(data stored in SCRATCH9089 zone)

EMBL: CP000884

ID   CP000884; SV 1; circular; genomic DNA; STD; PRO; 6767514 BP.
XX
AC   CP000884; AAVD01000000-AAVD01000025;
XX
PR   Project:PRJNA17413;
XX
DT   17-NOV-2007 (Rel. 93, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Delftia acidovorans SPH-1, complete genome.
XX
KW   .
XX
OS   Delftia acidovorans SPH-1
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Delftia.
XX
RN   [1]
RP   1-6767514
RX   DOI; 10.1128/AEM.70.7.4053-4063.2004.
RX   PUBMED; 15240283.
RA   Schleheck D., Knepper T.P., Fischer K., Cook A.M.;
RT   "Mineralization of individual congeners of linear alkylbenzenesulfonate by
RT   defined pairs of heterotrophic bacteria";
RL   Appl. Environ. Microbiol. 70(7):4053-4063(2004).
XX
RN   [2]
RP   1-6767514
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Lowry S., Clum A., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Schleheck D., Richardson P.;
RT   ;
RL   Submitted (05-NOV-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 9a7c62ed15106f4b533cc037a5a224ab.
DR   BioSample; SAMN00623041.
DR   EnsemblGenomes-Gn; Daci_R0001.
DR   EnsemblGenomes-Gn; Daci_R0002.
DR   EnsemblGenomes-Gn; Daci_R0003.
DR   EnsemblGenomes-Gn; Daci_R0004.
DR   EnsemblGenomes-Gn; Daci_R0005.
DR   EnsemblGenomes-Gn; Daci_R0006.
DR   EnsemblGenomes-Gn; Daci_R0007.
DR   EnsemblGenomes-Gn; Daci_R0008.
DR   EnsemblGenomes-Gn; Daci_R0009.
DR   EnsemblGenomes-Gn; Daci_R0010.
DR   EnsemblGenomes-Gn; Daci_R0011.
DR   EnsemblGenomes-Gn; Daci_R0012.
DR   EnsemblGenomes-Gn; Daci_R0013.
DR   EnsemblGenomes-Gn; Daci_R0014.
DR   EnsemblGenomes-Gn; Daci_R0015.
DR   EnsemblGenomes-Gn; Daci_R0016.
DR   EnsemblGenomes-Gn; Daci_R0017.
DR   EnsemblGenomes-Gn; Daci_R0018.
DR   EnsemblGenomes-Gn; Daci_R0019.
DR   EnsemblGenomes-Gn; Daci_R0020.
DR   EnsemblGenomes-Gn; Daci_R0021.
DR   EnsemblGenomes-Gn; Daci_R0022.
DR   EnsemblGenomes-Gn; Daci_R0023.
DR   EnsemblGenomes-Gn; Daci_R0024.
DR   EnsemblGenomes-Gn; Daci_R0025.
DR   EnsemblGenomes-Gn; Daci_R0026.
DR   EnsemblGenomes-Gn; Daci_R0027.
DR   EnsemblGenomes-Gn; Daci_R0028.
DR   EnsemblGenomes-Gn; Daci_R0029.
DR   EnsemblGenomes-Gn; Daci_R0030.
DR   EnsemblGenomes-Gn; Daci_R0031.
DR   EnsemblGenomes-Gn; Daci_R0032.
DR   EnsemblGenomes-Gn; Daci_R0033.
DR   EnsemblGenomes-Gn; Daci_R0034.
DR   EnsemblGenomes-Gn; Daci_R0035.
DR   EnsemblGenomes-Gn; Daci_R0036.
DR   EnsemblGenomes-Gn; Daci_R0037.
DR   EnsemblGenomes-Gn; Daci_R0038.
DR   EnsemblGenomes-Gn; Daci_R0039.
DR   EnsemblGenomes-Gn; Daci_R0040.
DR   EnsemblGenomes-Gn; Daci_R0041.
DR   EnsemblGenomes-Gn; Daci_R0042.
DR   EnsemblGenomes-Gn; Daci_R0043.
DR   EnsemblGenomes-Gn; Daci_R0044.
DR   EnsemblGenomes-Gn; Daci_R0045.
DR   EnsemblGenomes-Gn; Daci_R0046.
DR   EnsemblGenomes-Gn; Daci_R0047.
DR   EnsemblGenomes-Gn; Daci_R0048.
DR   EnsemblGenomes-Gn; Daci_R0049.
DR   EnsemblGenomes-Gn; Daci_R0050.
DR   EnsemblGenomes-Gn; Daci_R0051.
DR   EnsemblGenomes-Gn; Daci_R0052.
DR   EnsemblGenomes-Gn; Daci_R0053.
DR   EnsemblGenomes-Gn; Daci_R0054.
DR   EnsemblGenomes-Gn; Daci_R0055.
DR   EnsemblGenomes-Gn; Daci_R0056.
DR   EnsemblGenomes-Gn; Daci_R0057.
DR   EnsemblGenomes-Gn; Daci_R0058.
DR   EnsemblGenomes-Gn; Daci_R0059.
DR   EnsemblGenomes-Gn; Daci_R0060.
DR   EnsemblGenomes-Gn; Daci_R0061.
DR   EnsemblGenomes-Gn; Daci_R0062.
DR   EnsemblGenomes-Gn; Daci_R0063.
DR   EnsemblGenomes-Gn; Daci_R0064.
DR   EnsemblGenomes-Gn; Daci_R0065.
DR   EnsemblGenomes-Gn; Daci_R0066.
DR   EnsemblGenomes-Gn; Daci_R0067.
DR   EnsemblGenomes-Gn; Daci_R0068.
DR   EnsemblGenomes-Gn; Daci_R0069.
DR   EnsemblGenomes-Gn; Daci_R0070.
DR   EnsemblGenomes-Gn; Daci_R0071.
DR   EnsemblGenomes-Gn; Daci_R0072.
DR   EnsemblGenomes-Gn; Daci_R0073.
DR   EnsemblGenomes-Gn; Daci_R0074.
DR   EnsemblGenomes-Gn; Daci_R0075.
DR   EnsemblGenomes-Gn; Daci_R0076.
DR   EnsemblGenomes-Gn; Daci_R0077.
DR   EnsemblGenomes-Gn; Daci_R0078.
DR   EnsemblGenomes-Gn; Daci_R0079.
DR   EnsemblGenomes-Gn; Daci_R0080.
DR   EnsemblGenomes-Gn; Daci_R0081.
DR   EnsemblGenomes-Gn; Daci_R0082.
DR   EnsemblGenomes-Gn; Daci_R0083.
DR   EnsemblGenomes-Gn; Daci_R0084.
DR   EnsemblGenomes-Gn; Daci_R0085.
DR   EnsemblGenomes-Gn; Daci_R0086.
DR   EnsemblGenomes-Gn; Daci_R0087.
DR   EnsemblGenomes-Gn; Daci_R0088.
DR   EnsemblGenomes-Gn; Daci_R0089.
DR   EnsemblGenomes-Gn; Daci_R0090.
DR   EnsemblGenomes-Gn; Daci_R0091.
DR   EnsemblGenomes-Gn; Daci_R0092.
DR   EnsemblGenomes-Gn; Daci_R0093.
DR   EnsemblGenomes-Gn; Daci_R0094.
DR   EnsemblGenomes-Gn; Daci_R0095.
DR   EnsemblGenomes-Gn; Daci_R0096.
DR   EnsemblGenomes-Gn; Daci_R0097.
DR   EnsemblGenomes-Gn; Daci_R0098.
DR   EnsemblGenomes-Gn; EBG00001276270.
DR   EnsemblGenomes-Gn; EBG00001276273.
DR   EnsemblGenomes-Gn; EBG00001276276.
DR   EnsemblGenomes-Gn; EBG00001276278.
DR   EnsemblGenomes-Gn; EBG00001276283.
DR   EnsemblGenomes-Gn; EBG00001276286.
DR   EnsemblGenomes-Gn; EBG00001276287.
DR   EnsemblGenomes-Gn; EBG00001276289.
DR   EnsemblGenomes-Gn; EBG00001276292.
DR   EnsemblGenomes-Gn; EBG00001276294.
DR   EnsemblGenomes-Gn; EBG00001276296.
DR   EnsemblGenomes-Gn; EBG00001276300.
DR   EnsemblGenomes-Gn; EBG00001276302.
DR   EnsemblGenomes-Gn; EBG00001276305.
DR   EnsemblGenomes-Gn; EBG00001276307.
DR   EnsemblGenomes-Gn; EBG00001276309.
DR   EnsemblGenomes-Gn; EBG00001276312.
DR   EnsemblGenomes-Gn; EBG00001276315.
DR   EnsemblGenomes-Gn; EBG00001276317.
DR   EnsemblGenomes-Gn; EBG00001276319.
DR   EnsemblGenomes-Gn; EBG00001276322.
DR   EnsemblGenomes-Gn; EBG00001276324.
DR   EnsemblGenomes-Gn; EBG00001276326.
DR   EnsemblGenomes-Gn; EBG00001276328.
DR   EnsemblGenomes-Gn; EBG00001276330.
DR   EnsemblGenomes-Gn; EBG00001276332.
DR   EnsemblGenomes-Gn; EBG00001276334.
DR   EnsemblGenomes-Gn; EBG00001276336.
DR   EnsemblGenomes-Gn; EBG00001276338.
DR   EnsemblGenomes-Gn; EBG00001276341.
DR   EnsemblGenomes-Gn; EBG00001276343.
DR   EnsemblGenomes-Gn; EBG00001276345.
DR   EnsemblGenomes-Gn; EBG00001276348.
DR   EnsemblGenomes-Gn; EBG00001276349.
DR   EnsemblGenomes-Gn; EBG00001276352.
DR   EnsemblGenomes-Gn; EBG00001276354.
DR   EnsemblGenomes-Gn; EBG00001276356.
DR   EnsemblGenomes-Gn; EBG00001276358.
DR   EnsemblGenomes-Gn; EBG00001276361.
DR   EnsemblGenomes-Gn; EBG00001276364.
DR   EnsemblGenomes-Gn; EBG00001276366.
DR   EnsemblGenomes-Gn; EBG00001276368.
DR   EnsemblGenomes-Gn; EBG00001276370.
DR   EnsemblGenomes-Gn; EBG00001276372.
DR   EnsemblGenomes-Gn; EBG00001276374.
DR   EnsemblGenomes-Gn; EBG00001276376.
DR   EnsemblGenomes-Gn; EBG00001276378.
DR   EnsemblGenomes-Gn; EBG00001276380.
DR   EnsemblGenomes-Gn; EBG00001276382.
DR   EnsemblGenomes-Gn; EBG00001276383.
DR   EnsemblGenomes-Gn; EBG00001276384.
DR   EnsemblGenomes-Gn; EBG00001276385.
DR   EnsemblGenomes-Gn; EBG00001276386.
DR   EnsemblGenomes-Gn; EBG00001276387.
DR   EnsemblGenomes-Gn; EBG00001276388.
DR   EnsemblGenomes-Gn; EBG00001276389.
DR   EnsemblGenomes-Gn; EBG00001276390.
DR   EnsemblGenomes-Gn; EBG00001276391.
DR   EnsemblGenomes-Gn; EBG00001276392.
DR   EnsemblGenomes-Gn; EBG00001276393.
DR   EnsemblGenomes-Gn; EBG00001276394.
DR   EnsemblGenomes-Gn; EBG00001276395.
DR   EnsemblGenomes-Gn; EBG00001276396.
DR   EnsemblGenomes-Gn; EBG00001276397.
DR   EnsemblGenomes-Gn; EBG00001276398.
DR   EnsemblGenomes-Gn; EBG00001276399.
DR   EnsemblGenomes-Gn; EBG00001276400.
DR   EnsemblGenomes-Gn; EBG00001276401.
DR   EnsemblGenomes-Gn; EBG00001276402.
DR   EnsemblGenomes-Gn; EBG00001276403.
DR   EnsemblGenomes-Gn; EBG00001276404.
DR   EnsemblGenomes-Gn; EBG00001276405.
DR   EnsemblGenomes-Gn; EBG00001276406.
DR   EnsemblGenomes-Gn; EBG00001276407.
DR   EnsemblGenomes-Gn; EBG00001276408.
DR   EnsemblGenomes-Gn; EBG00001276409.
DR   EnsemblGenomes-Gn; EBG00001276410.
DR   EnsemblGenomes-Gn; EBG00001276411.
DR   EnsemblGenomes-Gn; EBG00001276412.
DR   EnsemblGenomes-Gn; EBG00001276413.
DR   EnsemblGenomes-Gn; EBG00001276414.
DR   EnsemblGenomes-Gn; EBG00001276415.
DR   EnsemblGenomes-Gn; EBG00001276416.
DR   EnsemblGenomes-Gn; EBG00001276417.
DR   EnsemblGenomes-Gn; EBG00001276418.
DR   EnsemblGenomes-Gn; EBG00001276419.
DR   EnsemblGenomes-Gn; EBG00001276420.
DR   EnsemblGenomes-Gn; EBG00001276421.
DR   EnsemblGenomes-Gn; EBG00001276422.
DR   EnsemblGenomes-Gn; EBG00001276423.
DR   EnsemblGenomes-Gn; EBG00001276424.
DR   EnsemblGenomes-Gn; EBG00001276425.
DR   EnsemblGenomes-Gn; EBG00001276426.
DR   EnsemblGenomes-Gn; EBG00001276427.
DR   EnsemblGenomes-Gn; EBG00001276428.
DR   EnsemblGenomes-Gn; EBG00001276429.
DR   EnsemblGenomes-Gn; EBG00001276430.
DR   EnsemblGenomes-Gn; EBG00001276431.
DR   EnsemblGenomes-Gn; EBG00001276432.
DR   EnsemblGenomes-Gn; EBG00001276433.
DR   EnsemblGenomes-Gn; EBG00001276434.
DR   EnsemblGenomes-Gn; EBG00001276435.
DR   EnsemblGenomes-Gn; EBG00001276436.
DR   EnsemblGenomes-Gn; EBG00001276437.
DR   EnsemblGenomes-Gn; EBG00001276438.
DR   EnsemblGenomes-Gn; EBG00001276439.
DR   EnsemblGenomes-Gn; EBG00001276440.
DR   EnsemblGenomes-Gn; EBG00001276441.
DR   EnsemblGenomes-Gn; EBG00001276442.
DR   EnsemblGenomes-Gn; EBG00001276443.
DR   EnsemblGenomes-Gn; EBG00001276444.
DR   EnsemblGenomes-Gn; EBG00001276445.
DR   EnsemblGenomes-Gn; EBG00001276446.
DR   EnsemblGenomes-Gn; EBG00001276447.
DR   EnsemblGenomes-Gn; EBG00001276448.
DR   EnsemblGenomes-Gn; EBG00001276449.
DR   EnsemblGenomes-Gn; EBG00001276450.
DR   EnsemblGenomes-Gn; EBG00001276451.
DR   EnsemblGenomes-Gn; EBG00001276452.
DR   EnsemblGenomes-Gn; EBG00001276453.
DR   EnsemblGenomes-Gn; EBG00001276454.
DR   EnsemblGenomes-Gn; EBG00001276455.
DR   EnsemblGenomes-Gn; EBG00001276456.
DR   EnsemblGenomes-Gn; EBG00001276457.
DR   EnsemblGenomes-Gn; EBG00001276458.
DR   EnsemblGenomes-Gn; EBG00001276459.
DR   EnsemblGenomes-Gn; EBG00001276460.
DR   EnsemblGenomes-Gn; EBG00001276461.
DR   EnsemblGenomes-Gn; EBG00001276462.
DR   EnsemblGenomes-Gn; EBG00001276463.
DR   EnsemblGenomes-Gn; EBG00001276464.
DR   EnsemblGenomes-Gn; EBG00001276465.
DR   EnsemblGenomes-Gn; EBG00001276466.
DR   EnsemblGenomes-Gn; EBG00001276467.
DR   EnsemblGenomes-Gn; EBG00001276468.
DR   EnsemblGenomes-Gn; EBG00001276469.
DR   EnsemblGenomes-Gn; EBG00001276470.
DR   EnsemblGenomes-Gn; EBG00001276471.
DR   EnsemblGenomes-Gn; EBG00001276472.
DR   EnsemblGenomes-Gn; EBG00001276473.
DR   EnsemblGenomes-Gn; EBG00001276474.
DR   EnsemblGenomes-Gn; EBG00001276475.
DR   EnsemblGenomes-Gn; EBG00001276476.
DR   EnsemblGenomes-Gn; EBG00001276477.
DR   EnsemblGenomes-Gn; EBG00001276478.
DR   EnsemblGenomes-Gn; EBG00001276479.
DR   EnsemblGenomes-Gn; EBG00001276480.
DR   EnsemblGenomes-Gn; EBG00001276481.
DR   EnsemblGenomes-Gn; EBG00001276482.
DR   EnsemblGenomes-Gn; EBG00001276483.
DR   EnsemblGenomes-Gn; EBG00001276484.
DR   EnsemblGenomes-Gn; EBG00001276485.
DR   EnsemblGenomes-Gn; EBG00001276486.
DR   EnsemblGenomes-Gn; EBG00001276487.
DR   EnsemblGenomes-Gn; EBG00001276488.
DR   EnsemblGenomes-Gn; EBG00001276489.
DR   EnsemblGenomes-Gn; EBG00001276490.
DR   EnsemblGenomes-Gn; EBG00001276491.
DR   EnsemblGenomes-Gn; EBG00001276492.
DR   EnsemblGenomes-Gn; EBG00001276493.
DR   EnsemblGenomes-Gn; EBG00001276494.
DR   EnsemblGenomes-Gn; EBG00001276495.
DR   EnsemblGenomes-Gn; EBG00001276496.
DR   EnsemblGenomes-Gn; EBG00001276497.
DR   EnsemblGenomes-Gn; EBG00001276498.
DR   EnsemblGenomes-Gn; EBG00001276499.
DR   EnsemblGenomes-Gn; EBG00001276500.
DR   EnsemblGenomes-Gn; EBG00001276501.
DR   EnsemblGenomes-Tr; Daci_R0001-1.
DR   EnsemblGenomes-Tr; Daci_R0002-1.
DR   EnsemblGenomes-Tr; Daci_R0003-1.
DR   EnsemblGenomes-Tr; Daci_R0004-1.
DR   EnsemblGenomes-Tr; Daci_R0005-1.
DR   EnsemblGenomes-Tr; Daci_R0006-1.
DR   EnsemblGenomes-Tr; Daci_R0007-1.
DR   EnsemblGenomes-Tr; Daci_R0008-1.
DR   EnsemblGenomes-Tr; Daci_R0009-1.
DR   EnsemblGenomes-Tr; Daci_R0010-1.
DR   EnsemblGenomes-Tr; Daci_R0011-1.
DR   EnsemblGenomes-Tr; Daci_R0012-1.
DR   EnsemblGenomes-Tr; Daci_R0013-1.
DR   EnsemblGenomes-Tr; Daci_R0014-1.
DR   EnsemblGenomes-Tr; Daci_R0015-1.
DR   EnsemblGenomes-Tr; Daci_R0016-1.
DR   EnsemblGenomes-Tr; Daci_R0017-1.
DR   EnsemblGenomes-Tr; Daci_R0018-1.
DR   EnsemblGenomes-Tr; Daci_R0019-1.
DR   EnsemblGenomes-Tr; Daci_R0020-1.
DR   EnsemblGenomes-Tr; Daci_R0021-1.
DR   EnsemblGenomes-Tr; Daci_R0022-1.
DR   EnsemblGenomes-Tr; Daci_R0023-1.
DR   EnsemblGenomes-Tr; Daci_R0024-1.
DR   EnsemblGenomes-Tr; Daci_R0025-1.
DR   EnsemblGenomes-Tr; Daci_R0026-1.
DR   EnsemblGenomes-Tr; Daci_R0027-1.
DR   EnsemblGenomes-Tr; Daci_R0028-1.
DR   EnsemblGenomes-Tr; Daci_R0029-1.
DR   EnsemblGenomes-Tr; Daci_R0030-1.
DR   EnsemblGenomes-Tr; Daci_R0031-1.
DR   EnsemblGenomes-Tr; Daci_R0032-1.
DR   EnsemblGenomes-Tr; Daci_R0033-1.
DR   EnsemblGenomes-Tr; Daci_R0034-1.
DR   EnsemblGenomes-Tr; Daci_R0035-1.
DR   EnsemblGenomes-Tr; Daci_R0036-1.
DR   EnsemblGenomes-Tr; Daci_R0037-1.
DR   EnsemblGenomes-Tr; Daci_R0038-1.
DR   EnsemblGenomes-Tr; Daci_R0039-1.
DR   EnsemblGenomes-Tr; Daci_R0040-1.
DR   EnsemblGenomes-Tr; Daci_R0041-1.
DR   EnsemblGenomes-Tr; Daci_R0042-1.
DR   EnsemblGenomes-Tr; Daci_R0043-1.
DR   EnsemblGenomes-Tr; Daci_R0044-1.
DR   EnsemblGenomes-Tr; Daci_R0045-1.
DR   EnsemblGenomes-Tr; Daci_R0046-1.
DR   EnsemblGenomes-Tr; Daci_R0047-1.
DR   EnsemblGenomes-Tr; Daci_R0048-1.
DR   EnsemblGenomes-Tr; Daci_R0049-1.
DR   EnsemblGenomes-Tr; Daci_R0050-1.
DR   EnsemblGenomes-Tr; Daci_R0051-1.
DR   EnsemblGenomes-Tr; Daci_R0052-1.
DR   EnsemblGenomes-Tr; Daci_R0053-1.
DR   EnsemblGenomes-Tr; Daci_R0054-1.
DR   EnsemblGenomes-Tr; Daci_R0055-1.
