPREELNTLNQNGTRLPSHPDR
FT                   LKTRGVDATTGSLGQGISIAGGMALSHKLARRPNRVFCIVGDGELNEGQCWEAFQFIAH
FT                   HRLNNLTVFIDWNKQQLDGELEEIINPFDLEGKFRAFGFDVVTVKGDDIAGLLAVVQPV
FT                   PPADAQPRVVILDSIKGQGVPCLEQLTNSHHLRLTDDMKQTLNEAIHQLEVTHD"
FT   gene            556030..556983
FT                   /locus_tag="SARI_00560"
FT   CDS_pept        556030..556983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2340 2.7e-161 putative transketolase
FT                   K00615; COG: COG3958 Transketolase, C-terminal subunit;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20486"
FT                   /db_xref="GOA:A9MJ86"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ86"
FT                   /inference="protein motif:Gene3D:IPR009014"
FT                   /inference="protein motif:HMMPfam:IPR005475"
FT                   /inference="protein motif:HMMPfam:IPR005476"
FT                   /inference="protein motif:HMMPIR:IPR012068"
FT                   /inference="protein motif:superfamily:IPR009014"
FT                   /inference="similar to AA sequence:INSD:AAL21241.1"
FT                   /protein_id="ABX20486.1"
FT                   /translation="MIKLAPAGLKDNIEMRKVYAGFVARQIEAGSPIIALEADLMSSMA
FT                   MDSVARDYPQHVINCGIMEANVIGTAAGLALTGRKPFVHTFTAFASRRCFDQLFMALDY
FT                   QRNNVKVIASDAGVTACHNGGTHMSFEDMGIVRGLAHSVVLEVTDTVMFADILRQLMDL
FT                   DGFYWLRTIRKQAPSIYAPGSTFTIGKGNVLREGDDITLIANGIMVAEALEAARQLEQE
FT                   GVSAAVIDMFTLKPIDRMLVKNYAEKTRRIVTCENHSIHNGLGSAVAEVLVENCPVPMR
FT                   RVGVKERYGQVGTQDFLQKEYGLTAAAIVEAAKSML"
FT   gene            complement(557032..558552)
FT                   /locus_tag="SARI_00561"
FT   CDS_pept        complement(557032..558552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00561"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1288 Predicted membrane protein; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20487"
FT                   /db_xref="GOA:A9MJ87"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ87"
FT                   /inference="protein motif:HMMPfam:IPR004669"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804382.1"
FT                   /protein_id="ABX20487.1"
FT                   /translation="MSVVTESKPARKWAMPDTLVIIFFVAILTSIATWVVPVGMFDSQE
FT                   VQYQVDGQTKTRKVVDPHSFRIVTNEAGEAQYHRVQFFTTGDERPGLMNFPFEGLTSGS
FT                   KFGTAVGIIMFMLVIGGAFGIVMRTGTVDNGILALIRHTRGNEVLFIPVLFVLFSLGGA
FT                   VFGMGEEAVAFAIIIAPLMVRLGYDSITTVLVTYIATQIGFASSWMNPFCVVVAQGIAG
FT                   VPVLSGSGLRIVVWIVATLIGLVFTLVYASRVKKNPQLSRVHESDRYFREQQDEVVQRP
FT                   FTFGDWLVLLVLTGVMIWVVWGVIVHAWFIPEIASQFFTMGVVIGLIGVIFRLNGMTVN
FT                   VMASSFTEGARMMIAPALLVGFAKGILLLVGNGEAGEPSVLNTLLNSIAHGISGLNNAI
FT                   AAWFMLLFQAVFNFFVTSGSGQAALTMPLLAPLGDLVGVNRQVTVLAFQFGDGFSHIIY
FT                   PTSASLMATLGVCRVDFRNWLKVGASLLGLLFIMSSVVVIGAQMMGYH"
FT   gene            complement(558776..560905)
FT                   /locus_tag="SARI_00562"
FT   CDS_pept        complement(558776..560905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0526 0. pta; phosphate
FT                   acetyltransferase K00625; COG: COG0857 BioD-like N-terminal
FT                   domain of phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20488"
FT                   /db_xref="GOA:A9MJ88"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ88"
FT                   /inference="protein motif:HMMPfam:IPR002505"
FT                   /inference="protein motif:HMMPfam:IPR010766"
FT                   /inference="protein motif:HMMTigr:IPR004614"
FT                   /protein_id="ABX20488.1"
FT                   /translation="MLIPTGTSVGLTSVSLGVIRAMERKGVRLSVFKPIAQPRAGGDAP
FT                   DQTTTIVRANSTLPAAEPLKMSHVESLLSSNQKDVLMEEIIANYHANTKDAEVVLVEGL
FT                   VPTRKHQFAQSLNYEIAKTLNAEIVFVMSQGTDTPEQLNERIELTRSSFGGAKNTNITG
FT                   VIVNKLNAPVDEQGRTRPDLSEIFDDSSKAQVIKIDPAKLQESSPLPVLGAVPWSFDLI
FT                   ATRAIDMARHLNATIINEGDIKTRRVKSVTFCARSIPHMLEHFRAGSLLVTSADRPDVL
FT                   VAACLAAMNGVEIGALLLTGGYEMDARISKLCERAFATGLPVFMVNTNTWQTSLSLQSF
FT                   NLEVPVDDHERIEKVQEYVANYINADWVESLTATSERSRRLSPPAFRYQLTELARKAGK
FT                   RVVLPEGDEPRTVKAAAICAERGIATCVLLGNPDEINRVAASQGVELGAGIEIVDPEVV
FT                   RESYVARLVELRKSKGMTEPVAREQLEDNVVLGTLMLEQDEVDGLVSGAVHTTANTIRP
FT