DR   EnsemblGenomes-Tr; Daci_R0056-1.
DR   EnsemblGenomes-Tr; Daci_R0057-1.
DR   EnsemblGenomes-Tr; Daci_R0058-1.
DR   EnsemblGenomes-Tr; Daci_R0059-1.
DR   EnsemblGenomes-Tr; Daci_R0060-1.
DR   EnsemblGenomes-Tr; Daci_R0061-1.
DR   EnsemblGenomes-Tr; Daci_R0062-1.
DR   EnsemblGenomes-Tr; Daci_R0063-1.
DR   EnsemblGenomes-Tr; Daci_R0064-1.
DR   EnsemblGenomes-Tr; Daci_R0065-1.
DR   EnsemblGenomes-Tr; Daci_R0066-1.
DR   EnsemblGenomes-Tr; Daci_R0067-1.
DR   EnsemblGenomes-Tr; Daci_R0068-1.
DR   EnsemblGenomes-Tr; Daci_R0069-1.
DR   EnsemblGenomes-Tr; Daci_R0070-1.
DR   EnsemblGenomes-Tr; Daci_R0071-1.
DR   EnsemblGenomes-Tr; Daci_R0072-1.
DR   EnsemblGenomes-Tr; Daci_R0073-1.
DR   EnsemblGenomes-Tr; Daci_R0074-1.
DR   EnsemblGenomes-Tr; Daci_R0075-1.
DR   EnsemblGenomes-Tr; Daci_R0076-1.
DR   EnsemblGenomes-Tr; Daci_R0077-1.
DR   EnsemblGenomes-Tr; Daci_R0078-1.
DR   EnsemblGenomes-Tr; Daci_R0079-1.
DR   EnsemblGenomes-Tr; Daci_R0080-1.
DR   EnsemblGenomes-Tr; Daci_R0081-1.
DR   EnsemblGenomes-Tr; Daci_R0082-1.
DR   EnsemblGenomes-Tr; Daci_R0083-1.
DR   EnsemblGenomes-Tr; Daci_R0084-1.
DR   EnsemblGenomes-Tr; Daci_R0085-1.
DR   EnsemblGenomes-Tr; Daci_R0086-1.
DR   EnsemblGenomes-Tr; Daci_R0087-1.
DR   EnsemblGenomes-Tr; Daci_R0088-1.
DR   EnsemblGenomes-Tr; Daci_R0089-1.
DR   EnsemblGenomes-Tr; Daci_R0090-1.
DR   EnsemblGenomes-Tr; Daci_R0091-1.
DR   EnsemblGenomes-Tr; Daci_R0092-1.
DR   EnsemblGenomes-Tr; Daci_R0093-1.
DR   EnsemblGenomes-Tr; Daci_R0094-1.
DR   EnsemblGenomes-Tr; Daci_R0095-1.
DR   EnsemblGenomes-Tr; Daci_R0096-1.
DR   EnsemblGenomes-Tr; Daci_R0097-1.
DR   EnsemblGenomes-Tr; Daci_R0098-1.
DR   EnsemblGenomes-Tr; EBT00001808301.
DR   EnsemblGenomes-Tr; EBT00001808302.
DR   EnsemblGenomes-Tr; EBT00001808303.
DR   EnsemblGenomes-Tr; EBT00001808304.
DR   EnsemblGenomes-Tr; EBT00001808305.
DR   EnsemblGenomes-Tr; EBT00001808306.
DR   EnsemblGenomes-Tr; EBT00001808307.
DR   EnsemblGenomes-Tr; EBT00001808308.
DR   EnsemblGenomes-Tr; EBT00001808309.
DR   EnsemblGenomes-Tr; EBT00001808310.
DR   EnsemblGenomes-Tr; EBT00001808311.
DR   EnsemblGenomes-Tr; EBT00001808312.
DR   EnsemblGenomes-Tr; EBT00001808313.
DR   EnsemblGenomes-Tr; EBT00001808314.
DR   EnsemblGenomes-Tr; EBT00001808315.
DR   EnsemblGenomes-Tr; EBT00001808316.
DR   EnsemblGenomes-Tr; EBT00001808317.
DR   EnsemblGenomes-Tr; EBT00001808318.
DR   EnsemblGenomes-Tr; EBT00001808319.
DR   EnsemblGenomes-Tr; EBT00001808320.
DR   EnsemblGenomes-Tr; EBT00001808321.
DR   EnsemblGenomes-Tr; EBT00001808322.
DR   EnsemblGenomes-Tr; EBT00001808323.
DR   EnsemblGenomes-Tr; EBT00001808324.
DR   EnsemblGenomes-Tr; EBT00001808325.
DR   EnsemblGenomes-Tr; EBT00001808326.
DR   EnsemblGenomes-Tr; EBT00001808327.
DR   EnsemblGenomes-Tr; EBT00001808328.
DR   EnsemblGenomes-Tr; EBT00001808329.
DR   EnsemblGenomes-Tr; EBT00001808330.
DR   EnsemblGenomes-Tr; EBT00001808331.
DR   EnsemblGenomes-Tr; EBT00001808332.
DR   EnsemblGenomes-Tr; EBT00001808333.
DR   EnsemblGenomes-Tr; EBT00001808334.
DR   EnsemblGenomes-Tr; EBT00001808335.
DR   EnsemblGenomes-Tr; EBT00001808336.
DR   EnsemblGenomes-Tr; EBT00001808337.
DR   EnsemblGenomes-Tr; EBT00001808338.
DR   EnsemblGenomes-Tr; EBT00001808339.
DR   EnsemblGenomes-Tr; EBT00001808340.
DR   EnsemblGenomes-Tr; EBT00001808341.
DR   EnsemblGenomes-Tr; EBT00001808342.
DR   EnsemblGenomes-Tr; EBT00001808343.
DR   EnsemblGenomes-Tr; EBT00001808344.
DR   EnsemblGenomes-Tr; EBT00001808345.
DR   EnsemblGenomes-Tr; EBT00001808346.
DR   EnsemblGenomes-Tr; EBT00001808347.
DR   EnsemblGenomes-Tr; EBT00001808348.
DR   EnsemblGenomes-Tr; EBT00001808349.
DR   EnsemblGenomes-Tr; EBT00001808350.
DR   EnsemblGenomes-Tr; EBT00001808351.
DR   EnsemblGenomes-Tr; EBT00001808352.
DR   EnsemblGenomes-Tr; EBT00001808353.
DR   EnsemblGenomes-Tr; EBT00001808354.
DR   EnsemblGenomes-Tr; EBT00001808355.
DR   EnsemblGenomes-Tr; EBT00001808356.
DR   EnsemblGenomes-Tr; EBT00001808357.
DR   EnsemblGenomes-Tr; EBT00001808358.
DR   EnsemblGenomes-Tr; EBT00001808359.
DR   EnsemblGenomes-Tr; EBT00001808360.
DR   EnsemblGenomes-Tr; EBT00001808361.
DR   EnsemblGenomes-Tr; EBT00001808362.
DR   EnsemblGenomes-Tr; EBT00001808363.
DR   EnsemblGenomes-Tr; EBT00001808364.
DR   EnsemblGenomes-Tr; EBT00001808365.
DR   EnsemblGenomes-Tr; EBT00001808366.
DR   EnsemblGenomes-Tr; EBT00001808367.
DR   EnsemblGenomes-Tr; EBT00001808368.
DR   EnsemblGenomes-Tr; EBT00001808369.
DR   EnsemblGenomes-Tr; EBT00001808370.
DR   EnsemblGenomes-Tr; EBT00001808371.
DR   EnsemblGenomes-Tr; EBT00001808372.
DR   EnsemblGenomes-Tr; EBT00001808373.
DR   EnsemblGenomes-Tr; EBT00001808374.
DR   EnsemblGenomes-Tr; EBT00001808375.
DR   EnsemblGenomes-Tr; EBT00001808376.
DR   EnsemblGenomes-Tr; EBT00001808377.
DR   EnsemblGenomes-Tr; EBT00001808378.
DR   EnsemblGenomes-Tr; EBT00001808379.
DR   EnsemblGenomes-Tr; EBT00001808380.
DR   EnsemblGenomes-Tr; EBT00001808381.
DR   EnsemblGenomes-Tr; EBT00001808382.
DR   EnsemblGenomes-Tr; EBT00001808383.
DR   EnsemblGenomes-Tr; EBT00001808384.
DR   EnsemblGenomes-Tr; EBT00001808385.
DR   EnsemblGenomes-Tr; EBT00001808386.
DR   EnsemblGenomes-Tr; EBT00001808387.
DR   EnsemblGenomes-Tr; EBT00001808388.
DR   EnsemblGenomes-Tr; EBT00001808389.
DR   EnsemblGenomes-Tr; EBT00001808390.
DR   EnsemblGenomes-Tr; EBT00001808391.
DR   EnsemblGenomes-Tr; EBT00001808392.
DR   EnsemblGenomes-Tr; EBT00001808393.
DR   EnsemblGenomes-Tr; EBT00001808394.
DR   EnsemblGenomes-Tr; EBT00001808395.
DR   EnsemblGenomes-Tr; EBT00001808396.
DR   EnsemblGenomes-Tr; EBT00001808397.
DR   EnsemblGenomes-Tr; EBT00001808398.
DR   EnsemblGenomes-Tr; EBT00001808399.
DR   EnsemblGenomes-Tr; EBT00001808400.
DR   EnsemblGenomes-Tr; EBT00001808401.
DR   EnsemblGenomes-Tr; EBT00001808402.
DR   EnsemblGenomes-Tr; EBT00001808403.
DR   EnsemblGenomes-Tr; EBT00001808404.
DR   EnsemblGenomes-Tr; EBT00001808405.
DR   EnsemblGenomes-Tr; EBT00001808406.
DR   EnsemblGenomes-Tr; EBT00001808407.
DR   EnsemblGenomes-Tr; EBT00001808408.
DR   EnsemblGenomes-Tr; EBT00001808409.
DR   EnsemblGenomes-Tr; EBT00001808410.
DR   EnsemblGenomes-Tr; EBT00001808411.
DR   EnsemblGenomes-Tr; EBT00001808412.
DR   EnsemblGenomes-Tr; EBT00001808413.
DR   EnsemblGenomes-Tr; EBT00001808414.
DR   EnsemblGenomes-Tr; EBT00001808415.
DR   EnsemblGenomes-Tr; EBT00001808416.
DR   EnsemblGenomes-Tr; EBT00001808417.
DR   EnsemblGenomes-Tr; EBT00001808418.
DR   EnsemblGenomes-Tr; EBT00001808419.
DR   EnsemblGenomes-Tr; EBT00001808420.
DR   EnsemblGenomes-Tr; EBT00001808421.
DR   EnsemblGenomes-Tr; EBT00001808422.
DR   EnsemblGenomes-Tr; EBT00001808423.
DR   EnsemblGenomes-Tr; EBT00001808424.
DR   EnsemblGenomes-Tr; EBT00001808425.
DR   EnsemblGenomes-Tr; EBT00001808426.
DR   EnsemblGenomes-Tr; EBT00001808427.
DR   EnsemblGenomes-Tr; EBT00001808428.
DR   EnsemblGenomes-Tr; EBT00001808429.
DR   EnsemblGenomes-Tr; EBT00001808430.
DR   EnsemblGenomes-Tr; EBT00001808431.
DR   EnsemblGenomes-Tr; EBT00001808432.
DR   EnsemblGenomes-Tr; EBT00001808433.
DR   EnsemblGenomes-Tr; EBT00001808434.
DR   EnsemblGenomes-Tr; EBT00001808435.
DR   EnsemblGenomes-Tr; EBT00001808436.
DR   EnsemblGenomes-Tr; EBT00001808437.
DR   EnsemblGenomes-Tr; EBT00001808438.
DR   EnsemblGenomes-Tr; EBT00001808439.
DR   EnsemblGenomes-Tr; EBT00001808440.
DR   EnsemblGenomes-Tr; EBT00001808441.
DR   EnsemblGenomes-Tr; EBT00001808442.
DR   EnsemblGenomes-Tr; EBT00001808443.
DR   EnsemblGenomes-Tr; EBT00001808444.
DR   EnsemblGenomes-Tr; EBT00001808445.
DR   EnsemblGenomes-Tr; EBT00001808446.
DR   EnsemblGenomes-Tr; EBT00001808447.
DR   EnsemblGenomes-Tr; EBT00001808448.
DR   EnsemblGenomes-Tr; EBT00001808449.
DR   EnsemblGenomes-Tr; EBT00001808450.
DR   EnsemblGenomes-Tr; EBT00001808451.
DR   EnsemblGenomes-Tr; EBT00001808452.
DR   EnsemblGenomes-Tr; EBT00001808453.
DR   EnsemblGenomes-Tr; EBT00001808454.
DR   EnsemblGenomes-Tr; EBT00001808455.
DR   EnsemblGenomes-Tr; EBT00001808456.
DR   EnsemblGenomes-Tr; EBT00001808457.
DR   EnsemblGenomes-Tr; EBT00001808458.
DR   EnsemblGenomes-Tr; EBT00001808459.
DR   EnsemblGenomes-Tr; EBT00001808460.
DR   EnsemblGenomes-Tr; EBT00001808461.
DR   EnsemblGenomes-Tr; EBT00001808462.
DR   EnsemblGenomes-Tr; EBT00001808463.
DR   EnsemblGenomes-Tr; EBT00001808464.
DR   EnsemblGenomes-Tr; EBT00001808465.
DR   EnsemblGenomes-Tr; EBT00001808466.
DR   EnsemblGenomes-Tr; EBT00001808467.
DR   EnsemblGenomes-Tr; EBT00001808468.
DR   EuropePMC; PMC3197606; 22028825.
DR   EuropePMC; PMC3618409; 23576841.
DR   EuropePMC; PMC5132249; 27907117.
DR   EuropePMC; PMC5334598; 28254991.
DR   EuropePMC; PMC5512189; 28748209.
DR   EuropePMC; PMC5531050; 28553940.
DR   EuropePMC; PMC5668544; 29097468.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000884.
DR   SILVA-SSU; CP000884.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002762
CC   Source DNA available from David Schleheck
CC   (david.schleheck@unsw.edu.au)
CC   Bacteria available from DSMZ: DSM 14801 (http://www.dsmz.de)
CC   Delftia acidovorans SPH-1 was isolated from a sewage treatment
CC   plant in Germany and is part of a defined three-member bacterial
CC   community which completely mineralises representative congeners of
CC   linear alkylbenzenesulfonate (LAS) surfactants (reference 1). The
CC   community genome was kindly established by DOE-JGI as part of the
CC   2006 Microbes Program (see also JGI Project Id 4003071
CC   [Parvibaculum lavamentivorans DS-1] and 4002763 [Comamonas
CC   testosteroni KF-1]). The first-tier organism Parvibaculum
CC   lavamentivorans converts LAS surfactants into many
CC   sulfophenylcarboxylates (SPCs), and Delftia acidovorans SPH-1
CC   represents a second-tier organism by completely degrading some of
CC   these SPCs; Comamonas testosteroni degrades a different set of
CC   SPCs.
CC   Contacts: David Schleheck (david.schleheck@unsw.edu.au)
CC             Staffan Kjelleberg (s.kjelleberg@unsw.edu.au)
CC             Alasdair Cook (alasdair.cook@uni-konstanz.de)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6767514
FT                   /organism="Delftia acidovorans SPH-1"
FT                   /strain="SPH-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:398578"
FT   gene            16..1422
FT                   /locus_tag="Daci_0001"
FT   CDS_pept        16..1422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: aav:Aave_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32648"
FT                   /db_xref="GOA:A9BP84"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP84"
FT                   /protein_id="ABX32648.1"
FT                   /translation="MTEEPTNDAGQGLWQVCVEQLGQEMPEQQFNTWIKPLTAHVAEDF
FT                   SKVTVYVANRFKLDWIRAQYAGRISAMLESLYGQPVTLELALAQRESVVRTYVRPSSSE
FT                   RSAPPETIVTSVPTVTSEDAAAPVFRTRLNAALTFETLVEGTANRMARSAAMHVAGSPG
FT                   HLYNPLFIYGGVGLGKTHLVHAVGNKLLADKPDAKVLYIHAEQFVSDVVKAYQRRTFDE
FT                   FKERYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPKGLANIHE
FT                   RLVSRFDSGLTVAIEPPELEMRVAILINKARAENAEMPEEVAFFVAKNVRSNVRELEGA
FT                   LRKILAYSRFNQKEVSIQLAREALRDLLSIQNRQISVENIQKTVADYYKIKVADMYSKK
FT                   RPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIAGERQQLTELNQQ
FT                   LHVLEQTLKG"
FT   gene            1544..2662
FT                   /locus_tag="Daci_0002"
FT   CDS_pept        1544..2662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: aav:Aave_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32649"
FT                   /db_xref="GOA:A9BP85"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP85"
FT                   /protein_id="ABX32649.1"
FT                   /translation="MIVLKATQDKVLAVLQSVSGIVERRHTLPILANVLIKKTGNALQL
FT                   TTSDLEIQIRTTAELGGDTGDFTTTVGARKLIDILKTMPGDQTVSLETQQAKMVLKGGK
FT                   SRFTLQTLPAEDFPLVQEAAAFGPSFSVPQKVLKDLLGQVSFAMAVQDIRYYLNGILFV
FT                   AEGKQLSLVATDGHRLAFASSQLDVEVPKQEVILPRKTVLELQRLLSDAGGENQPHIEM
FT                   QFANNQAKFTFGGMEFVTKLVEGKFPDYNRVIPRNHTNSVTLGRAPLLASLQRTAIMTS
FT                   DKFKGVRLTVEPGTLRVASNNAEQEEAMDELDIDYGGDTIEIGFNVTYLIDALSNMSQD
FT                   MIRIDLQDGNSSALLTIPENDSFKYVVMPMRI"
FT   gene            2865..5444
FT                   /locus_tag="Daci_0003"
FT   CDS_pept        2865..5444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: ajs:Ajs_4146 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32650"
FT                   /db_xref="GOA:A9BP86"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP86"
FT                   /protein_id="ABX32650.1"
FT                   /translation="MTDENKPENQTIAPEGSDSSGYGEGAIQILEGLEAVRKRPGMYIG
FT                   DTSDGTGLHHLVFEVVDNSIDEALAGYCDDILVTIHADGSLSVIDNGRGIPTRVKMDDK
FT                   HEPKRSAAEIALTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSIWLKLNVRRDGEVYE
FT                   IDFSRGHVQNRPIEIVDGVEVSPMRVVGKSDKRGTKVHFLPDTEIFTQNHEFRYEILAK
FT                   RLRELSFLNNGVRIRLKDERDGREDDFSGAGGVMGFVQFINANKKVLHPTAFHANGTRP
FT                   AESYGGIPGTEIGVEVAMQWNDSYAEQVLCFTNNIPQRDGGTHLTGLRAAMTRVIGKYI
FT                   EQNELAKKAKVEVSGDDMREGLCCVLSVKVPEPKFSSQTKDKLVSSEVRAPVEDIVAKA
FT                   LTDYLEEKPNDAKILCSKIVDAARAREAARKAREMTRRKGVLDGMGLPGKLADCQEKDP
FT                   ALCEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARYEKLLTSNEIVTLITAL
FT                   GTGIGKATAESGKSGSDDFDPNKLRYHRIIIMTDADVDGAHIRTLLLTFFYRQMPDLVE
FT                   RGHIYIAQPPLYKVKNGKEELYIKDGPALNQYLLRIALMNASVSTGGANPRTLDGEELA
FT                   KLANMHLAAETVIDRLSNFMDAEALRAIADGVQITLDSIEAAQACAPILEAKLRELTTT
FT                   GVPAEVTAEIDPVSEKPVLRISRHHHGNIKSSILTQEFVRSHDYAALADEAQNFNGLLG
FT                   EGAKVTRGEGEKAKSDKAGDFRQAMQWLLHEAERTTARQRYKGLGEMNPEQLWETTMDP
FT                   TVRSLLQVQIGDAIEADRVFTMLMGDEVEPRREFIETNALRAGNIDV"
FT   gene            complement(5770..6699)
FT                   /locus_tag="Daci_0004"
FT   CDS_pept        complement(5770..6699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0004"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: vei:Veis_4576 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32651"
FT                   /db_xref="GOA:A9BP87"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP87"
FT                   /protein_id="ABX32651.1"
FT                   /translation="MSLTLRQLKYFTAVAEVGRISHAALQLNISQSAVTTAVRELEEML
FT                   GQQLFERQPHGVELTRAGRRFLSHAYAVLSAADEAIRMPHEGVNVEGTLTIAATYTVLG
FT                   YFLPHHLQRFEQLHPQIKVKVHEVVREAIEEGLITQQYDMGVLLTSNVVLRELSLETFF
FT                   GSQRRLWVPAKHALLEKAEVTLADVAAEPYILLTVDEAAGTAMKYWSKTPYQPQIRLRT
FT                   SSVEAVRSTVANGLGVTVLSDMVYRPWSLEGKRIETISLRDAVPTMNIGLGWKQGIEFS
FT                   PAMTAFRDYFRQLFLEPVVHQGRRRPGG"
FT   gene            6915..7727
FT                   /locus_tag="Daci_0005"
FT   CDS_pept        6915..7727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0005"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: vei:Veis_4577
FT                   LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32652"
FT                   /db_xref="GOA:A9BP88"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP88"
FT                   /protein_id="ABX32652.1"
FT                   /translation="MPTTQGKNVKKTLIDLNSDMGESFGPWAIGDGVDQELMPLISSAN
FT                   IATGFHAGDPNIMRKTVLLARENGVGIGAHPGFRDLVGFGRRHINAPADELVNDMVYQL
FT                   GALREFARLAGMTLQHIKPHGALYMHAARDEALSRALVTALQQIEPTLRLFCMESSVTF
FT                   QVACELGQPVAREFYADRDYDLSGSIVFTRRVGALDPEAVAAKVLRACTEGVVRTVEGQ
FT                   DLAIGFDSVCIHSDTPGALALVQATRRALAKHGIEVAGFAGAAAPAQP"
FT   gene            7781..8029
FT                   /locus_tag="Daci_0006"
FT   CDS_pept        7781..8029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0006"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: vei:Veis_4578 biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32653"
FT                   /db_xref="GOA:A9BP89"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP89"
FT                   /protein_id="ABX32653.1"
FT                   /translation="MPATHEVLSPLPGTFYRRSAPDAPPFKAEGDTVAVGDVIGLVEVM
FT                   KQFSEVTADVAGRLRGFAVENGEPVDPGQALAVIETA"
FT   gene            8040..9437
FT                   /locus_tag="Daci_0007"
FT   CDS_pept        8040..9437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0007"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; RimK domain protein
FT                   ATP-grasp; KEGG: vei:Veis_4579 carbamoyl-phosphate synthase
FT                   L chain, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32654"
FT                   /db_xref="GOA:A9BP90"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP90"
FT                   /protein_id="ABX32654.1"
FT                   /translation="MTAAFDKLLIANRGEIAVRIIRAAKELGLKTVAVYSDADAQSLAV
FT                   RMADEAVRIGPAHATRSYLSVDAILEAAADSGAGAVHPGYGFLSENAAFAERIEGAGLV
FT                   FVGPTPHAIRTMGDKAAARAAAMKAGVPTVPGSVGAVTDADTAVAVAKDIGYPIMIKAS
FT                   AGGGGRGIRVAHDEAELRQQFATATAEAQAAFGNGEVYLERFIRQARHIEVQILGDGQR
FT                   VVHCFERECSLQRRRQKVWEEAPSAAISEATRAALCESALRLAHAVAYRGAGTLEYLYD
FT                   DDTREFFFIEMNTRIQVEHPVTEMITGIDLVKEMLRIALGQPLRLQQEDIRLTGAAIEV
FT                   RINAENAAKNFMPSPGLVSQLVVPGGPGVRFDTMLFPGCTVPAYYDSLLGKLIVHDTDR
FT                   AGALARMRRALDELQVEGIHTTIPLHRALCEDAGVAQAAFHTGFLETWLALNPLADAPA
FT                   PLAEVTA"
FT   gene            9434..10345
FT                   /locus_tag="Daci_0008"
FT   CDS_pept        9434..10345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0008"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   bur:Bcep18194_A6283 allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32655"
FT                   /db_xref="GOA:A9BP91"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP91"
FT                   /protein_id="ABX32655.1"
FT                   /translation="MTAASTLPTQARYSFGGDEHLFVEISEEMSLPAFFKGMAICNELR
FT                   RRAQAGEITGVTEICPANAAYLVRFDPDAIAPDALLATLKDIEAGLGDADLQMQTRIVE
FT                   IPVLYNDPWTHETLMRFRERHQDPSGTDIEYAARINGHVSVEAFIEAHSSAPWFVSMVG
FT                   FVAGLPFLFQMVERQRQIQVPKYLSPRTDTPRLTLGHGGCFSCIYSVRGAGGYQMFGVT
FT                   PAPIFDPAQRLSYLKELMVFFQPGDIVKYKPIDRAEYDRQIAQVEAGTYALRIAPVSFS
FT                   LNDFLADPGGYNQQLLKVLHGD"
FT   gene            10335..11312
FT                   /locus_tag="Daci_0009"
FT   CDS_pept        10335..11312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0009"
FT                   /product="urea amidolyase related protein"
FT                   /EC_number="3.5.1.54"
FT                   /note="KEGG: vei:Veis_4581 UreA amidolyase related protein;
FT                   TIGRFAM: urea amidolyase related protein; PFAM: Allophanate
FT                   hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32656"
FT                   /db_xref="GOA:A9BP92"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP92"
FT                   /protein_id="ABX32656.1"
FT                   /translation="MAIEVLKPGLATSVQDAGRPGYYHLGIPLSGALDQQSLVLANLLV
FT                   GNDEGAAVIESTLLGPELQFDAPALVAVTGADAKIKLNVNEVPRNTAFAVQAGDRLGFD
FT                   FMKLGARMCIAVAGGIDVPVVLGSRSTYSLGAFGGFNGRKLLAGDRLPVGVPSATARAG
FT                   RTVQAALLPVLDKEVVLRVLPGIYFHRLQEVSVQSFFADTWTVGSEADRIGYRYKNGTP
FT                   LKFHERTPPFGAGDDPSNIVDAGYPYGSIQVPGGREPIILHRDAVSGGGYAMVGTVISA
FT                   DMDLIAQMQPNHKARFVEVDMAQALEARAERRRRIERLRAALSA"
FT   gene            complement(11432..12595)
FT                   /locus_tag="Daci_0010"
FT   CDS_pept        complement(11432..12595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0010"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reh:H16_A3377 predicted acyl-CoA
FT                   transferase/carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32657"
FT                   /db_xref="GOA:A9BP93"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP93"
FT                   /protein_id="ABX32657.1"
FT                   /translation="MQTRPLDGLTVLAMEHAVAGPFASRQLADLGARVIKLERLPDGDF
FT                   ARGYDDKVHGESSFFVWANRGKQSLAADIKTAEGQHIVGKILENADILIQNLAPGAMQR
FT                   MGMDFDSLHEKYPRLIVCDISGYGEGGPLSDKKAYDLLIQAVAGLISVTGTPDQPARVG
FT                   ISIADIAAAMYAYSGILSALLQRARTGRGLRVEVSMLEALAEWMSYPLNFAHYGGTAPA
FT                   RSGLTHPSIAPYGQYTAGDGQSLIFGLQNDREWHSFCIHVLQQPALAQDARFATNLQRV
FT                   AHRAELDAVIASVLAHLSREQAMQRLDAGGIANAPLNDMHAVWNHPQLQARQRWREVAT
FT                   PAGNIQALLPPATLSDAEAAMGAVPALGEHTQALWDEFGGQARGWLE"
FT   gene            complement(12690..13610)
FT                   /locus_tag="Daci_0011"
FT   CDS_pept        complement(12690..13610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0011"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reh:H16_A3376 transcriptional
FT                   regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32658"
FT                   /db_xref="GOA:A9BP94"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP94"
FT                   /protein_id="ABX32658.1"
FT                   /translation="MRYELTDLRVFLAIAQAKSLSAGAAEMHLTAPSASYRLKNLEQAM
FT                   GASLFERTSKGMVLTPAGMTVKKYADSIFGSVDRLHGEMQRHINGISGHIRVFANSSTL
FT                   TGIAPVLSRYLAHYPNVNVDLEERLSEDTVRAVLDGNADVGLVAGQIDLHGLHAITYGH
FT                   DELVFVVPAGHPLAASSRVPLETALTYDLVSIGRKTSNFLYLQGMASRLGMNPRVRVHA
FT                   PTFEAVLQCVQEGVGIALVPRSIARPALQAHRLAAVGLDEAWAQREQKVVTREPETLPA
FT                   YARDFVAYVAAQPLPEEGAVQESLP"
FT   gene            13737..14708
FT                   /locus_tag="Daci_0012"
FT   CDS_pept        13737..14708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rme:Rmet_3811 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32659"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP95"
FT                   /protein_id="ABX32659.1"
FT                   /translation="MDFKTARRQTLLTALLLAAGAAASQDYPARPIKLVIPYAAGGPTD
FT                   TFGRAMADVWSQKLGTPVVIENRTGAGTLVGTEAVAKAAPDGYTLLLTTVAHAVNPYIH
FT                   DKLGYRTEEDFAPVGLLARAPLVLVVDKRLPVQSLPDFLAYLRARPGQVSYASAGVGSA
FT                   PHLGAELLNLMAGTRAQHVPYRGSAPAIQDLIGGHLAFMLDSAPTGLAQVKAGTVRLLA
FT                   TTMAQRLPQTPDTPAIAEQVPGYEAYTWNAVFAPAGTPPALIARLQSSLQATVDDAGLQ
FT                   KKAYDMGLVLEKQPRPQALAAFLKQELDKWGKVARAAHMSAN"
FT   gene            14720..15184
FT                   /locus_tag="Daci_0013"
FT   CDS_pept        14720..15184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0013"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   rme:Rmet_3812 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32660"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP96"
FT                   /protein_id="ABX32660.1"
FT                   /translation="MPRHPSLCAQRYFEDFALGEVFALPSRTMTDALFAAFQLASGDNH
FT                   PVHYDVEYCRARGMPHMLAHGYQVAIQTAAGAGLFPHMVEESLKGFLEQGSRFLAPVYV
FT                   GDTLYCTLTVSELKPGNTTGVLTLATEVLNQRDERVSDGFQKYLLRKRPA"
FT   gene            15195..15713
FT                   /locus_tag="Daci_0014"
FT   CDS_pept        15195..15713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0014"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   ajs:Ajs_4149 protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32661"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP97"
FT                   /protein_id="ABX32661.1"
FT                   /translation="MDAGAASPKDPPPRLATPARQPPPGFLTKNSGPAHAHPPTMRSPI
FT                   SIVDVDRLDSWSKYKPGMCDSCAANCCTMPLEVQLPDLVRLELVDPFEVDNVEPKLIAK
FT                   RLMKMRLIDHYNPKHNIFTMARRASGDCNFLDAQSRRCTVYDKRPETCRLHPKKGPKPG
FT                   FCAYGHKDR"
FT   gene            complement(15884..17290)
FT                   /locus_tag="Daci_0015"
FT   CDS_pept        complement(15884..17290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0015"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: mms:mma_0288 two-component
FT                   sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32662"
FT                   /db_xref="GOA:A9BP98"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP98"
FT                   /protein_id="ABX32662.1"
FT                   /translation="MSLAKPWSSTAFRLALTYGVLLVLTMSIVLSVFYVQTVGVLRMRT
FT                   DRQAENHMRRLVEHRDKYGEPALEAEIQQTLLDGVNTDTEILILMDGEGNPIIGNADVV
FT                   PARRLTEMGVRDLKVRRNGKIIAGRVAVAQLSDGKLLAVGSDMQVQSDVEELFGRASLL
FT                   AGLVALGMAVLGAGAFRRVVEERAADIRSTMARVATGDLRQRIPVTRRDDEFTLLNRDI
FT                   NTMLDRLELLMDGIRHVSNTIAHNLRTPLTRILLRLRNAQQATPEEKNETLALVAQEVA
FT                   ELGVVFDKLLQIAEVESGASRKNFAPVDLRALLVDVVEFYEPLVEDAGGVLRLDVEGMP
FT                   MALGDGDLLASAVANLVDNAIKYGSLPDSDHGADMQLRAGVAHEHGMDGGAWGVEIIVQ
FT                   DRGPGVDAQTREKMSTRFYRAESDREGYGLGLASVLAIVQLHGGKLGFENMHPGLQARI
FT                   WLPGLPGNSP"
FT   gene            complement(17295..18083)
FT                   /locus_tag="Daci_0016"
FT   CDS_pept        complement(17295..18083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0016"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mms:mma_0289 two-components
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32663"
FT                   /db_xref="GOA:A9BP99"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9BP99"
FT                   /protein_id="ABX32663.1"
FT                   /translation="MPASPPISAESGAPYSVCLSFESGPAARMYRYLIIEDDALNARYI
FT                   AEGLRQQGAQVAVCSDGVQGIAMAVGESWDVIILDRMLPNGFDGLQILQTLRSMGKQTP
FT                   VLVLSALSATDERVRGLKAGCDDYLTKPFAFSELSARLEALVRRAQIPAPAREMRLADL
FT                   RLNLLTRSAERAGQPLALQPREFRLLAFLMQHAHQIVTRTMLLESVWDYRFDPQTNVID
FT                   VHISRLRGKVDKGFEPALIHTVRGVGYSLSDRPQDLPQVA"
FT   gene            complement(18230..19651)
FT                   /locus_tag="Daci_0017"
FT   CDS_pept        complement(18230..19651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0017"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   mxa:MXAN_7436 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32664"
FT                   /db_xref="GOA:A9BPA0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPA0"
FT                   /protein_id="ABX32664.1"
FT                   /translation="MKKSDSPLSGFAASPSRFAGGTTPSPRGGSCSASLAFGRAGFAGS
FT                   ARYRALFVAVALCCGAGSALAQQAVPAVPAITAAPASEVAPAAAPQQPVGMQEYLQMVV
FT                   RNQPQLAAQRLQIGIAQADSRTAAAFPNPTASYSSKPGEKQWGIEQPLPIFGQRRLRME
FT                   NARKGETAARANVEVAVATTLNDAATAFIDLLMTQQRLKVWEEAQEALNGAGNIVRGQI
FT                   EAGARSRYDGARLSLQQAQMAMQVSQAQSDWQDAASHAAALAALPQWAPRATGSLQAVP
FT                   VGQLLNEQELWEAARQRLPVLVAAQAELDQLRHKVELERREALPTPSVSVARVRNRLDG
FT                   NYNQIGVSVELPLFDRREGPIARAQVEAEQAQLRYDAALIEARTELQRAIKQLKLRRDA
FT                   VRAYEKQGLAQIAPLNQMAQDAYKLGQGSILELIDSLGSINEHRLEHLDLVKEMMLAEW
FT                   QVRVASGDLPMWAAP"
FT   gene            complement(19638..22742)
FT                   /locus_tag="Daci_0018"
FT   CDS_pept        complement(19638..22742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0018"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: mxa:MXAN_7437 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32665"
FT                   /db_xref="GOA:A9BPA1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPA1"
FT                   /protein_id="ABX32665.1"
FT                   /translation="MLRSLIAFVVHRRLVALCATLIIAIYGVYSYLHTAIEAYPDVTNV
FT                   QVGVIAQAPGLAPEEVERQITQPLERELNGTPGLVSLRSESYFGLAMINLVFNDDADSF
FT                   HARAEVSQRLPQANLPDGVTPEMAPDYTPLGKIFYYRLKSDRHTLAQLRTEQEWRVVRV
FT                   LKQVQGVADVVSIGGFVKEFHVEVDPEKLYALGLSLEDVSDALSKSNRNVGGGLMRRGE
FT                   QSLIIRGIGLLRTPQEIQGVVVAMRGSAPVTIGDVARVVQSHTPRQGSVGMDDADDVVQ
FT                   GIVLLKRGENPSVVLDQIHAKVAALNDGGLPEGMHMETNYDRSDLVGHTLGTVQHNLLF
FT                   GATLIVGVLWLFLRSLRGSLIVATVIPLSLLVAFIGLHLLGMPANLISMGAIDFGIMVD
FT                   GAVVLAENIIRNARMRKPQTQADMRHIIIDSAVAVAKPTLFAMAIVIAALIPVFSLESI
FT                   EGRIFRPLAMTYSFALLGALVFAMGLVPALCALFLKPQHVMVEEPKIFDRAHHGYQHWI
FT                   AKVLDAGRRRAMIVIASLAILVAAGVSAAWLGTEFLPELDEGDAYVLVQMPASISLEKG
FT                   QEVLRDVRLRLKTFPEVITVTTEQGRPESGTDNETLNLAKVLVRLKGHGEWRKGLTKPQ
FT                   LIEQMRATLSEIPGVSFNFAQPIRDSVEESTSGARGQVVLKVFGPDIPQLRSILQQTVD
FT                   LVKDIDGVVDLGLYRDAPAPQVHVEFDRQSLARQGIAMETAQKTLEAALAGNISTTLWE
FT                   GEYPVPVRVRLPYVDRMDEERIRNIAIPLPNGGSVPLHSVGQVAIKIGNSSIFREGNAR
FT                   YMALKFNVEGRDIGSVVKDTLATFKKNVKIPEGYQAVWGGEWENQQRAAARLKIVVPLS
FT                   LIIVYALLFGALGQARSAGIILLCAPFTMVGGIAALHFAGIELSISAAIGFIALLGQVA
FT                   LAGLLVISAVEELRRQGMPMMQALVEGAAERMRSIVLVALLALLGLLPMALSTGVGSET
FT                   QKPFASVIVGGMVVLPLVALVLLPVLYALLGPKNMLTQEELDEKE"
FT   gene            complement(22764..23912)
FT                   /locus_tag="Daci_0019"
FT   CDS_pept        complement(22764..23912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0019"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: mxa:MXAN_7438 putative cobalt-zinc-cadmium
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32666"
FT                   /db_xref="GOA:A9BPA2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPA2"
FT                   /protein_id="ABX32666.1"
FT                   /translation="MIKTFAGLPKAARFPAASACAVIAVACLVAGCDASKASAQNEPAA
FT                   QAPAPAGVVRVKPESLKMLDIAVVADPQGTQMAWAPARVAFAEDRVATVSVPLAARVVS
FT                   VRAHVGDIVKAGDELATLVSPEALRVRYEVEAARSAHDVATVEVRRQQTMVDKGVGVEV
FT                   DLRAAQAKLRESAQELARAQGTSALLGQGGGDRLVLRAPRAGVVAERKAVVGASVEPSG
FT                   ELFLIGDPAAMNVVADVFESDLPGIRLGSAVQVDVPQLPKPLTGTVRHLGATLDKESRR
FT                   ASVIVQLDAQNPVLRSGMQARVGLQVSNEHEMLIPVTAVLIKDESRSIVFVQTGEQQFE
FT                   ARTVVLGRPSRGMVPVVSGLKSGEKIVVRGGLLLDGAASQLL"
FT   gene            24333..24644
FT                   /locus_tag="Daci_0020"
FT   CDS_pept        24333..24644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32667"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPA3"
FT                   /protein_id="ABX32667.1"
FT                   /translation="MNGDNHPINPQACQQHAHRIDHRPNALAAVGKTVDAATRMAINGH
FT                   GNNPGTAGGQMSIPVTDTHLCTHAIGGFSDPYDGQLVGCTAYEKRALCAVFHKISHLI"
FT   gene            24810..26888
FT                   /locus_tag="Daci_0021"
FT   CDS_pept        24810..26888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0021"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; DEAD-like helicases; KEGG:
FT                   aav:Aave_0013 helicase C2"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32668"
FT                   /db_xref="GOA:A9BPA4"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039000"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPA4"
FT                   /protein_id="ABX32668.1"
FT                   /translation="MAAQIAQTFSQAQLGKIDEGAPEPTRSIAVVQAGTGVGKSLAYSI
FT                   PAISMALARGTRVLISTATVALQEQLVNKDLPALAQQLEQPFKFALAKGRGRFVCKLKL
FT                   ERLASTGEAQDEDLDDLFAEEKAQAQSRVARPAQELEARMQFYKSMANALASQAWDGDR
FT                   DSLETPPEAEAWSPVAAESSSCTGKHCPAFSNCVYYERRKDLVAAQVIVANHDLLLSSL
FT                   GARLLPELDNCLLVLDEAHHLPATALGQFAGEMDLSRLGWIDKLTSRALRVNTLVEVEE
FT                   LADLPSHASQLRQQLQELARLVMELYGDTLKSQKDSWGPARVRAPRGMLPEPLLEPLGK
FT                   AAHHANSFLDALRAISKALRAAIKDNPEEARRLSTAYAQVGALAPRLESVYDTAQLLMQ
FT                   QPAQDDDSSRVPNAKWFTLETDGEYIVVKAHASPILPGATLRHHLWSQVRGAVLTSATL
FT                   TSCGQFDFFLREAGLHDDAAVTTLEVPSPFDYARQGTLVARETVADPKEAARFTQEMVD
FT                   ALLGDLSHVQAGALVLFTSREQMRLAVDALSTAMRSQVLVQTAMPRALLLARHRDAVEM
FT                   GEPSIIFGMQSFGEGLDLPGALCESLFITKLPFAPPDDPVGEARAEWLRSSGRNPFNEL
FT                   VVPATAIRLAQWVGRAIRTEEDQAHVYCYDRRLVNTSYGQQLLKGLPPFALQRRPAR"
FT   gene            complement(28449..29111)
FT                   /locus_tag="Daci_0022"
FT   CDS_pept        complement(28449..29111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32669"
FT                   /db_xref="GOA:A9BPA5"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPA5"
FT                   /protein_id="ABX32669.1"
FT                   /translation="MAPKNTQTTPSSCQNHATARKNPPERSGRPQRPGRPASFAAVLLA
FT                   GAAAVLPLAAQAQSTPESSPSMYLQYGAAEHSADSWTVGVTVPWRNWRHALWGGQLSGY
FT                   WDVWGARWSAPLEGRDRGTWVIGVNPTVRWRPSNGQSPWFAETGVGLSWALNRRYVTDE
FT                   KEFPTRYNFATHIGVGYLFGSQGQHELVLRLEHHSNAGIKKPNPGENFLQLRYAHHF"
FT   gene            complement(29287..29841)
FT                   /locus_tag="Daci_0023"
FT   CDS_pept        complement(29287..29841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32670"
FT                   /db_xref="GOA:A9BPA6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPA6"
FT                   /protein_id="ABX32670.1"
FT                   /translation="MTTTFRRTLASAAAATALLASFALPSYAQTAAAAAPAAAATTTAP
FT                   KPDRAMHKHGDRMEHMQQRIAKLKADLKLTPAQETAWNTYAATFKPGERPQRMEREDFA
FT                   KLTTPQRIDKMREMRAQRAADADRRGEATKAFYAQLDASQQKTFDAATLHKGHPGHHGM
FT                   DHGPRHDHKSGQARPAPAPAQ"
FT   gene            30152..31207
FT                   /locus_tag="Daci_0024"
FT   CDS_pept        30152..31207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0024"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG: aav:Aave_0025
FT                   putative exonuclease, RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32671"
FT                   /db_xref="GOA:A9BPA7"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPA7"
FT                   /protein_id="ABX32671.1"
FT                   /translation="MFKNMIVYRIAESWQGDLQQLEEALGKSPFAECGATQERSAGWVP
FT                   PRGEPHGPLAESVANQWVMRFMTEAKMLPASVLNRRVNEKAAHIEATEGRKPGKKEKKE
FT                   LKDEAKLDLLPMAFTKQGAMWVWLDPQARTLVLDTGSQARADEVVSSLVEGLTGFALAL
FT                   VDTQTSAQAAMAHWLTTQESPAGFSIDRECELKAADESKAVVRYARHPLDIDEVRQHIE
FT                   HGKLPTRLALTWDDRVSFVLTEGLQLRKIALLDAVMEGQSQDDGGFDADVAIATGELSK
FT                   LIPDLIEALGGEGRTGLGQDLPASLQTPAAQTPTATQATPAAPRAAASGRGALTGPALA
FT                   PVDTAPEEAPF"
FT   gene            complement(31268..32455)
FT                   /locus_tag="Daci_0025"
FT   CDS_pept        complement(31268..32455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0025"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: ajs:Ajs_0014 acetyl-CoA acetyltransferases;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32672"
FT                   /db_xref="GOA:A9BPA8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPA8"
FT                   /protein_id="ABX32672.1"
FT                   /translation="MTPRDVFVVGTARTAIGTFGGSLKDVPNTQLATTAVKAAIERAGL
FT                   APDAIGHVVMGNVIPTDTKDAYLSRVAAIDAGCPIETPAFNVNRLCGSGLQAIVSAAQA
FT                   IALGDCDVAIGGGSESMSRGPYFDQAARWGARMGDAKSIDYMLGILHDPWQKMHMGITA
FT                   ENVAERYHISREMQDELAAASHQRAAAAIAAGHFKEQIVPVEIATRKGVVVFDTDEHVR
FT                   ASTTIELLSTMKPAFRKEGGSVTAGNASGINDGAAAVALAAGDRVAALGLKPLARLVGY
FT                   AHAGVDPAYMGIGPVPATQKVLQRTGLKIADMDVIEANEAFAAQACAVIQQLGMDPAKV
FT                   NPNGSGISLGHPVGATGAIITTKAIAELQRTGGRYALVTMCIGGGQGISAIFERV"
FT   gene            complement(32555..33343)
FT                   /locus_tag="Daci_0026"
FT   CDS_pept        complement(32555..33343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0026"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rfr:Rfer_4068 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32673"
FT                   /db_xref="GOA:A9BPA9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPA9"
FT                   /protein_id="ABX32673.1"
FT                   /translation="MTDTQDTPLLLHREGAIATLTFHRPAALNAIDVPMALALRDAVRT
FT                   LAQDRALRCVVLEGAGRAFMAGGDLDTLAADPVRGAAELLAPLNEAVALLGQLDAPVIA
FT                   KVHGAAAGAGLSLMLQADFVYAAEGTRFNLAYINLGASCDVGASWALPRIVGLRNALEI
FT                   AMLGETLDCAQAQRLSLINRVLPPAELDAAVQQLAQRLAAGPTVALGHMRRLMRAGLDR
FT                   SLRDQLAAEACAFDACARTADLPRGIAAFHAKQTPQFEGR"
FT   gene            complement(33353..35188)
FT                   /locus_tag="Daci_0027"
FT   CDS_pept        complement(33353..35188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0027"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rfr:Rfer_4067 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32674"
FT                   /db_xref="GOA:A9BPB0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPB0"
FT                   /protein_id="ABX32674.1"
FT                   /translation="MKNLPELTLPQMLAERARSDALRVAIRQKDFGIWKPTSWARYHER
FT                   ASHFGLGLAQLGLPPGGHMGVISENRIEWVLAQMGAGLIGAITVGVYPTSPTPEVAYVA
FT                   GHADVDIMVCEDQEQTDKLLAALPQLPRLKKIIVMETKGLRSFAPEVRALIATFDEVER
FT                   LGAQAASRAPIEQALARQTLDDVGLMIYTSGSTGKPKGAMITYRNIRGVVPGIAERLGL
FT                   DGGTRHLSYLPLCHVAEQMLTSFVPVYLGSQVHFGESIRTVQEDLREVAPNMFLGVPRI
FT                   WEKLHAAISIKMQETGPLRRALYRRAMAACAPLAEKPRRQWSLAERLAWAASYWSVLRA
FT                   LQNFIGLREARVALTGAAPIPPDVVRFFRTLGVPLIEVYGLTESTGMVTGHRLDDVAVG
FT                   SVGVATEGVQWRIASHGGQPGDEGDGSGELLIKGDMVFAGYYKNPEATAQSLQDGWLHT
FT                   GDVVRVQGGQLRIVDRLKDIMITAGGKNLTPSEIENTMKASPFIKECIVVAEGRKFVGA
FT                   LVQIDYETVGQWAQARRIPFTHFRSLAEMAEVRALIDAEIAQGNARLAQVSHVRRFHLL
FT                   TKELDHDDGEVTATMKVRRSSIYKTYAAEIDALYH"
FT   gene            complement(35334..36152)
FT                   /locus_tag="Daci_0028"
FT   CDS_pept        complement(35334..36152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0028"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rfr:Rfer_4066 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32675"
FT                   /db_xref="GOA:A9BPB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPB1"
FT                   /protein_id="ABX32675.1"
FT                   /translation="MTEQPTDKVLEINNIEVIYNKVVQALRGLSLAVPRGQIVALLGSN
FT                   GAGKSTTLKAVSGLLALEDGLLASGSVRYNGQSTAQYAPQQLVRLGLSHVMEGRRVFED
FT                   LTVEENLVAATYALTGRNQVKPDFDLVYSYFPRLHERRKGLAGYLSGGEQQMLAIGRAL
FT                   IAQPQLMLLDEPSLGLAPKLVEDIFTIIARINAERGTSMLLVEQNATVALAVAHSGYIM
FT                   ENGKIVIDGPAERLAQDADVREFYLGMGGGGEAKSFRDLKHYKRRKRWLS"
FT   gene            complement(36178..37359)
FT                   /locus_tag="Daci_0029"
FT   CDS_pept        complement(36178..37359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0029"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rfr:Rfer_4065 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32676"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPB2"
FT                   /protein_id="ABX32676.1"
FT                   /translation="MQQHPTSSRRRSLLLAAGASLAAPLAARAQAGGEDIVIGGSIPMT
FT                   GVFAFAGVGINAGMGDYVKMVNEAGGIKGRKIRYVPEDTGYKVDVSVAAFKKITSQNKV
FT                   NLYYGDSTGFSKTINPELDRNGAILMAGASFATELNNPAKYPNQFLVGPDYTEMFGILL
FT                   KHIAKEKPGAKVAFVYSDSEFGRDPIEASEAAAKKLGLNVVAKLMTPPGSVDVSTEVIK
FT                   LRRAAPDYTIFHGYILAPIPEFIQQGKQMGMTSQWMGTFWTMDSSTVMKMGEAGDGFMG
FT                   VMPYRYYYDTSAKAPMLDKIRALRPEYQSTAYIQGFLAAMLFVESARRCLDAGKPLTGP
FT                   NLKAALNSIKDFDTGGLIGVPITIKGNSIPVGRVYKADMKAQKMLPASDWIAL"
FT   gene            complement(37397..38434)
FT                   /locus_tag="Daci_0030"
FT   CDS_pept        complement(37397..38434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0030"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rfr:Rfer_4064 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32677"
FT                   /db_xref="GOA:A9BPB3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPB3"
FT                   /protein_id="ABX32677.1"
FT                   /translation="MRIGTLKESYIADAALYDSRTQRIWLAMAGALLLLFPFMASDYWL
FT                   YLACLVSINVAGATGLNILTGYTGLVSLGQAAFMGLGAYTVAIVQARWGTPVLFNLLAG
FT                   GFVAMLGGIVVGLPSLRVKGLYLAIATIAASFIAHFLFANLRLTGGTAGLTLQPATVFG
FT                   VALDTSFRLYWVIVPVTLLMLLGAANLFRTRIGRAFIAIRDRDISAEVLGIPLLRYKLL
FT                   SFGLSSFYAGVAGGLWAYFFRVVTPESFPLLMSIFFLAAIIVGGMGSILGGILGAVFMT
FT                   MVPELLKLIVDLLPGGSELAVFLSPVRTMVFGLLIIVFLVFEPQGLAQMWRRLRRFFHL
FT                   WPFRN"
FT   gene            complement(38457..39338)
FT                   /locus_tag="Daci_0031"
FT   CDS_pept        complement(38457..39338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0031"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rfr:Rfer_4063 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32678"
FT                   /db_xref="GOA:A9BPB4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPB4"
FT                   /protein_id="ABX32678.1"
FT                   /translation="MMDWAYLFEIALTGLAAGGLYALAALAFVVVYKATRVVNIAIGEL
FT                   LMVGAYLFFTFAAMFTLPLWLAIPAAVLGTGLLGALIERTMIRPLLGEPPISVFMVTVG
FT                   LASVLVGLVELIWTADQRRLPEFMPTQPVMIGEAFLAPKVAWGAAVAVVFIAAVLLVFR
FT                   YWRGGVALRATASDQAAAYSVGINVPRVFSLAWVVSAMIAAVSGIIVGSIGGISSSMGV
FT                   FGLSVLVVVIVGGLDSVLGALVGGLFIGLVEALAGAYLGGEYKLLATFIVLVVVLMLRP
FT                   YGLFGTHEIERL"
FT   gene            complement(39335..40219)
FT                   /locus_tag="Daci_0032"
FT   CDS_pept        complement(39335..40219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0032"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bpa:BPP2037 high-affinity branched-chain amino acid
FT                   transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32679"
FT                   /db_xref="GOA:A9BPB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPB5"
FT                   /protein_id="ABX32679.1"
FT                   /translation="METHPDGGPPAPLLQVDGVTLAFGGVKALSGVGFDVQPGSITAVI
FT                   GPNGAGKTSLFNTISGFYRPTGGSIRFQGEDITRTPAPRRARLGLGRSFQNIALFRGMT
FT                   VLDNIKLGRHAHLRTNVLDALLYLGRARREEAELRRDIEERIIDFLEIDHIRHAPVAAL
FT                   SYGLQKRVEMARALAMQPRILMLDEPVAGMNREETEDMARFILDVRAEWGVTVLMVEHD
FT                   MGMVMDLSDHVVVLNFGQVIAQGTPAVVQADPEVNRAYLGAGDVGELRRRLRGTSTRPE
FT                   PATPQPALAQEAA"
FT   gene            40350..41120
FT                   /locus_tag="Daci_0033"
FT   CDS_pept        40350..41120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0033"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rfr:Rfer_4061
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32680"
FT                   /db_xref="GOA:A9BPB6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPB6"
FT                   /protein_id="ABX32680.1"
FT                   /translation="MKQSSPETKTRPSPSPGTRAGKGRAAPSVDSPWSGTPDREQQREA
FT                   KRQAVLQAAAQLFNERGFSATSLDDIAARLGVSKPTLYYYVKNKDEILLQCVNQGLAMT
FT                   LEGIEASRRAGGQAVDQLRACMQVYARIVTMDFGMCLIRVGDEQVPPDSRRELRRQKAA
FT                   IDQAFRRLVAAGVQEGSLAPCDPKMTAFVIAGALSWIGRWYQPGGQYSAEEVAQQCIDT
FT                   LMGGVLRRADVLDTPKLSKPPKVGKPAKRAKAGG"
FT   gene            complement(41147..41581)
FT                   /locus_tag="Daci_0034"
FT   CDS_pept        complement(41147..41581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0034"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cu(I)-responsive transcriptional regulator;
FT                   PFAM: regulatory protein MerR; Transcription regulator MerR
FT                   DNA binding; KEGG: ajs:Ajs_0017 putative transcriptional
FT                   regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32681"
FT                   /db_xref="GOA:A9BPB7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPB7"
FT                   /protein_id="ABX32681.1"
FT                   /translation="MSAHPAQHWPVSIGEAARRAGVSARMVRHYEAQGLLPPMHRTDGG
FT                   YRQYAEADVHALRFIRRGRDLGFSMDEIATLLGLWQDKSRASSQVKAIAQRHIDELTER
FT                   IAAMQAMQRTLKTLVHCCHGDDRPDCPILDDLAAQESAAP"
FT   gene            complement(41626..41820)
FT                   /locus_tag="Daci_0035"
FT   CDS_pept        complement(41626..41820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0035"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: vei:Veis_1021 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32682"
FT                   /db_xref="GOA:A9BPB8"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPB8"
FT                   /protein_id="ABX32682.1"
FT                   /translation="MQHVFTVQGMTCGHCERAVTQAVQGVDDQAQVKIDRAAQRVEVDS
FT                   SASREALGAAIAEEGYKVA"
FT   gene            42121..43824
FT                   /locus_tag="Daci_0036"
FT   CDS_pept        42121..43824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0036"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: aav:Aave_0035
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32683"
FT                   /db_xref="GOA:A9BPB9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPB9"
FT                   /protein_id="ABX32683.1"
FT                   /translation="MNLLGMMRAFTIRTRMLGAIAMVLVLLGLLGGAGMLGMFRIHGMS
FT                   QQFMHTSYAKMGYMVELRAELGAVRAHEKDMIIQYERAEEVRKAHTQWLAAIDRVKSVA
FT                   ERFLKDEDPADDAIVSGISERVDRYRQQFEHIARQLEAGGYDTATTANRMSGKAMAEVA
FT                   EVEKLIAQLDQLLRQQVDAMAAEEQGVAEQTQWIFVAAVVLTVLVVVPLTLMNMLSICR
FT                   PLVQARQTALTIAQGDLSQSVKVEGKDEVADLQRALDQMQQSLGSMVTQVRDASGNIAT
FT                   ASQEIATGNQDLSSRTEQTASNVQETVASLSQLTATVQQTASSSQLANQLAASASTTAT
FT                   RGGDVVAQAVVSMQEITTSSRKIGDIIGLIDSIAFQTNILALNAAVEAARAGEQGRGFA
FT                   VVAAEVRSLAQRSAQAASEIKALIQTSVQAVDVGVRQVEDAGKTMKEIVDSVQRVGDII
FT                   GEITAASSEQSGGIGQVNQAVGDIDRMTQQNAALVEESAAAAESLREQAARLAQVVGQF
FT                   RIAGAAVASMGSHASYGRPSQGQPSLAPAAGRASLASGRDTRETQLLEHA"
FT   gene            complement(43930..45048)
FT                   /locus_tag="Daci_0037"
FT   CDS_pept        complement(43930..45048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0037"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   ajs:Ajs_0022 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32684"
FT                   /db_xref="GOA:A9BPC0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPC0"
FT                   /protein_id="ABX32684.1"
FT                   /translation="MTSLFDPIQAGELRLPNRIAMAPLTRNRAPQALPNDIMVTYYAQR
FT                   ASAGLLISEGTAISHQGQGYAHVPGLYGSEQLDGWKRVTDAVHKAGGRIVTQLWHVGRV
FT                   SHTSLQPEGQAPVGPSPVAAKSKTYVIDEDSGKGQFVPTSAPRALAQHELPAIVHSFAV
FT                   AARNAVETAGFDGVELHGANGYLLDQFLKTGANQRDDDYGGSIENRARLLLECTRAAAD
FT                   AVGGGRVGIRLSPVTPANDIADADPQPLFEYVVRQLAPLGLAYIHIIEGATGGPRELPD
FT                   RPFDYAALKSAYREAGGQGAWMVNNGYDRDMALRAVENGHADIVAFGKAFISNPDLVHR
FT                   LRDDLPLNPWNSSLFYGGGAEGYIDYPFARQA"
FT   gene            complement(45130..45711)
FT                   /locus_tag="Daci_0038"
FT   CDS_pept        complement(45130..45711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0038"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   azo:azo2988 probable chromate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32685"
FT                   /db_xref="GOA:A9BPC1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPC1"
FT                   /protein_id="ABX32685.1"
FT                   /translation="MDIIGLCGSLRRHSLNRLLLELAGECLPPQATMQVCDWRALPPLD
FT                   ADLLATGMPASVHQLRERIRRADAVVLATPEYNFSIPGMFKNALDWISRGDDQPFRHKP
FT                   VALVSASPGPLGGARVQYELRKVLQCMEADVLARPEVFVGQATQKFDSQGLCTDAATRS
FT                   FVTAQMQALGRLVAQHRRLHDSAQIPGLHD"
FT   gene            complement(45716..46690)
FT                   /locus_tag="Daci_0039"
FT   CDS_pept        complement(45716..46690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bja:blr3080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32686"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPC2"
FT                   /protein_id="ABX32686.1"
FT                   /translation="MTAITRRTALLAGAASLSLSTARAQGGFPSRPIQLIHGFGAGGNA
FT                   DVVARLVAQKLQESLRQPVVVEIKSGAGGSIASNFVAKAVPDGYSLVMLTGAHTVSAAL
FT                   RKSLPYDAVKDFAFVSTVSSFPFVVAVRAEHPARTLADLLAMARKEPGRITFTSVGVGS
FT                   TQHMAGELLGSTAKVQLLHVPYRGGGAPVQAVIAGDVDVLSDTLTVAMPHIKSGRLRAL
FT                   AVTSAQAWPTLPEVPPASAVLPGFEVHSWLGLAAPAGTPADVVQRLAAEAHKALKEPDL
FT                   LQALASAGSAATPCSPEEMRAMVGAEIARWRGVIQQVGIPLQA"
FT   gene            complement(46791..47342)
FT                   /locus_tag="Daci_0040"
FT   CDS_pept        complement(46791..47342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0040"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: eli:ELI_06420 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32687"
FT                   /db_xref="GOA:A9BPC3"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPC3"
FT                   /protein_id="ABX32687.1"
FT                   /translation="MLCKKLHHAAYRCKDAAETVRFYTEVLGLRFTHAMGEDHVPSTGQ
FT                   YSPHIHIFFEMEDGSSIAFFECPRDPGQMKDMESPGWIQHFAFEVADVDTVLRARQDLL
FT                   DRGIDVVGPTNHDDFITSIYFFDPSGHRLELTARTADAARHQVFEQEAMQVLALWNETH
FT                   DWSQREKLYGAQTGYARADR"
FT   gene            complement(47355..47741)
FT                   /locus_tag="Daci_0041"
FT   CDS_pept        complement(47355..47741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0041"
FT                   /product="NIPSNAP family containing protein"
FT                   /note="PFAM: NIPSNAP family containing protein; KEGG:
FT                   rsh:Rsph17029_3880 NIPSNAP family containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32688"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPC4"
FT                   /protein_id="ABX32688.1"
FT                   /translation="MLVEQRTYTAHPGKWRDYMALYQTEGLELQQRILGRMVGYYTSDS
FT                   GPLNQIVHLWAYTDLNERAERRARLLAEPRWQAYVARMLPLLQSQESKFLVPAPFFQPQ
FT                   WSGCQEPLHGATGPASASGPLSTD"
FT   gene            complement(47755..48510)
FT                   /locus_tag="Daci_0042"
FT   CDS_pept        complement(47755..48510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0042"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: swi:Swit_1570 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32689"
FT                   /db_xref="GOA:A9BQI7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQI7"
FT                   /protein_id="ABX32689.1"
FT                   /translation="MMQLSHPPLQDRIAVVTGASSGIGAATARALAREGATVVIGYHQG
FT                   RDRAQALREELPGSHHTLQLSLQDEASHATAAQWLQQHLGRVDLLVNCAGFTERIAHAQ
FT                   IDALEPALFNRILCANVGGTYAVTRALLPLLRASQDAAVVNVSSVSAFTGLGSNMAYCA
FT                   AKAALDTLTVSMARAFGPVRFLCVSPAAVDTGFVEGRSRQELEKKAAHTPLGRVVEPGD
FT                   VAQAILACATHLRTATGTRIVIDGGHSLG"
FT   gene            48625..49398
FT                   /locus_tag="Daci_0043"
FT   CDS_pept        48625..49398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0043"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bpe:BP2655 putative IclR-family
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32690"
FT                   /db_xref="GOA:A9BQI8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQI8"
FT                   /protein_id="ABX32690.1"
FT                   /translation="MTSSSDAGSLKRGVAFLKLLATGGVRGCPLSELAEKSGVPHPSAH
FT                   RILKQLIAERLVVHDAQTHRYRLGPLAFELGLAGSMLHDIRDLCEPAMAALSRETEDTA
FT                   YLVVRSGFEAVCLHRLEGDFPIRTLVLQVGSRRPLGVGAGGLAVLAAIAPEEREAIIER
FT                   VAPALPAFGKLTDAGLRLACEETARAGVAVIQNRVSLGVTAVGAHFCDSMGQAMGAVSV
FT                   AALTQRMTAARVRRIAQQVRAAAAQIEQRIRTRKR"
FT   gene            complement(49470..50120)
FT                   /locus_tag="Daci_0044"
FT   CDS_pept        complement(49470..50120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0044"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ajs:Ajs_0023 glutathione S-transferase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32691"
FT                   /db_xref="GOA:A9BQI9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQI9"
FT                   /protein_id="ABX32691.1"
FT                   /translation="MGACLSYPDRKPSTMKLYYSPGACSLSPHIVLHEAGLAYEPVLAS
FT                   TKTHKLQDGTDYYGINPLGYVPFLVLDDGDTLHEGPAIVQYLADLVPEKKLAPANGTMA
FT                   RYHLQEWLNFIGTELHKGFGPLFNPATPDDYKPVVRQRVLDRLKWVDGELNGRDYLMGE
FT                   QFTVADAYLFTVTGWAQFVGVDISELTNLLAYRERVLARPAVQAAMKAEGLLK"
FT   gene            complement(50174..50761)
FT                   /locus_tag="Daci_0045"
FT   CDS_pept        complement(50174..50761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0045"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   aav:Aave_0050 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32692"
FT                   /db_xref="GOA:A9BQJ0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQJ0"
FT                   /protein_id="ABX32692.1"
FT                   /translation="MAAMQILIFAGSTRQQSHNRRLAAAAAGMARELGAQPTLLELSDF
FT                   DIPMYNADLEASGTPPDVLRFKAALHSHPAWLICSPEYNGSYPALLKNAIDWASSPVAG
FT                   DPVWSDGTLPFRGKVVGMASASPGGLGGLRAQSHLAPLLLNLQCWLAPVSHAVGQAGQA
FT                   FDDAGRLQRPQDQLGMKAVLEQVLWAAQRLSA"
FT   gene            51062..53041
FT                   /locus_tag="Daci_0046"
FT   CDS_pept        51062..53041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0046"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: aav:Aave_0051
FT                   glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32693"
FT                   /db_xref="GOA:A9BQJ1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BQJ1"
FT                   /protein_id="ABX32693.1"
FT                   /translation="MLYPQEFDVIVVGGGHAGTEAALAAARMGCRTLLLSHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMALATDIGGIQFRILNSSKGPAVRATRAQADRILY
FT                   KAAIRDMLENQPNLWLFQQAVDDLMVEGDRVVGAVTQVGVRFRSRTVVLTAGTFLDGKI
FT                   HVGLNNYAAGRAGDPPAVSLSSRLKELQLPQGRLKTGTPPRLDGRSIDFSQCEEQPGDG
FT                   MPGGVNEGVLPVFSFIGNAAMHPRQMPCWITHTNERTHDIIRSGFDRSPMFTGKIEGVG
FT                   PRYCPSVEDKINRFADKESHQIFLEPEGLTTNEFYPNGISTSLPFDIQYELVRSMKGLE
FT                   NAHILRPGYAIEYDYFDPRSLKSSFETRQIQGLFFAGQINGTTGYEEAAAQGLFAGLNA
FT                   ALQCRGQEAWLPRRDEAYLGVLVDDLITKGVTEPYRMFTSRAEFRLQLREDNADMRLTE
FT                   AGRAMGLVDDARWDAFSRKRDAVSRETERLKSTWVNPRIVTPEESERVLGKSIEREYNL
FT                   FDLLRRPDVGYGKLMSLNEGRYASADVQPDVLGDLSASVVEQVEIAAKYAGYIDRQKDE
FT                   VQRAAHFENLRLPAELDYMQVPALSFEVRQSLQKHRPETLGQASRMSGVTPAAISLLMV
FT                   HLKKGGFRGFAPDVTDAKGEEASA"
FT   gene            53038..53697
FT                   /locus_tag="Daci_0047"
FT   CDS_pept        53038..53697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0047"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: ajs:Ajs_0027
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32694"
FT                   /db_xref="GOA:A9BQJ2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQJ2"
FT                   /protein_id="ABX32694.1"
FT                   /translation="MSQELRAPLEAGLQALGLDLTPAQIDTLMEFQALLGKWNKVYNLT
FT                   AVRDPQEMLTHHLLDSLAAVPALQRHLAQMPAREGRTAMLDVGSGGGLPGVVFAICCPQ
FT                   IDVHCVDTVGKKAAFIQQAAATLRLPNLRGIHSRVEQLTTRYPLISCRAFASLADFTSW
FT                   SRQALEEGGTWLAMKGKHPDDEIAALPADVQVFHVEPLKVPGLDAERCILWLRVCA"
FT   gene            53804..54418
FT                   /locus_tag="Daci_0048"
FT   CDS_pept        53804..54418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0048"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   ajs:Ajs_0028 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32695"
FT                   /db_xref="GOA:A9BQJ3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQJ3"
FT                   /protein_id="ABX32695.1"
FT                   /translation="MFGISDFSAFVVAILLFLLIPGPGNLALITSTGKGGIRAGMAACA
FT                   GVLAADQVLIWMAVAGVAALLASYPTAFHAVQWLGAAYLGWLGFRMLTAKPGDKPVLHI
FT                   EPRHYFRQAGLITLMNPKSIVFYMAFFPLFVDPASHQGLLTFAVMAATVAALTFLYCLI
FT                   VVLLTAHLAERMRANPAVSRVLEKTAGVFLIGFGLKLAIAK"
FT   gene            54432..55202
FT                   /locus_tag="Daci_0049"
FT   CDS_pept        54432..55202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0049"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   ajs:Ajs_0029 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32696"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQJ4"
FT                   /protein_id="ABX32696.1"
FT                   /translation="MAKIFCVANQKGGVGKTTTAVNLAAGLAKVGQRVLMIDLDPQGNA
FT                   TMGSGVDKRALELSVYDVLLENASVKEAAVRSEAVGYDVLGANRELSGAEIELVTLERR
FT                   NDRLKGALKAVDADYDFVLVDCPPSLSMLTLNGLCAAHGVVVPMQCEYFALEGLTDLVN
FT                   TIKQVHANMNPDLQIIGLLRVMFDPRTTLQQQVSDQLKEHFGDKVFDTVIPRNVRLAEA
FT                   PSYGVPGVVFDPGAKGSKAFIDFAHEMVRRIKKM"
FT   gene            55374..55934
FT                   /locus_tag="Daci_0050"
FT   CDS_pept        55374..55934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0050"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   aav:Aave_0055 protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32697"
FT                   /db_xref="GOA:A9BQJ5"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQJ5"
FT                   /protein_id="ABX32697.1"
FT                   /translation="MAEQTMQIDVTAEDVWLLPGWQNSDADHWQSRWEQRHGYRRLEQN
FT                   DWDRPLRGDWSARLQETVLDAPRPVVLVAHSLGCILVAWWAAHSPLAARKVRGALLVAP
FT                   GDTEQPQLREQLPGWSPVMMQRLPFASIVVGSDNDIYCSAQRVQAMADAWGARFVDAGP
FT                   SGHLNTASGLGDWDSGHALLASL"
FT   gene            55948..56883
FT                   /locus_tag="Daci_0051"
FT   CDS_pept        55948..56883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0051"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: aav:Aave_0056 ParB-like
FT                   partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32698"
FT                   /db_xref="GOA:A9BQJ6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQJ6"
FT                   /protein_id="ABX32698.1"
FT                   /translation="MVTKKPKGLGRGLEALLGPKVHDKEEGGGPVAETGLPSILQLDVM
FT                   VPGQYQPRTHMDEGALYELAESIKAQGIMQPILVRRLAKGDHAGKYEIIAGERRFRAAR
FT                   IAGLAEVPVLVREVPDEAAAAMALIENIQREDLNPLEEAQGLSRLVKEFGLTHEQAAQA
FT                   VGRSRSAATNILRLLNLADPVQTMLMAGDIDMGHARALLSLDRAAQITAGNQIAAKKLS
FT                   VREAEALVKKIGADFSLVRQKSKKDGKSRDIKRVEEELSDLLMADVEVRIKKSVRRGGK
FT                   LQEMGEVAIQFGSLDALNGLIERLRGDASE"
FT   gene            57079..58113
FT                   /locus_tag="Daci_0052"
FT   CDS_pept        57079..58113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0052"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   aav:Aave_0066 peptidoglycan-binding domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32699"
FT                   /db_xref="GOA:A9BQJ7"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQJ7"
FT                   /protein_id="ABX32699.1"
FT                   /translation="MKKYLALTAIAAVALTGCVTTDMRMGSPEAKTVATGAAGGASAEN
FT                   ANTELERCDSSLGTISLVENQTAGWYTILTQQYRLPPTSQLLRLMIQQSNCFIVVERGA
FT                   AGMGAMARERALMDSGEMRGGSNLGKGQMVASDYGLSPEVIFNQSDAGGMGGAIGGRAG
FT                   GIFGALAAATKTREASVMLALVDNRSGVQVSASEGSSSKTDWGGMGALFGGSAGASLGG
FT                   YTRTAEGKVIAAAFMDAYNQMVRALRNYKAQTVKGQGLGGGGRLGVDGGAAPSQTSAPG
FT                   ANAAGMSLRAAQQKLNALGYTAGTPDGSMGKNTQNALREFQRDQSLPQTGRLDRATSQA
FT                   LQQQ"
FT   gene            58302..59123
FT                   /locus_tag="Daci_0053"
FT   CDS_pept        58302..59123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0053"
FT                   /product="methyltransferase type 12"
FT                   /note="KEGG: ajs:Ajs_0032 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32700"
FT                   /db_xref="GOA:A9BQJ8"
FT                   /db_xref="InterPro:IPR026170"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQJ8"
FT                   /protein_id="ABX32700.1"
FT                   /translation="MRRLPWPAPALLAWAGAWLVYAALQSTLGPLAAWLAACFLGVLAS
FT                   LLATPWWRRLAVAAGFPLSCLMLWGPGGLAAISPWLWLAALGLLTLVYPLNAWRDAPLF
FT                   PTPTDALQGLADAAPLPDGAAVLDAGCGLGDGLRALRGQYPQARLNGMEWSWPLRWLCA
FT                   LRCPWARVRRADIWLADWSSYQMVYLFQRPESMGRAAVKAATELPEGAWLVSLDFALPG
FT                   VEPSWQRQGPGRHSLWLYRMPLGGAGEAVVHVPEPEETPYEKALRELQERR"
FT   gene            complement(59137..59484)
FT                   /locus_tag="Daci_0054"
FT   CDS_pept        complement(59137..59484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0054"
FT                   /product="cytochrome c, class I"
FT                   /note="KEGG: ajs:Ajs_0034 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32701"
FT                   /db_xref="GOA:A9BQJ9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQJ9"
FT                   /protein_id="ABX32701.1"
FT                   /translation="MFTMKHLVHTALLGSTLLGSALLSAPAFADEAAQMALGKKLFATA
FT                   TPACALCHTLKDAGAEGAIGPVLDELKPDAARVARALRDGIGAMPSFKATLSEADIAAL
FT                   SLYVSKASAKK"
FT   gene            complement(59571..60824)
FT                   /locus_tag="Daci_0055"
FT   CDS_pept        complement(59571..60824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0055"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; Mo-co
FT                   oxidoreductase dimerisation domain; KEGG: ajs:Ajs_0035
FT                   oxidoreductase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32702"
FT                   /db_xref="GOA:A9BQK0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQK0"
FT                   /protein_id="ABX32702.1"
FT                   /translation="MNHLPTSPTSPARRSLLAGSASALAAAGLAGLHQGALAQAQAQAQ
FT                   APAAAAAPVAKPLPGYAGWKKADALIVHSSTTIETRRGAFGTSVITPSDQLYVRNNLPT
FT                   PPESIVADRDAWQLQVEGVRQPRSLSLRELKSLGLETVAMVLQCSGNGRAFFPSKPSGT
FT                   AWTVGAAGCVIWSGVPVREVVKALGGVSDGGLYMTGTGGEVLPAGLDPKSVIVERSVPL
FT                   SAMEDALLAWEMNGEPIPLAHGGPLRLIVPGYTGVNNIKYIKQLAFTPRESEAHIMSHG
FT                   YRISPPGSKGDPSQPSVQEMSVKSWINSPLPEDGGQAAGLVQIHGVAFGGMDAVKGVEV
FT                   STDGGKSWQAARLVGPDLGKYAWRQFVLQARLPKGTHVLASRATDARGRVQPETRGENQ
FT                   SGYNNTSWADHAVTVTVA"
FT   gene            complement(60896..61483)
FT                   /locus_tag="Daci_0056"
FT   CDS_pept        complement(60896..61483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32703"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQK1"
FT                   /protein_id="ABX32703.1"
FT                   /translation="MTAPDTTDESAFDLRARAELALAFDPGPHGEPPAHLLRHTPWHAR
FT                   SGVRRLIAALLVGSSAATAVFAMRPPELVRAAIEHEYYERTLRGSFMPEAEVARRMDLP
FT                   AGEKLPGYTQLMRPCDIDGTRAYHLTTFFEKGGIVTVLAFDQPQRLADGQGWWANMHWQ
FT                   VVRSREGRPLVLVAQKKQALAVASKALGTPAP"
FT   gene            complement(61480..62070)
FT                   /locus_tag="Daci_0057"
FT   CDS_pept        complement(61480..62070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0057"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   ajs:Ajs_0037 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32704"
FT                   /db_xref="GOA:A9BQK2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQK2"
FT                   /protein_id="ABX32704.1"
FT                   /translation="MLLCRMISTAESRYNQWVREHYRFLLRSAWALTGSRALAEDVVQD
FT                   CFTSAWRFRHQLREAAMARAWLFQIMRRHAFRHLAPSAHLVSDDEALDQHPAPTPSPSA
FT                   LDDRLDVVKALARIAPIHREVLVLYYFDDMPTAQMAEALDIAPGTVLSRLSRARDALKA
FT                   ALEQAAPAPAPETASVIPLRPTPLRATRYQGLK"
FT   gene            complement(62127..63056)
FT                   /locus_tag="Daci_0058"
FT   CDS_pept        complement(62127..63056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0058"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AraC protein arabinose-binding/dimerisation;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: aav:Aave_0082 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32705"
FT                   /db_xref="GOA:A9BQK3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQK3"
FT                   /protein_id="ABX32705.1"
FT                   /translation="MEPVEALHPHLFVPTPQRPVRAKQHRLSARTRVIPHSHSWAQIAI
FT                   SLDGVLHLSAPQGTLIAPPSKAVWIPPGLVHAVAMVEEADLVSIYVLQDDPAQGPVLPD
FT                   LPSCGVACNPQDWARCRVLEVSPLMRELITALPKQSDDQPAPDAATLQREHHLSALLLE
FT                   ELRRASEVHLGVNMPQDKRLRMLCEAVVADPTQHESLADWAADTGASPRTVARLFQQQL
FT                   GCSFTTWRQQVVLAHGLSLAARGLPIQQIAAELGYSPSAFSAMVHRTVGMPPARFFGQQ
FT                   AGSAAHRVGSGAVSRPTRELLGTIASSR"
FT   gene            63263..64516
FT                   /locus_tag="Daci_0059"
FT   CDS_pept        63263..64516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0059"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   aav:Aave_0083 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32706"
FT                   /db_xref="GOA:A9BQK4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQK4"
FT                   /protein_id="ABX32706.1"
FT                   /translation="MPDAVAPDPLRSDVRTIGLIGLAHGSSHFFHLLLPPLFPWLIAEF
FT                   GYSYAELSVMVSLFFVVSGVGQAMAGFAVDRFGARPILFAALGSFTVAGVVASLAQGYG
FT                   MLLLAAFFAGLGNAPFHPVDFTILNKRVSAKRIGHAFSVHGLSGNIGWALAPLFMAGIT
FT                   TATGSWRLACLCGAALAAVILTIMVLNREALDDRAADAHAPAARAAAAAVPQEHPMAFL
FT                   KLPSVWLCFSFFFWSTCALSAIQSFASPAMQSMYGLPLSVTALIVTGYMLCGAAGMLAG
FT                   GFLVGRVQRLEKVISICMLGSGVALFLVGTGWLPAMAAVAVASIAGLGTGLAGPSRDML
FT                   IKRAAPPGATGRVYGTVYSGLDLGFCLAAPVFGYMLDHGMSHGVFYGSAIALVLSVVSA
FT                   VVVGDGVSKKGGMALSAG"
FT   gene            64674..65963
FT                   /locus_tag="Daci_0060"
FT   CDS_pept        64674..65963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0060"
FT                   /product="Glutamate carboxypeptidase"
FT                   /EC_number="3.4.17.11"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: bja:bll3749 glutamate carboxypepticase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32707"
FT                   /db_xref="GOA:A9BQK5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQK5"
FT                   /protein_id="ABX32707.1"
FT                   /translation="MRSAFAPLSLMFRSAPLALALAMAGLSGSALAAPKADIQALAQKH
FT                   QQPLLDTLRDLVHIESGSKDMEGVEQIANYVAGKLREQGGKVEILQPTDVYRLGDTPEK
FT                   IGPMVHAEFKGKGTSRIMLIAHMDTVYLRGMLKDQPFRIDGERAYGLGIADDKQGVALI
FT                   LHTVAMLRQLGFDNYGTLTVLMNSDEEISSPGARSTITRMGAEQDAVFSFEGGGTDGGV
FT                   RLATSGIGAAYLKVEGKASHAGAKPEDGVNALYELSHQLLQMKDLSKPETGLKLNWTVA
FT                   KAGTNRNVIPAEATAQADARALRVADFTALEQAMQAKVGHKLLDASKVQLKFEVRRPPL
FT                   EANEASRSLAKQAQTIYSDELGLKMSVMEKATGGGTDAAFAALKAKGAVIEGFGLSGYG
FT                   AHSNDAEYVQLNTIVPRLYLATRMIMDLSK"
FT   gene            complement(66152..67153)
FT                   /locus_tag="Daci_0061"
FT   CDS_pept        complement(66152..67153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rme:Rmet_1755 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32708"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQK6"
FT                   /protein_id="ABX32708.1"
FT                   /translation="MTSTPFQASRRQILSAACATAIATLAPAARAQSQWPDKLIKLTVA
FT                   FPPGGPTDTAARIVAQRLTERLGQTIVIDNRPGASGSVGTAAFIKSQPDGYSLSMFGMP
FT                   ALLAPMLFNNNLYDVRKDFLPVATVYDLPMAIVINPRELPDVTNLQQLIEHARKAKPAL
FT                   NYTSSGTGSFGHLSMEQLKDLGGFDMQHVPYRGSAPAVTDLIGGQIAVMFADVVAALPH
FT                   IQAGKLRAIAVSSQKAKQLLPNVKSVAEQGFPGFDADTWGGLIAPLNTPPAVVQRLNQE
FT                   LKLILAEPELQKKMLAAGAIATYQDGAAMKARLNADFTRWSKIAKDKNISSQ"
FT   gene            complement(67225..68433)
FT                   /locus_tag="Daci_0062"
FT   CDS_pept        complement(67225..68433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0062"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rme:Rmet_1756 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32709"
FT                   /db_xref="GOA:A9BQK7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQK7"
FT                   /protein_id="ABX32709.1"
FT                   /translation="MSALPSSLPLDGVRVLDLSRVLAGPMCAMALADLGADVVKVEHPG
FT                   RGDDTRDWGVRVGQRNTSYFNSANRNKRSVTLDLQAEEGLRIARELAADSDVVIQNFKV
FT                   GGAEKLGLGYEQLSQLNPRLVYCSISGYSRSGPEATRPGYDLVVQGESGIMAMNGEQGQ
FT                   GPLKFGVAAVDMFTGMYSAQAILAALYERERSGRGRHVQMALYDCGLMITSYYGMEALL
FT                   KAGDPPKFGNAHPSIVPYGVFEAADGPLVITVGNNGQFQRFCTDVIAKPEWAADERFAT
FT                   NTARSANRELLMPLVQAELLRFTRAQLLECLTAAQIPCGEVLGLFEALNSQRTADAGLL
FT                   HRFEDSEAGSQSVLAPPYALDGQRLPVRRPPPHQGEHTDEVLQQRLGLDEQARAALRAK
FT                   NII"
FT   gene            68563..69468
FT                   /locus_tag="Daci_0063"
FT   CDS_pept        68563..69468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0063"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rme:Rmet_1757 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32710"
FT                   /db_xref="GOA:A9BQK8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQK8"
FT                   /protein_id="ABX32710.1"
FT                   /translation="MDLGGLSLLVDIIEAGNLSRAAVRLGMSRANVSHRLNQFERQIGQ
FT                   QLLRRTTRQVEPTELGLRLYAHGRAIRQEAMAADESVDSLGQSLQGTVRLSVPSGYGQL
FT                   QMSGWLTEFMRMHPGITLEVIFDNDIEDLMQGAVDFAVRVMTEPPESLVACKLGDVLYE
FT                   ACATPQFLAQHGQPDSLLALKRVPLITSALTGQKLRTAGMNGARPTELRIRPRLMSPNF
FT                   HFLRDAVLQGLGVAVVPRYMVAAELASGALERLPLPPGSLDFLATRQYLLYMPSHYQTR
FT                   AITTLIDFLREKAAAEGLRG"
FT   gene            complement(69458..70882)
FT                   /locus_tag="Daci_0064"
FT   CDS_pept        complement(69458..70882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0064"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   aav:Aave_0095 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32711"
FT                   /db_xref="GOA:A9BQK9"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQK9"
FT                   /protein_id="ABX32711.1"
FT                   /translation="MNAPVAPVRLQPDFAQRPIPEAFLQALAQRFGAQCSTALAVREQH
FT                   GRDEGAIQAPPPAAVVFAESTQDVQDALKLADQHAVPVIPYGAGSSLEGHLLAVEGGIS
FT                   LDLSRMNRILSVNAEDLTVTVQPGITRKQLNDAIKDTGFFFPIDPGADASIGGMTATRA
FT                   SGTNAVRYGTMRENVLALELVTASGELMRTGTRAKKSSAGYDLTRLIVGSEGTLGVVTE
FT                   ITVRLYPLPEAVSAAICSFPSIEAAVRTVIQTIQMGVPIARVELVDVNSVRMVNAYSKL
FT                   TLREEPMLLMEFHGSPTGVKEQAEMVQDIAGEFGGNAFEWAERPEDRTRLFTARHNAYF
FT                   AAVSSRPGCRCITTDACVPISRLADALLDSVREADDSGIPYFLVGHVGDGNFHFGYLID
FT                   PDNEDERSRAEQLNHQLVSRSIALGGTCTGEHGVGIHKMDFLREEAGDGAVQMMRSIKQ
FT                   ALDPKNILNPGKIFSL"
FT   gene            complement(70965..71333)
FT                   /locus_tag="Daci_0065"
FT   CDS_pept        complement(70965..71333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0065"
FT                   /product="putative signal transduction protein with EFhand
FT                   domain"
FT                   /note="KEGG: ajs:Ajs_0042 calcium-binding
FT                   EF-hand-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32712"
FT                   /db_xref="GOA:A9BQL0"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQL0"
FT                   /protein_id="ABX32712.1"
FT                   /translation="MTSQLRKVSGFEIRSVMLFAAISLGSVAAMAQTSTPAAPPSQASF
FT                   GAGSGPATGVQAAPTPSSAGANDVQAAFDRADTNRDGKLSKKEAEALPAVSSNFAQIDA
FT                   DKNGSLSRDEFSKAVQPR"
FT   gene            71515..72087
FT                   /locus_tag="Daci_0066"
FT   CDS_pept        71515..72087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0066"
FT                   /product="ATP--cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP--cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: ajs:Ajs_0043
FT                   ATP--cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32713"
FT                   /db_xref="GOA:A9BQL1"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQL1"
FT                   /protein_id="ABX32713.1"
FT                   /translation="MGNRLTQIATRTGDDGSTGLGDNTRVSKNSGRPHAMGDVDELNSH
FT                   IGLLLCEALPDEVRELLVDVQHQLFNLGGELSIPGYELLKDDALLQLDEALAHYNAQLP
FT                   RLQEFILPAGSRAAAQAHVCRTVARRAERMVVALEQGEAMRPAPRQYLNRLSDLLFVLA
FT                   RVLNRMDGGDDVYWKSERMARAQSAEE"
FT   gene            72141..73046
FT                   /locus_tag="Daci_0067"
FT   CDS_pept        72141..73046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0067"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: aav:Aave_1935 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32714"
FT                   /db_xref="GOA:A9BQL2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQL2"
FT                   /protein_id="ABX32714.1"
FT                   /translation="MRLRHIEVFNAVMQTGSVSAAARLINITQPAVSRTLQHAELQLGF
FT                   ALFQRARGRLTPTNEALALFPHIEKLFEQLDEVQRLADNLRHGQAADRLTVLTVFALSR
FT                   EVLPRAVAGFRRRHPQVQVHVQALHTPQVVSALLLQEADVGFVISSVGQPALEHELLAE
FT                   VDMFCVLPKGLLPPSRVREEGMELKDLAELPVVALDARDPLGMRLGQACREHGVGLSPV
FT                   VTVQTYHAALSMAEYGLGAAIMDGCTALAADRRKVHVVPLLPRITVGVNALSLPQRPGS
FT                   VLARAMTEEMRKALRELLAG"
FT   gene            73214..74146
FT                   /locus_tag="Daci_0068"
FT   CDS_pept        73214..74146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mag:amb0959 uncharacterized membrane-bound
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32715"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQL3"
FT                   /protein_id="ABX32715.1"
FT                   /translation="MRNSGALRPRWQVVAWACAALAFAGGLALIFFAEPAPEVRHAQVS
FT                   ATKPPAQASRPAAPAPETPAPPAIASVPAPVPVAPLTTPRAKAFPAVVVDASAEILYNR
FT                   LARSEVTLDQAGEVAKLHKALEPCWMASLYERMALLVPPDSDPKGHAMAQRLAREQRAS
FT                   ARPGCGQLPMDAYTRADEWTARLAVQGDPQSMMDYGGAYWTRGLEHARTDPERLAEYRR
FT                   TTLIYLNALIDQGYVDALISMASIRSNPTWGEPQPAEVWAYVYADAKAKGNVSSQANLL
FT                   QSIDQRVPPEGRQRARDMAQELLRRCCGG"
FT   gene            complement(74836..76071)
FT                   /locus_tag="Daci_0069"
FT   CDS_pept        complement(74836..76071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0069"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pol:Bpro_1999 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32716"
FT                   /db_xref="GOA:A9BQL4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQL4"
FT                   /protein_id="ABX32716.1"
FT                   /translation="MHVCIVGAGIVGLATAWALQQAGHRITVLDRAPGPAQGASGGNGA
FT                   QLSYSYVQPLADPGIWKMLPRLLLEKDSPLAFRLRADPAQWAWGLRFLGACNAHASAEG
FT                   TRALLALAAESRQAFESLQADEALACDLHTPGKLVLYPTQQALDAAAQQVALQAGLGGA
FT                   PQRIVNAAEVSRIEPALAGYAQRIAGAVHTPSEAAADCRLLCEQLAARLTARGAELRYG
FT                   VELQGFEREGDAITGLRTAAGPLPLRADHYVLASGWESAVHARQLGLRIPVYPLKGYSI
FT                   TADAAAQLPHAAPRVSVTDTARKVVFARIGERLRVAGMVEIVGRDTRTDPRRIASLRRS
FT                   TQEVFADLPLDGNLHPWTGMRPATPTGLPLTGRQRGGPRNLWLQTGHGALGLTLAFGSA
FT                   QRLVGQMEADDL"
FT   gene            76294..77175
FT                   /locus_tag="Daci_0070"
FT   CDS_pept        76294..77175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0070"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: vei:Veis_4737 extracellular solute-binding protein,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32717"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQL5"
FT                   /protein_id="ABX32717.1"
FT                   /translation="MQLHTTALCAALALGGLAAAHADTLAKVRDSGRITLAYRESSVPF
FT                   SYLDNGKPIGMTVEMSQAVAEAVKKAVNRPDLKVQWQAVTSQNRMPLLANGTIDLECGS
FT                   TTNNTVRGKEVAFAINHFYTGTRLLVKKSSGIKNYADLKDKTVAITTGTTNLQVLRKAN
FT                   ADKAWGMNIVMAKDHADGFLLVENDRAAAFGMDDILLFGLIPTAKNPGDFEVVADSLQV
FT                   EPYACMLRKDDPQFKQLVDGVIGDMMKSGAFARLYDKWFMQPIAPRNVALGLPMSEQLQ
FT                   KNLQDLSDKPAF"
FT   gene            77190..77951
FT                   /locus_tag="Daci_0071"
FT   CDS_pept        77190..77951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0071"
FT                   /product="aspartate racemase"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; KEGG: vei:Veis_4736 aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32718"
FT                   /db_xref="GOA:A9BQL6"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQL6"
FT                   /protein_id="ABX32718.1"
FT                   /translation="MQQQLQPPRAVGILGGMGPAAGADFVRLFVQACTAHLQQQGLPVH
FT                   DQAYPEHWLVQLPMPDRSAALRADPQSPTGPAQHLLQGVGRMAALGVRSVALACNTAHA
FT                   WHGQLQALFPQLHVLHIARQAALHLQAGGAQQAIVLATQGTYDSGLYDAALAECGITAL
FT                   QPDAQGRARLMQGIYDGVKQGDMDLAARCFGEVLAPLLQRHGDVPVIMGCTEIPLALPQ
FT                   SPLARGAGLVDPAWILAQALAGDAYGPVAIQ"
FT   gene            complement(77945..79264)
FT                   /locus_tag="Daci_0072"
FT   CDS_pept        complement(77945..79264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0072"
FT                   /product="benzoyl-CoA oxygenase/reductase, BoxA protein"
FT                   /note="TIGRFAM: benzoyl-CoA oxygenase/reductase, BoxA
FT                   protein; PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   vei:Veis_0734 oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32719"
FT                   /db_xref="GOA:A9BQL7"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR015701"
FT                   /db_xref="InterPro:IPR017634"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQL7"
FT                   /protein_id="ABX32719.1"
FT                   /translation="MTVALVEHGILTQHLIDPEICIRCNTCEATCPVGAITHDDRNYVV
FT                   LAEQCNGCMDCVSPCPTGAIDNWRKVPLASAYPVAEQLLWDELPEELPPEVLVQAQDAG
FT                   DASAAEDLSQAQAVIAAAATRGADASRPDDQADTQVLRSASYGATVPPWSAAHPYTNLH
FT                   GPRSPVTATVVGNLNCTEAGFDSETHHIVLDFGSQPFPVLEGQSIAVIAPGTDAQGRPH
FT                   VARQYSVASARNGERPGYNNLALTVKRVTQDHQGRPVRGVASNYLCDARIGDRVQVIGP
FT                   FGQSFLMPNHPRSHIVMICTGTGSAPMRAMTEWRRRLRRSGRFEGGKLMLFFGARTPQE
FT                   LPYFGPLQSLPRDFIDNNLAFSRVAGQPRRYVQDLLRERAADLAALLRDDNAHFYVCGL
FT                   KSMEEGVVLALRDVAQQAGLDWEQVGARLKREGRLHLETY"
FT   gene            complement(79291..80718)
FT                   /locus_tag="Daci_0073"
FT   CDS_pept        complement(79291..80718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0073"
FT                   /product="benzoyl-CoA oxygenase component B"
FT                   /note="KEGG: pna:Pnap_2943 benzoyl-CoA oxygenase component
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32720"
FT                   /db_xref="GOA:A9BQL8"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR017635"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQL8"
FT                   /protein_id="ABX32720.1"
FT                   /translation="MSAINYSEKIPNNVNLGEDRTLQRALESWQPNFLNWWGDVGPEGS
FT                   TDYDVYLRTAISVDPQGWAQFGHVKMRDYRWGIFLNPAEADRKVHFGDHAGEKAWQDVP
FT                   GEHRANLRRIIVTQGDTEPASVEQQRHLGLTAPSMYDLRNLFQVNVEEGRHLWAMVYLL
FT                   HKHFGRDGREEAEALLERQSGDENNPRILGAFNEKTPDWLSFFMFTYFTDRDGKFQLAA
FT                   LAESAFDPLARTTKFMLTEEAHHMFVGESGVSRVLQRTCQVMNELRTDDVGRLRAAGVI
FT                   DLPTLQRYLNFHYSVTIDLFGADQSSNAATFYSSGLKGRYEEGKRADDHRLHDQHYKVL
FT                   EVVDGRLQEKEVPMLNALNEVLRDDYIKDSNAGVGRWNKVMEKAGIDFRLTVPHKAFNR
FT                   QIGALAGVRMSPDGRVVSEQEWRMREGEWLPTDADRAFVASLMGRCVEPGQFAGWIAPP
FT                   VMGINRQPVDFEYVRFN"
FT   gene            complement(80757..82427)
FT                   /locus_tag="Daci_0074"
FT   CDS_pept        complement(80757..82427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0074"
FT                   /product="benzoyl-CoA-dihydrodiol lyase"
FT                   /note="TIGRFAM: benzoyl-CoA-dihydrodiol lyase; PFAM:
FT                   Enoyl-CoA hydratase/isomerase; KEGG: vei:Veis_0732
FT                   enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32721"
FT                   /db_xref="GOA:A9BQL9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR017633"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQL9"
FT                   /protein_id="ABX32721.1"
FT                   /translation="MHPSSPTVDYRTEPAQYRHWSFTVEGAIARMQLNIAEDGGIRPGY
FT                   KLKLNSYDLGVDIELHDALNRIRFEHPQVRTVIVTSGRDRIFCSGANIFMLGVSSHAWK
FT                   VNFCKFTNETRNGIEDSSRHSGLKFLAAVNGACAGGGYELALACDDIVLIDDRSSSVSL
FT                   PEVPLLGVLPGTGGLTRVTDKRHVRHDLADIFCTSVEGVRGQRAVDWRLVDAVAKPAQF
FT                   EAVVAQRAQRLAEGSTRPANAQGITLTRLEREATDDALHYRHVSVQIDRARRSATLTVK
FT                   APTLGQGPQPATIEAIEQAGDAWWPLAMGRELDDAILHLRTNELDVGTWLLKTEGDAAA
FT                   VLAADAALLAHQDHWLARETLGLLRRSFARLDVSSRTLFALIEPGSCFVGMLAELAFAA
FT                   DRAYMLVLPDDTERAPRIQLDEFNFGLLPLVNDQSRLQRRFYEEAAPLEAARAATGRAL
FT                   DGDQALALGLVTAAPDDIDWDDEIRIAMEERAAMSPDALTGLEANLRFASRENMVTRIF
FT                   GRLSAWQNWIFNRPNAVGDKGALKLYGTGQKAGFDFNRV"
FT   gene            complement(82621..83535)
FT                   /locus_tag="Daci_0075"
FT   CDS_pept        complement(82621..83535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0075"
FT                   /product="transcriptional regulator, XRE family with
FT                   shikimate kinase activity"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; helix-turn-helix domain
FT                   protein; KEGG: pna:Pnap_2945 shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32722"
FT                   /db_xref="GOA:A9BQM0"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQM0"
FT                   /protein_id="ABX32722.1"
FT                   /translation="MDQFETAAQSAGAADSLSEAPRNQVLQALGERVRSLRSRRGMTRR
FT                   ALAAAADVSERHLANLEYGTGNVSVLVLHHIAQALQCSMAELLGDVTTTSAEWLLIREL
FT                   LEGRNEEDLRRVRLAAGELLGTAPSDRQRHTRIALIGLRGAGKSTLGRMLAEQLGVPFL
FT                   ELNQEIERIAGCSVRAIHDLYGANAYRRYERRALEEAVQIYSDVVIATPGGIVSDPATF
FT                   NELLSHCTTVWLKAQPEEHMARVVAQGDTRPMAANPEAMDDLRSILEGRAGFYAKADHV
FT                   VDTSGQTLEQSFDQLKALFLPAR"
FT   gene            83710..85266
FT                   /locus_tag="Daci_0076"
FT   CDS_pept        83710..85266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0076"
FT                   /product="benzoate-CoA ligase family"
FT                   /note="TIGRFAM: benzoate-CoA ligase family; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: reh:H16_B1918
FT                   benzoate-coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32723"
FT                   /db_xref="GOA:A9BQM1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQM1"
FT                   /protein_id="ABX32723.1"
FT                   /translation="MIDFTQPFNFAAHLFALNEGRPGKIAYIDDHGTLSYGQLQQQAQR
FT                   MASGLLAAGIHREERVLLLMHDRHEWAVAFLGALYAGVVPVAVNTLLTADDYAYMLGHS
FT                   RAQAVLTCDALLPLLRQALDRAPNEVRHVWVAGDEAAARAAGFAPLQPWLAAQPPLPAP
FT                   APTLGDDPGFWLYSSGSTGKPKGAVHTHANPYWTAELYGGPVLGLGEGDICFSAAKLYF
FT                   AYGLGNALSFPLSVGATVLLMAERPTPEATFARWVQHRPTVFFGAPTGFAGMLASPLLP
FT                   AREQVSLRMCSSAGEALPAEIAQRFKAHFGADIVDGIGSTEMLHIFLSNRPGDIRYGTT
FT                   GKPVDGYRVELRGEDGRPVADGEVGDLFIQGPSAALMYWGNRDKTRETFQGGWLKSGDK
FT                   YVRDADGYYTYAGRSDDMLKVSGIYVSPFEVEATLMQHPAVLEAAVIGKTDADGLLKTK
FT                   SFVVLKDGCSATEAELKAFVKQRLAAYKYPRFIEFVDELPKTATGKIQRFRLREREASV
FT                   G"
FT   gene            85325..86488
FT                   /locus_tag="Daci_0077"
FT   CDS_pept        85325..86488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0077"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pna:Pnap_2950 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32724"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQM2"
FT                   /protein_id="ABX32724.1"
FT                   /translation="MNTDRKHWAVLALTASLSCGAYAQDRIKVGFMLPYSGTYAALGSA
FT                   IENGFRMFVNEQGGRLGGREIEFFKVDDESDPAKATDNVNRLIKRDKVDVLVGTVHSGV
FT                   AMAMARAAKESGTVLIVPNAGADAVTGAMCAPNIFRSSFSNWQSSYPMGVVAARQEGKK
FT                   TAMTITWKYAAGEEMTNAFKEGFEKEGGKVSKQLTVPFPNVEFQALLTEIAAARPDAVF
FT                   AFFAGAGAVKFVKDYHAAGLHKTIPLYGSGFLTDGTLEAQGEAAQGVLTTLHYADELGT
FT                   ERDRRFRSAYAQAYKLMPDVYAVQGYDAAQMLGVGLKAAGGDIAKKAEFRQAIEKATIP
FT                   SPRGDFTISKSHNPVQDMYLRKVVGKENQRMGVAIKALGDTGRGCRM"
FT   gene            86539..87411
FT                   /locus_tag="Daci_0078"
FT   CDS_pept        86539..87411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0078"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   reh:H16_A1415 ABC-type transporter, permease component:
FT                   HAAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32725"
FT                   /db_xref="GOA:A9BQM3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQM3"
FT                   /protein_id="ABX32725.1"
FT                   /translation="MDLATFLVQCLNAVQYGLLLFLLASGLTLIFGIMGVINLAHGSFY
FT                   MIGAYMAFALSPLLGQHFITMLLAGVALTVVLGYALEWAFFSYLYEREHLQQVLMTFGL
FT                   ILVFEELRSLLAGNDVHGVPLPGWLSGSFSLGGLMSYPWYRLFASGVCLLVALALYWVV
FT                   NRTRLGMMVRAGASNRDMVRGLGIDVKRLYRIVFAIGVALAALAGMIAAPMSSVYPGMG
FT                   GNVLIICFVVVVIGGIGSITGALLASLLVGFVDTFGKLFFQELSGMSVYLLMAVVLVGR
FT                   PQGLMGQRS"
FT   gene            87415..88500
FT                   /locus_tag="Daci_0079"
FT   CDS_pept        87415..88500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0079"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rfr:Rfer_0212 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32726"
FT                   /db_xref="GOA:A9BQM4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQM4"
FT                   /protein_id="ABX32726.1"
FT                   /translation="MAVSNPSPALLAAAVQPLQPVQPAEMPQRACRWQACAVPLACVAL
FT                   LALAGPWWSDYLSGLVVKTMILAIFALSLQLLVGGTGLVSLGHAAFMGLGAYAAVLSAG
FT                   NEGGSLPAMLGWALLASGGYALLVGLLSLRTRGIYFIMVTLAFAQMAYFVVHDTGIGGG
FT                   SDGIYLMARPALGAIDMEIPRVQYYVVLAALVLVYAFLAGLRQSRFGAALAGIRVNEQR
FT                   MRAAGFTTYGYKLAAFVLAGMLAGVAGFLLAVRDAVVNPELLSWHHSGEVLLMVILGGL
FT                   GSLRGAVLGTVAFIALKEVLSTHAIVGPMADHWQLSLGLAIIVLVALLPKGLMGLIGLA
FT                   GLARQRAGVHNEVHHKEAGHG"
FT   gene            88493..89251
FT                   /locus_tag="Daci_0080"
FT   CDS_pept        88493..89251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0080"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pna:Pnap_2953 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32727"
FT                   /db_xref="GOA:A9BQM5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQM5"
FT                   /protein_id="ABX32727.1"
FT                   /translation="MADAALLSVRGLTRRFGGLTAVGGVDLDLHEGEVHAVIGTNGAGK
FT                   STLVNMLSGELAASAGRIALAGQDVTRMPQPRRARAGVGRSYQRTTIFPEFSALENCRL
FT                   AAQAQMALRPWQLGLSAQRCAASVRQAHAALERAGLAGQAQAVAGTLSHGAKRQLEVAM
FT                   CLATGPRVLLLDEPLAGMGAEETERMLALLQELKRGHAVLLVEHDMDAVFRIADRITVM
FT                   VNGSVVATGTPAQIRVDPVVRTAYLGEDDD"
FT   gene            89244..89957
FT                   /locus_tag="Daci_0081"
FT   CDS_pept        89244..89957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0081"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pna:Pnap_2954 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32728"
FT                   /db_xref="GOA:A9BQM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQM6"
FT                   /protein_id="ABX32728.1"
FT                   /translation="MTEPMFAIDELHTYYGDSHILQGVSLALGAGQAVGLLGRNGMGKT
FT                   TLIRTLMGYVPARRGRLRADGRDCTGAPPERMARLGIGYVPEGRGIFPNLSVRENLVMS
FT                   ARPGLQGERHWTLERVLDTFPRLAERLANGGDQLSGGEQQMLSIGRALMTHPRLLILDE
FT                   ATEGLAPLVVAEIWRVIAAIRSTGISTLIVDRDYKKVLAHTDRAVVMAKGRLALQADSR
FT                   ELLTQPERLSELLGV"
FT   gene            complement(89990..90835)
FT                   /locus_tag="Daci_0082"
FT   CDS_pept        complement(89990..90835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0082"
FT                   /product="Domain of unknown function DUF1814"
FT                   /note="PFAM: Domain of unknown function DUF1814; KEGG:
FT                   xom:XOO_2997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32729"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQM7"
FT                   /protein_id="ABX32729.1"
FT                   /translation="MSRDIAASIRARLKQCADARRQDFNLTLTHYGLERLLYRLSISPH
FT                   ADSYLLKGALLFAIWYEQPHRPTRDADLLGFGLDDVDSAVSAFREICGIAVDDGIAFDA
FT                   ASVRGTTIRKEAGYGEVRIDLRATLDGARITLQVDIGFGDAVTPSPQAIRYPVLLDGLP
FT                   APQLRSYPKYTVVAEKLHAICLLGMANTRMKDYFDLWVLMTEGTLDPAELRRAMKATFE
FT                   RRQLALPAGLPAGLSDGFSSDAAKQAQWAAFLKKNRLEALELAPVVARLREEFQQCGIF
FT                   "
FT   gene            complement(90832..91446)
FT                   /locus_tag="Daci_0083"
FT   CDS_pept        complement(90832..91446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_2998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32730"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQM8"
FT                   /protein_id="ABX32730.1"
FT                   /translation="MPAPGSALEQAVLALAEQRPLLRARDLAALGLPTMALSRLVAAGR
FT                   LERVARGLYSLPGRPLSEHRSLAEVALRVPQGVVCLLSALRVHGIGTQAPFEVWMAIPH
FT                   HSPTPRIDQPALRAIRMSGAALSEGVETLQIDGVGVAVFNASKTVADCFKYRNKIGLDV
FT                   ALEALRDGWAQGKLTADALWHYAAIDRVSNVMRPYLESIAA"
FT   gene            complement(91554..92027)
FT                   /locus_tag="Daci_0084"
FT   CDS_pept        complement(91554..92027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0084"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ajs:Ajs_0044 uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32731"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQM9"
FT                   /protein_id="ABX32731.1"
FT                   /translation="MPIWKRSFTLEDITSLSADTAVSHLGIEFTEIGDDFLRGRVHVDQ
FT                   RTCQPYGILHGGVNVVLAETLGSVAAACSIPEGWRSVGLNVSANHVRAARQGWVTGTAR
FT                   PVHLGQTTHVWAIELHDETGRLTCTCSLTMALLPPTHAQNVKLAAQPPVAAQP"
FT   gene            complement(92166..93680)
FT                   /locus_tag="Daci_0085"
FT   CDS_pept        complement(92166..93680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0085"
FT                   /product="succinate CoA transferase"
FT                   /EC_number="3.1.2.1"
FT                   /note="KEGG: ajs:Ajs_0046 acetyl-CoA hydrolase; TIGRFAM:
FT                   succinate CoA transferase; PFAM: acetyl-CoA
FT                   hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32732"
FT                   /db_xref="GOA:A9BQN0"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQN0"
FT                   /protein_id="ABX32732.1"
FT                   /translation="MSLADRVRFPEFLSRTMTAEQAAALIPHGVNVGMSGFTGAGYPKA
FT                   LPQAIAQHAKSEHAAGRPYKINVWTGASTAAEMDGALAEAGALGQRLPFNTDPTCRARI
FT                   NAGEIDFIDMHLSHVAQHAWFGFLGPMSVAVVEVLGVTEDGRLIPSTAVGNNKTWLEIA
FT                   DKVILEVNTKPPAKMEGMHDIYYGTAIPPRRVPIALTHADDRIGEPYLRVDPAKVVAVV
FT                   ETHKGDRDNVFAQPDANSNLIAASIIDFLAHEMKMGRLPKEMLPIQSGVGNVANAVLAG
FT                   LLTGPFENLLGFTEVLQDGMLDLLRAGKMSRASATSISLSGSAYRDFEENIDFYRERII
FT                   LRPQEISNHPELVRRLGVIAMNSMIEADIYGNINSTHVMGTGMMNGIGGSGDFARNGYL
FT                   SFFVTPSVAKGGKISCIVPMCSHVDHTEHDTQIIVTEQGLADLRGLSPRKRAQVIIDRC
FT                   AHPDFRPQLQDYFDRAQRQGALHTPHILGEALSWHQRFVETGDMRA"
FT   gene            complement(93888..95195)
FT                   /locus_tag="Daci_0086"
FT   CDS_pept        complement(93888..95195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0086"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: ajs:Ajs_0048
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32733"
FT                   /db_xref="GOA:A9BQN1"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQN1"
FT                   /protein_id="ABX32733.1"
FT                   /translation="MGLFQWTEKSANQLQRGGVIGPDERLPWPQTGLMGIQHVIAMFGS
FT                   TVLAPILMGFDPNVAVLMSGIGTLIFFLITGGKVPSYLGSSFAFIGVVIAATAYGGKGA
FT                   NGNIGVALGGIIACGAVYALIGLVVQMVGTRWIERFMPPVVTGAVVAVIGLNLAAIPVK
FT                   NMAANNFESWMQALTFVCVGLVAVFTRGMVQRLLILVGLIAASLLYGLFTNVLGMGKPV
FT                   DLSGVINAAWFGLPQFHAPVFSGPAMVLIVPVVIILVAENLGHIKAVTAMTGKNLDQYM
FT                   GRAFIGDGVATMVSGAAGGTGVTTYAENIGVMAATRIYSTAVFFVAAVLAVLLGFSPKF
FT                   GALIQAIPLPVMGGVSIVVFGLIAVAGAKIWVDNRVDFSQNKNLIVAAITLILGTGDFT
FT                   LKFGDFALGGIGTATFGAIILYALLDHARDDQPLIH"
FT   gene            95340..97454
FT                   /locus_tag="Daci_0087"
FT   CDS_pept        95340..97454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0087"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: vei:Veis_3179
FT                   acetoacetyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32734"
FT                   /db_xref="GOA:A9BQN2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQN2"
FT                   /protein_id="ABX32734.1"
FT                   /translation="MAFPSGLAGSARVPWPVMSHTPAFIPQIRLYQDWLRERHGLQFDS
FT                   YDALWRWSVTDLDAFWQSIWDYNALQSPTPHTAVLERNTMPGAQWFPGAQINYTRQALR
FT                   HVDAAHAAGMPAVVSRNETGRHRELSWPELRRQVAALALHLKAQGVGRGDRVAAYLPNI
FT                   PEAMVALLATASLGAVWSICAPDMGTNAVLDRFRQIAPKALIAVDGVHYAGRDIDRMAV
FT                   LAELRAGLPSVEHVVLVPNLDLQARLADAADYGQVTARDDAATAAFEPEWLPFDHPLWI
FT                   VYSSGTTGLPKPIVHGHGGMVLVALQLKALHNDVGCSYHPNSWGERYHWYSSTGWVMWN
FT                   AQVSGLLGGTTCVIFDGSPGGSKDRPDWGVLWRFAAETGVTSFGSGAAFYANCMKAGVD
FT                   LAQCGDLSRIRSLGTTGSPLSPEVQSWGTAQFAGMGRPDIWWNNISGGTDFAGAFIGGH
FT                   RELPQQPGIMQCRQLGAAVEAWNEQGQPVIDEVGELVCTQPIPSMPLYLWGDADGKRYL
FT                   SSYFDMYPAGHGRAPGGGDGPAAMGPVWRHGDWIRILPEGGCIIYGRSDATINRHGLRM
FT                   GTSEIYSAVEALPEVLDSMVVDLEYLGRESFMPLFVVLRPGVDLDDALRARLQGAIRQA
FT                   LSPRFVPDEIVQVAEIPRTLSGKKQELPIKKLMLGQPLDKVVNKEAMANPGCLDWYVGF
FT                   AAQHAKAQAA"
FT   gene            97543..98700
FT                   /locus_tag="Daci_0088"
FT   CDS_pept        97543..98700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0088"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   ajs:Ajs_0061 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32735"
FT                   /db_xref="GOA:A9BQN3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQN3"
FT                   /protein_id="ABX32735.1"
FT                   /translation="MSVLDSLALTRIPAEDEALRAEVRAFLAQAISGLPPHVRARSWGG
FT                   YSAELSRQLGEKGWIGVTLPREYGGGGRSAFTRYVLVEEYLACGAPVGSHWIADRQSGP
FT                   LILKYGTEAQKRFYLPRICRGEAFFCIGMSEPGAGSDLASVKTRAVPNGKGFVLNGQKI
FT                   WTTNAHHCHYMIALVRTSGEAGDRHKGLSQVIVDLSLPGVTVRPITDLSGDSHFCEVFF
FT                   DNVQLPPDALIGQEGQGWEQVTAELAFERSGPERLFSSIVLFDEWLAWLRATGERSEGA
FT                   LRLAGRVFTELAPLRAMSVAVQDKLVRGESPIVEAALVKELGTTLEQSIPAAIADDLFA
FT                   REASEVPLELLRTLNYVTEVAPSYSLRGGTRDILRGMIARGLGLR"
FT   gene            98869..99897
FT                   /locus_tag="Daci_0089"
FT   CDS_pept        98869..99897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0089"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: vei:Veis_4039
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32736"
FT                   /db_xref="GOA:A9BQN4"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQN4"
FT                   /protein_id="ABX32736.1"
FT                   /translation="MEDDLFADAARQLLQGECTPARVRAIEAGGSPRALWQSLEQAGFA
FT                   DALVPEHAGGAGLALAQLFDVWSQAGAHALPVPLGETMLARALLAGAGAERPPGAIALV
FT                   QGLLQPDGSLHCEPVRLGAVADSVLVQHAQGWSLLPVAQAQSKPAAFCLDVNLRWSAEQ
FT                   VRAAPAPAIALPGGLDLRTLQAGLVAAQLAGALMEVFQRTLQYANDRQQFGRPIGKFQA
FT                   IQHQLAVMSEHVFAARMAARLGCAGQGIFPERLRVAVAKARCSQAALAVAEAAHAIHGA
FT                   MGFTEEYDLQLLTRRLHAWRQTAGSESYWHGVAGAALVHGHAGSTLDLIRSTTDITADI
FT                   TA"
FT   gene            99921..100709
FT                   /locus_tag="Daci_0090"
FT   CDS_pept        99921..100709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0090"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   ajs:Ajs_0063 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32737"
FT                   /db_xref="GOA:A9BQN5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQN5"
FT                   /protein_id="ABX32737.1"
FT                   /translation="MPFLNIARDGAIWTLTMNLPETRNALTGNTAVEEFVQVCDEIRRD
FT                   ASVKAVILTGAGPIFSSGGNVKDMQRFFDDALTPDAIREEYRQGIQRIPRALTQLDVPV
FT                   ICAINGPAIGAGLDLTCMCDIRIASETATFAESFVRVGIVPGDGGAWLLPRAVGRAKAA
FT                   EMAFTGEAIDAQQALACGLVSRVVPADQLLPTARALADKIAANPGAVMRMTKRLLREGE
FT                   HSTLESLLELSAGYQALAHKTADHREAVMAFVEKRKPRFQ"
FT   gene            100809..101624
FT                   /locus_tag="Daci_0091"
FT   CDS_pept        100809..101624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0091"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG: aav:Aave_0124 septum
FT                   site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32738"
FT                   /db_xref="GOA:A9BQN6"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQN6"
FT                   /protein_id="ABX32738.1"
FT                   /translation="MYCAHSTLCASRGNSPIHRTPSPMAVETTSTARPSFDLKSAQLPV
FT                   VAVTLRDTDVRALVADLAQRLADDPDFFDNDPVLIDLAHVREAEESIDFAVLVEALRFH
FT                   RTVPVAVRGGSPAQMEAARAAGLAPAPEAAPVRPTVPEIEIQEVVREIEVVREVPAPQA
FT                   DALIVDKPLRSGQRVYARGTDIVVLAMVSYGAEVIADGNVHVYAPLRGRAIAGARGNTE
FT                   ARIFSTCMEAQLLSIAGIYRTIETDLPADVAAKPAKVRLDGEKILIEPV"
FT   gene            101674..102486
FT                   /locus_tag="Daci_0092"
FT   CDS_pept        101674..102486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0092"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: aav:Aave_0125
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32739"
FT                   /db_xref="GOA:A9BQN7"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQN7"
FT                   /protein_id="ABX32739.1"
FT                   /translation="MAKIVVVTSGKGGVGKTTTSASFASGLALRGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEANLNQALIKDKQCDNLFVLAASQTRDKDALTQDGVKK
FT                   ILDDLAGMDFEYIICDSPAGIESGALIAMHFADEALVVTNPEVSSVRDSDRILGMLSSK
FT                   TARAIAGESVKEHLLITRYNPNRVQDGQMLSLEDIQDILRIELIGVVPESETVLQASNQ
FT                   GIPAVHMQGSDVAEAYQDVVARFLGEEKPMRFTEAQKPGFFKRMFGGR"
FT   gene            102493..102756
FT                   /locus_tag="Daci_0093"
FT   CDS_pept        102493..102756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0093"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: ajs:Ajs_0067 cell division topological
FT                   specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32740"
FT                   /db_xref="GOA:A9BQN8"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BQN8"
FT                   /protein_id="ABX32740.1"
FT                   /translation="MSMLSFLLGEKKKTASVAKERLQIILARERVGGNGGGPDYLPALQ
FT                   KELMAVISKYVDIDVNDIKVHLERQENLEVLEVKIELPDASR"
FT   gene            complement(102986..104047)
FT                   /locus_tag="Daci_0094"
FT   CDS_pept        complement(102986..104047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0094"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   pfl:PFL_0408 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32741"
FT                   /db_xref="GOA:A9BQN9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQN9"
FT                   /protein_id="ABX32741.1"
FT                   /translation="MGFWFPEVPRWIWVLSIVCFIGALNLCSVKVFGEMEFWLSLLKVA
FT                   AIIAMIGGGLGIMVFGFGMAADQAPTGVQNLWVHGGFMPHGVSGLIASLAVVVFAFGGI
FT                   EIIGISAGEAKDPARVIPRAINAVPLRILLFYVLTLFVLMSIFPWPQIGSQGSPFVQIF
FT                   SGLGISSAATILNIVVISAAVSAINSDIFGAGRMLYGMAHQGQAPAGFGRVSRHGVPWM
FT                   TVVVMAVALLAGVVLNYLIPEDVFLLIASIATFATVWVWLMILLSQFAARRRMSPQQVA
FT                   ALKFPVPLWPAAPLAAIAFMLLVLGVLGYFPHTRAALVVGGLWIVLLGAAYLLWVRPAA
FT                   ARAQSEAMLPAAE"
FT   gene            complement(104029..104391)
FT                   /pseudo
FT                   /locus_tag="Daci_0095"
FT   gene            complement(104602..105105)
FT                   /locus_tag="Daci_0096"
FT   CDS_pept        complement(104602..105105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0096"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: vei:Veis_5008 flavin reductase domain protein,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32742"
FT                   /db_xref="GOA:A9BQP0"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQP0"
FT                   /protein_id="ABX32742.1"
FT                   /translation="MAALPPQSPFSSREFRDALGQFATGVTIVTARSPQGHPVGVTVSS
FT                   FNSVSLTPPLVLWSMALSAASLPVFQHCSHYAIHVLSASQKPLAELFARKGVDRFANTA
FT                   WRSSAQGVPLLSEATTVFECRNRHRHEEGDHVIFIGEVEQCSHQAGHTPLLYHAGRMHT
FT                   GGLG"
FT   gene            complement(105296..105931)
FT                   /locus_tag="Daci_0097"
FT   CDS_pept        complement(105296..105931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0097"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ajs:Ajs_4160 DNA polymerase III, epsilon
FT                   subunit; TIGRFAM: DNA polymerase III, epsilon subunit;
FT                   PFAM: Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32743"
FT                   /db_xref="GOA:A9BQP1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQP1"
FT                   /protein_id="ABX32743.1"
FT                   /translation="MPQPIAVIDFETTGMAPAQGARATEVAIVLIEGGQVVDRFQSLMR
FT                   TGAWIPPFITRLTGITNAMVAAAPPAEEVMRDAARFVGSAPMVAHNAAFDSKFWQSELA
FT                   LAGEAAPQPFACTVLLSRRIYPEAPSHSLSRLTAHLGLPVAERAHRALADAEMAAALLA
FT                   RMQQDLCLRHALAWPEHALLMQLQRCTRARMTAWLNENAAPAQMSMAL"
FT   gene            complement(105976..106476)
FT                   /locus_tag="Daci_0098"
FT   CDS_pept        complement(105976..106476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0098"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="TIGRFAM: homoprotocatechuate degradation operon
FT                   regulator, HpaR; PFAM: regulatory protein MarR; KEGG:
FT                   bra:BRADO2596 putative homoprotocatechuate degradative
FT                   operon repressor, transcriptional regulatory protein MarR
FT                   family, HpcR-like"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32744"
FT                   /db_xref="GOA:A9BQP2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQP2"
FT                   /protein_id="ABX32744.1"
FT                   /translation="MLPNMPQTTTSFAPEPLRAFSRSLPMALLRARESVMVRFRPMLRA
FT                   HGLTEQQWRVLRAMAAVTHRLRPMELSQATYISMPSLSRLLKTLEGRQLVERSRHASDM
FT                   RGAEFELTAAGHAIVAEIAPHSSETYAEIERLVGHEEIEQLYALLDQVVQRLGAADGSQ
FT                   AEE"
FT   gene            complement(106551..107372)
FT                   /locus_tag="Daci_0099"
FT   CDS_pept        complement(106551..107372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0099"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /note="KEGG: rha:RHA1_ro10138 4-hydroxy-2-oxovalerate
FT                   aldolase; TIGRFAM: 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase; PFAM: HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32745"
FT                   /db_xref="GOA:A9BQP3"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQP3"
FT                   /protein_id="ABX32745.1"
FT                   /translation="MQTPVNRFKAAIAADQPQIGLWLGLADAYSAEICAGAGFDWLLID
FT                   GEHSPNDTRTLLAQLQAIAAYPDSHAIARVPMGHGEVGEMLIKQYLDIGVQTLLVPMVD
FT                   TAEQAARIVRAARYPQADGQGGIRGMGGARASAWGRRANYAHEANAQVCVLVQVETRQA
FT                   LAHLDAIAATEGVDGVFIGPADLSASMGHIGNPGHPEVQEAIADAIARIRRAGKAPGIL
FT                   TPNEALARKYLELGCTFTAVGLDTSVLVQATSALAARFKQAAAPAPKSQTY"
FT   gene            complement(107391..108845)
FT                   /locus_tag="Daci_0100"
FT   CDS_pept        complement(107391..108845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0100"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: eba:ebA2996
FT                   succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32746"
FT                   /db_xref="GOA:A9BQP4"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQP4"
FT                   /protein_id="ABX32746.1"
FT                   /translation="MPLALRDPSLLKNLCLIDGQWLAADDGSRIDVHNPATGEAVGHVP
FT                   RMGEAETQRAIAAAERAFALWKQQTAEARARLLQRWFELMMENQEDLALIMTSEQGKPL
FT                   AESRGEIAYAASYVQWFAEEARRIYGSTVPAPWADKRIIVTKEPVGVCAAITPWNFPAA
FT                   MITRKVAPALAAGCTIIVKPAQQTPLSALAMAELAQRAGIPEGVFSVITGSSRAIGGVL
FT                   TASMAVRKLTFTGSTEVGRVLAEQCAPTLKKMSLELGGNAPFIVFDDADLDAAVEGAMA
FT                   SKYRNTGQTCVCANRLLVQDGVYDAFMARLKVAVQALKVGNGLEAGVGQGPLIDQAAVD
FT                   KVEELVADAVKNGAEVVLGGKRHALGGTFYEPTILANATDRMRIAREEVFGPVAPVFRF
FT                   KTEEEAIRMANDTEYGLAAYFYARDVGRVWRVGEALEYGMVGINSGIISTAVAPFGGVK
FT                   QSGMGREGGAAGIEEYLSTKYLCMGH"
FT   gene            complement(108891..109724)
FT                   /locus_tag="Daci_0101"
FT   CDS_pept        complement(108891..109724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0101"
FT                   /product="2-oxo-hepta-3-ene-1,7-dioic acid hydratase"
FT                   /EC_number="4.1.1.77"
FT                   /note="KEGG: bbr:BB0739 2-oxo-hepta-3-ene-1,7-dioic acid
FT                   hydratase; TIGRFAM: 2-oxo-hepta-3-ene-1,7-dioic acid
FT                   hydratase; PFAM: Hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32747"
FT                   /db_xref="GOA:A9BQP5"
FT                   /db_xref="InterPro:IPR012690"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQP5"
FT                   /protein_id="ABX32747.1"
FT                   /translation="MFSQELLTQLAQELDRSEKTRVQVEHFSKRFPGMTVEDGYRVSRE
FT                   WVRLQIAAGRKVIGHKIGLTSRAMQISSQIDEPDYGTLLDSMLYRCTPGQVLDIPAAHF
FT                   IAPRVEVELAFVLKAPLRGPGLPGGREITLQDVLDATDHVTPAIEIIDARIEQFDRHTK
FT                   AMRKVYDTISDNAANAGIVVGAGQAVPGVLDLPWCGAILRCNGVVEETGLAAGVQGHPA
FT                   IGVAWLANKLSPWGEALEAGQTVLAGSFTRPVAAKPGDLFDADYGPLGRLQFRFV"
FT   gene            complement(109726..110160)
FT                   /locus_tag="Daci_0102"
FT   CDS_pept        complement(109726..110160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0102"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase"
FT                   /note="PFAM: 5-carboxymethyl-2-hydroxymuconate isomerase;
FT                   KEGG: bbr:BB0738 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32748"
FT                   /db_xref="GOA:A9BQP6"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQP6"
FT                   /protein_id="ABX32748.1"
FT                   /translation="MPHVVILYTASLDAHTDMTQLCRALADTMLTVRAEDGAQVFPTGG
FT                   TRVLAYPAPHSAVADGGAAGRAAGGDGDYGFIYINLRMGRGRSAAVQQQAGDALLACAR
FT                   RHLQPLFAQRHLGLTVQVDESPGQVYDGKHSTLHPLFSRP"
FT   gene            complement(110161..110979)
FT                   /locus_tag="Daci_0103"
FT   CDS_pept        complement(110161..110979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0103"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: swi:Swit_4311 extradiol
FT                   ring-cleavage dioxygenase, class III enzyme, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32749"
FT                   /db_xref="GOA:A9BQP7"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQP7"
FT                   /protein_id="ABX32749.1"
FT                   /translation="MSLVFAGVCSHAPGITGRAHLADPATRDAFHAAFRDMGARLEAAR
FT                   PDAVIVIAAEHFANFFMNNMPAYAIGMADHYEGPIEDPAWLGIERHRIPGNAELSRRLI
FT                   TEVMQTVDVAFAEEWKFDHGIMVPLHFLTPAYDKDIIPVNINCQGPPLTPLHRAWAFGE
FT                   ALRRACDKAPERIAIVGTGGISHWPATPDSGKVNWEWDQQFMDRWCRNDRDALLSYTDA
FT                   ETYRDGGQGGFEIRSFIAVAAAARGAGQVLYCQPIPIFAVSCTAATMEVA"
FT   gene            complement(110981..111307)
FT                   /locus_tag="Daci_0104"
FT   CDS_pept        complement(110981..111307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0104"
FT                   /product="Extradiol ring-cleavage dioxygenase LigAB LigA
FT                   subunit"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase LigAB LigA
FT                   subunit; KEGG: swi:Swit_4310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32750"
FT                   /db_xref="GOA:A9BQP8"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQP8"
FT                   /protein_id="ABX32750.1"
FT                   /translation="MSLYTMQKFLFQLNREPEVQRRFAEDRAALLAEYALEPEEYEAMF
FT                   HGDIGKLYVLGCNGQLLMHFAPLLGMPWADYLQAMRDGVQKHGPVRAGVYAMTTATNEK
FT                   IAGV"
FT   gene            complement(111328..112320)
FT                   /locus_tag="Daci_0105"
FT   CDS_pept        complement(111328..112320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0143 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32751"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQP9"
FT                   /protein_id="ABX32751.1"
FT                   /translation="MQRRHFLQSTAATTAAALMLPGLSQAQPGSPAGTWPAKPLRIIVP
FT                   FTPGGTTDLVARLVGTELGKSLGQPVIVENKPGAGTVIGVDYVSKQPADGYTLVCVANS
FT                   FTANKTLVKNLPYDTTRDLKPVALMGLSEHVLATHPGSGLKTLADLRSRAKARPGELSY
FT                   ASFGNGTSAHLSGALLCQEMGIDMVHIPYKGQGPALADLLGGQVDVMFGNWPEFRGHVQ
FT                   SGKLVALGMATRQRSQFAPQVPTLAEQGVALESNSWQGLLAPGATPDALVQRINAAVVK
FT                   ALAEPAVVDAFARGGIVSQAGTAQQFAAFVTSEIAKYEAIIRRANITLG"
FT   gene            complement(112366..113823)
FT                   /locus_tag="Daci_0106"
FT   CDS_pept        complement(112366..113823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0106"
FT                   /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /note="TIGRFAM: 5-carboxymethyl-2-hydroxymuconate
FT                   semialdehyde dehydrogenase; PFAM: Aldehyde Dehydrogenase;
FT                   KEGG: bbr:BB0736 5-carboxymethyl-2-hydroxymuconate
FT                   semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32752"
FT                   /db_xref="GOA:A9BQQ0"
FT                   /db_xref="InterPro:IPR011985"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQQ0"
FT                   /protein_id="ABX32752.1"
FT                   /translation="MRIDHLIDGKAVAGKDYFETVNPATQEVLAEVAAGGEAEVQAAVA
FT                   AAKNAFPKWANTPATERAKLVRKLGDLIARHVPEIAQTETNDCGQVIAQTGKQLVPRAA
FT                   DNFYYFAEMCTRVDGHTYPTPTHLNYTLFHPVGVCALISPWNVPFMTATWKVAPCLAFG
FT                   NTAVLKMSELSPMTAARLGELALEAGIPPGVLNLVHGYGKDAGEPLVRHRDVRAVSFTG
FT                   STQTGNRIVQAAGLKKFSMELGGKSPFVIFDDADFERALDAAVFMIFSNNGERCTAGSR
FT                   ILVQKGIYAKFVDRFVERARKITVGDPLEESTIVGPMISASHLAKVRHYIELGQKEGAS
FT                   MLCGGLDAPVLPERVRKGNYVLPTVFADVDNRMQIAQDEIFGPVACIIPFSDEAEAVRL
FT                   ANDIQYGLSSYVWTESVGRAHRVAAAIEAGMCFVNSQNVRDLRQPFGGTKASGTGREGG
FT                   SWSYEVFCEPKNVAVSLGSHHIPHWGV"
FT   gene            complement(113852..114613)
FT                   /locus_tag="Daci_0107"
FT   CDS_pept        complement(113852..114613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0107"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit"
FT                   /EC_number="4.1.1.68"
FT                   /note="KEGG: bcy:Bcer98_0972 4-hydroxyphenylacetate
FT                   degradation bifunctional isomerase/decarboxylase, HpaG2
FT                   subunit; TIGRFAM: 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase,HpaG2 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32753"
FT                   /db_xref="GOA:A9BQQ1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012684"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQQ1"
FT                   /protein_id="ABX32753.1"
FT                   /translation="MKHGRVIFEGQTLQVTEGPHGQVQLPDGRLVAETAVQWLPPLQFG
FT                   TVFALGLNYADHAKEIAFNKAPEEPLVFLKGPNTLNGHHGRTYRPADVAYMHFECELGV
FT                   VIGKTCRNVRREDAYSVIAGYCTANDYAIRDYLENFYRPNLRVKNRDGATPVGPWFVDA
FT                   ADVPDPMNLRLRSWVNGELKQDGSTRDMVHDIPSLIAHLSGFMTLNPGDLILTGTPDGV
FT                   ADSRVGDEIVTEIEGLGRLVNTIVGDAPAAS"
FT   gene            complement(114610..115290)
FT                   /locus_tag="Daci_0108"
FT   CDS_pept        complement(114610..115290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0108"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase, HpaG1 subunit"
FT                   /EC_number="4.1.1.68"
FT                   /note="KEGG: bte:BTH_II1735 4-hydroxyphenylacetate
FT                   degradation bifunctional isomerase/decarboxylase,
FT                   N-terminal subunit; TIGRFAM: 4-hydroxyphenylacetate
FT                   degradation bifunctional isomerase/decarboxylase, HpaG1
FT                   subunit; PFAM: fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32754"
FT                   /db_xref="GOA:A9BQQ2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012686"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQQ2"
FT                   /protein_id="ABX32754.1"
FT                   /translation="MQIQPFLLDDGLALGTVYGTLLNQQATVQRLSPQFDSAPYKAAPR
FT                   APVLYLKPRNTWARDGAAVAVPADPGEVRVDASIGLVIGRSATRVSEATALDHVAGWLI
FT                   ASDLTLPHENYYRPAIRQRCRDGFCPLGALVRGTGFDAQAATLTVSINGEQVWQRGFAD
FT                   LVRSPARLLADVTEFMTLSPGDVLLLGPGEGAPLARPGDRVVIEVPGLGRLTHSVVAEQ
FT                   GAAA"
FT   gene            complement(115464..119141)
FT                   /locus_tag="Daci_0109"
FT   CDS_pept        complement(115464..119141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0109"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Fibronectin type III domain protein; KEGG:
FT                   ava:Ava_4728 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32755"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022060"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQQ3"
FT                   /protein_id="ABX32755.1"
FT                   /translation="MRMDTLDWRHKAIATACLALCGAAWSAPFTPGNLVAYRVGTGTGA
FT                   LPVYLDEYRVDGTLVQSLPLSGGATPLTASSKGSEGLLNRSDNGLCLVVPGYAVATGGT
FT                   EPNGVTAAAAQRAVAVVGFDSDVKSLRPLGTTAFSKDTIRGAASSDCGAVWASGKGTAT
FT                   ANNGVWHVAADGTGISQLNSSNVQGLAVAGGQLIAAINGGSLNQIGTNLPTTGIQTALP
FT                   LAGLTPSTYRGIAFLQLDGGPALANTVYVADNDAGAIRKFRLSMDGTSWQPAGSIAGLS
FT                   KVHGLAAFDTGGGNVMLMATDTTGRLYRAFDHGGYAGTLSGTAESIAAPQGGVFYGVAW
FT                   APLETVPATVPAAPSNLAATPAGNRVTAAWDAVPGAAYYVVELSQDSFASVASTAVALG
FT                   NSQALEGLQPGSYTLRVRAVNGLGGSTAAVSVPFMASAPPTASLPELTAFSGVVGDAND
FT                   PLASAGIGFTVQDAGGAGGVQVTARSSNQAVVADAGLAASNQAGNAVLRITPTGVGYAD
FT                   ITVTLTNAGGASVSRTIKYAASANTAANTSPRWLAGRSDASTAIVIDAATMLVGDDEAP
FT                   AQDASGNALPAGNSFSAYGPAGGLPIKPLMLDRTALGLADAAACTAPGLTGLDSCKSDE
FT                   EMDIEASFALGSRVYVAGSHSNNKSGKSRTDRWRLAAMDVTGSGASTALTTRGYYRWLR
FT                   EDLRSWDAAAHDGLAANYLGLVASSDGGATKAPEAETMSGFSIEGMSTSPDDGAAWLGF
FT                   RAPLVPAPGASAVTADDATGRTHALIVPVTNFAALPAADGGSKGSAIMGQPIRLDLGGR
FT                   GIREIRKNAAGEYLIIAGPSASATGTAPRNFQLYSWDGRVNGAGLALNLRPRAADLAAI
FT                   TVPNTACSAEGIGAMPASLDAGGSVDIISDCGDADFYGDGTAAKDLPYAAWKKARLDSL
FT                   AVPALSTVALTAQAVDQTSAVVQATPSMGGSLRAVALPANAPVPSWEQVMAGLDAAGLP
FT                   APASNTVSTAAGTAATLSFTGLDPAVSYRVHAVNLPASGTASAPAVLALSKPVPIGTQI
FT                   GTGSNTAGVSNGTGNVGADQWQFASNSAGFQPAPSQSPLPGDLRLPYGSLSFVLMGGTP
FT                   GSMATIRMDLPEAAPAQATLWKYGPTAATPTAHWYELSASAYRFAPDRRSVSFDITDGQ
FT                   TGDSDLTVNGVIVDPVAVAAPAALPPGATATPVPGLSTLAQALLALVLGGMAALRRRRG
FT                   "
FT   gene            complement(119345..119767)
FT                   /locus_tag="Daci_0110"
FT   CDS_pept        complement(119345..119767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0110"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: ajs:Ajs_0074 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32756"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQQ4"
FT                   /protein_id="ABX32756.1"
FT                   /translation="MNILLAVDGSPYTQKMLAYLTSHPEILGSAHSYSAITVQPQLPAR
FT                   ARAALGKEVVDEYYAEESTKVLDPVCSYLAEHGVQATRLSKVGPVADSIIKAAEEGKFD
FT                   LLVMGTHGHGALGRLVMGSVSTQVLAGSQVPVLLIR"
FT   gene            complement(119831..120730)
FT                   /locus_tag="Daci_0111"
FT   CDS_pept        complement(119831..120730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0111"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: aav:Aave_0135
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32757"
FT                   /db_xref="GOA:A9BQQ5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQQ5"
FT                   /protein_id="ABX32757.1"
FT                   /translation="MKIQLLSDLHLEAHPHFIAEPAPDADVLVLAGDIGSYQSGSLLQG
FT                   EHFGLERFSPLPQYAGWPCPVIFVPGNHEYDMQDFDAAHARLRAACERMGMVWLERETA
FT                   VLGGVRFVGTTLWSDYDAMSMHEGVTDLARLLKLREKAFRAANFYLHKTGGTRGGEPFL
FT                   AEPMREQSLVCQQWLRQALARPFDGPTVAVTHFAPSLRSADPRYGLVPGTAGFCNVLDD
FT                   LLPFADLWLHGHLHSPSDYVAEGLRDDGSAWRCRVVANPLGYARKGEQEGFFPRSTIEL
FT                   PAHVTAGAAEVADAPVRA"
FT   gene            complement(120779..121738)
FT                   /locus_tag="Daci_0112"
FT   CDS_pept        complement(120779..121738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0112"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pol:Bpro_0158 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32758"
FT                   /db_xref="GOA:A9BQQ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQQ6"
FT                   /protein_id="ABX32758.1"
FT                   /translation="MSALNFRTLDLNLLRVFDEVMAERSLTRAAHKLAITQPAVSNALR
FT                   RLREALGDELLVRQGQGVEPTPRALALWPVIREALQQLQDTLTPGEFHPSTATATFVLA
FT                   MADATAATLIPPMFSLLEREAPGVGIRVLPLTTRDPRGLLEAGEADMAVGYFPAALADL
FT                   TARAQSGALVAFDSRRLYEGEYLCVMRQGHPLADVPLTLDNYCAARHMLVSFSGRSFGF
FT                   IDEALASLGRTRQVVLTVNQFFTAGRVVMNSNLLTILPRHFVPVTGMADKLVLRELPFD
FT                   VQPVHVDALWRRRGQHPQAYDWLLRTLTRSAEATFPHT"
FT   gene            121880..122299
FT                   /locus_tag="Daci_0113"
FT   CDS_pept        121880..122299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32759"
FT                   /db_xref="GOA:A9BQQ7"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQQ7"
FT                   /protein_id="ABX32759.1"
FT                   /translation="MSNFIYNSYCVEHPGVVHVYQAADDRKSAAKRFSGKRGASALLLA
FT                   ALVAALMVVVNEVAHNWTDGHMLGAWVVLWVAAFMGLALFSAPARRAAMTARAGYRAWT
FT                   ESRQQAAADERIWNAALQDARLMADLARAMDRQGN"
FT   gene            complement(122441..124306)
FT                   /locus_tag="Daci_0114"
FT   CDS_pept        complement(122441..124306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0114"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   aav:Aave_0138 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32760"
FT                   /db_xref="GOA:A9BQQ8"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQQ8"
FT                   /protein_id="ABX32760.1"
FT                   /translation="MNAPVMQGLNIQAPAYVKNSRLIAWVAEMAALCKPAKIHWCDGSQ
FT                   EEYEQLCQQLVDAGTFKKLDPVKRPGSYLAWSDPSDVARVEDRTYICSANKEDAGPTNN
FT                   WMAPNEMRATLQPLFDGCMAGRTMYVVPFSMGPLGSPIAHVGVELSDSAYVAVNMKIMT
FT                   RMGRAVYDVIGVEGEFVPCVHTVGAPLAEGEKDQTSWPCNKTKYIVHYPETREIWSYGS
FT                   GYGGNALLGKKCFALRIASTMGRDQGWLAEHMLILGVTSPQGKKYHVAAAFPSACGKTN
FT                   FSMLVPPKVFEGWKVTTIGDDIAWIKPQADGSLRAINPEAGYFGVAPGTNYHTNPNCMA
FT                   SLDKNVIFTNVALTDDNDVWWEGMDKDTGKQPDHLIDWQGKDWTPQIARETGAKAAHPN
FT                   ARFTVAATNNPALDEAWDDPKGVKIDAIIFGGRRSTTVPLVTEARNWTEGVYMAATMGS
FT                   ETTAAAFGAQGVVRRDPFAMLPFAGYNMSDYFQHWLTLGAKIEGQGAVLPKIFTTNWFR
FT                   KNADGKFVWPGYGENMRVLKWMIDRLEGQAQGEQTAFGIAPQYAEINWTGLDFSADQFA
FT                   SVTSIDKAAWAEEMQLHTEHFDKLAHKLPQELLVTKAELEKRLAA"
FT   gene            complement(124632..124784)
FT                   /locus_tag="Daci_0115"
FT   CDS_pept        complement(124632..124784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32761"
FT                   /db_xref="GOA:A9BQQ9"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQQ9"
FT                   /protein_id="ABX32761.1"
FT                   /translation="MSHDPAANHATEATATDDATEAVVPYIPVILPLAGAVMMFLLAFI
FT                   AVNMA"
FT   gene            complement(124875..126122)
FT                   /locus_tag="Daci_0116"
FT   CDS_pept        complement(124875..126122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0116"
FT                   /product="threonine dehydratase"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein; KEGG: ajs:Ajs_0080
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32762"
FT                   /db_xref="GOA:A9BQR0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQR0"
FT                   /protein_id="ABX32762.1"
FT                   /translation="MACPAARPGRRAPQCVMLSLQDIQNAADRLRGAVLDTPCVESRTL
FT                   SQITGAQVYLKFENLQFTASFKERGALNKLAQLSPEERARGVVAMSAGNHAQGVAYHAQ
FT                   RLGVRAVIVMPRFTPGVKVERTRGFGAEIVLHGDSLAEARQHAYTLAEQQGLCFVHPYD
FT                   DEQIAAGQGTLALEMLAEQPDLDQLIVAIGGGGLIAGVATAAKGLNPGIEIIGVQTQRF
FT                   PSMFNAVRQAGLPMGTSTIAEGIAVTQPGAITQEVVSRLVDDMLLVDEGDIEQAVLMLL
FT                   EIEKTLVEGAGAAGLAALLRHPQHFAGKKVGLILSGGNIDPLLLAAIIGRGMVRSGRLA
FT                   RIKVSARDVPGVLARITATVAAAGANIEEVHHQRAFTMLAAQSVEIELVLQTRNKAHIE
FT                   EVIAALQAEGMQVNAA"
FT   gene            126210..127238
FT                   /locus_tag="Daci_0117"
FT   CDS_pept        126210..127238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0117"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bam:Bamb_1692 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32763"
FT                   /db_xref="GOA:A9BQR1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQR1"
FT                   /protein_id="ABX32763.1"
FT                   /translation="MALSSVQTPARPPRWLGRGTLRACDFSGPDYRILDAEVTAEDALL
FT                   AGHLQSWQVQPGLWLHGVEARDLRTMSTRSPAVPGLHLVVLLEGCVDVAFGSQGLQMQV
FT                   APASPAGAHVQACGAVIHSRPGDMFMRHWRRGKFERKLSITVQPQWFAAQALPMVAPPL
FT                   LRHWMEQQLLAIRPWQPSPRAVAVAEQIIQLAREGSAPLLLASRTLELVHEAVQALDAP
FT                   EPDPAQTVPGVLGVREHRRMARLKALLDSGGDGCRPLAEIAREVGLSASALQRQFRLAY
FT                   GSSIDEYRREQRLERAWAALEQTGCSVSEVAHAAGYSSAANFSTAFKRRFGISPKLVRA
FT                   RL"
FT   gene            127377..128489
FT                   /locus_tag="Daci_0118"
FT   CDS_pept        127377..128489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0118"
FT                   /product="FAD-binding 9 siderophore-interacting domain
FT                   protein"
FT                   /note="PFAM: Siderophore-interacting protein; FAD-binding 9
FT                   siderophore-interacting domain protein; KEGG: oan:Oant_1901
FT                   siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32764"
FT                   /db_xref="GOA:A9BQR2"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQR2"
FT                   /protein_id="ABX32764.1"
FT                   /translation="MTQLQARTSVRMDRAEEAIAAIVGHMQEHDITVRREGSRWVADYE
FT                   GGQGQLWLEGRQVHAEVAAPGVELLQDMKLMLAHLLLEATGAADGSLAWEGDGAALQRP
FT                   PAFRELRVLAVRDLTPHMRRVRFACDDMARYAQDTNIHVKLLFPQPGVAEPEWPTLSAS
FT                   GLLRLPEGDMRLDMRTYTMRAMGMAQDGANGWMDVDFVLHEDAGPGSAWAARAQPGQRI
FT                   GMTGPGGRTATPADWMLLAGDDTGLPAMLRIAAALPAHTRGHVFAEVQGPQDEQPVQAP
FT                   EGLQWHWLHRGAAEAGTTTLLIDALRAVRWPDALAGHPPSRFVWAAGEFDTAQAVRQWA
FT                   REERGLEKHEQLIVAYWRRGMSESDFKAAK"
FT   gene            complement(128511..130031)
FT                   /locus_tag="Daci_0119"
FT   CDS_pept        complement(128511..130031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0119"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bur:Bcep18194_A3296 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32765"
FT                   /db_xref="GOA:A9BQR3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQR3"
FT                   /protein_id="ABX32765.1"
FT                   /translation="MNLLDAFDSAVRKTPAKAFLRDRGASISYADMQRRSQRAAAVLQA
FT                   QGVGRGDTVALMCLNAPGFVEALFGAWRLGAALMPVNHKLQAPELQYILDHAQCKALVF
FT                   DAALAPVVAAAPHPCARLVTEAQEAVPGVQDWDTLVAAARPMEGTRPADGDIAQVLYTS
FT                   GTTGRPKGCLLSHRAVTLAAITAALGLSITREERTLMAMPIWHSSPLNNWFGGTLYMGG
FT                   TVVLLREYHPQHFLQAVQDEGVTLYFGAPVSYFAPLQMLPDFARYDLSSVRAWVYGGGP
FT                   IGADMARKLATAYRSDRFYQVYGMTETGPTGTTLYPEEQVERAGSIGRVALPGVDMRVV
FT                   RDDGEDAGPGDTGEIWLRTGSVMDGYLHDAQATAAAFAPGGWYRTGDLARLDDAGYLFI
FT                   VDRTKDMVITGGENVYSKEVEDALSAHPQVADVAVVGRPHPEWGETVVAHVVTRGEAAP
FT                   EAEALQQFLADRLARYKIPREFVFAASLPRTPTGKLQKFLLRQERSAT"
FT   gene            complement(130077..131771)
FT                   /locus_tag="Daci_0120"
FT   CDS_pept        complement(130077..131771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0120"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ajs:Ajs_0081
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32766"
FT                   /db_xref="GOA:A9BQR4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQR4"
FT                   /protein_id="ABX32766.1"
FT                   /translation="MSTGQTLQTGHTWNTHDVLNQVDELTDFNLLEADPALAEALQRNG
FT                   AARHIPSLSRYAQQLGERATWELAEQANRHTPELHRFDARGRIIDAVEFHPSWHTLLGL
FT                   YRQQGLISLPFEDSSAGRWSAWAAGFYLHGQVEQGTLCPATMTTAAIPLLQKEPALWQQ
FT                   LQGKLFSHEYDPRDLPVGDKASMWLGMGMTEKQGGSDVRANTTVAMPVHAGGRGGEYLL
FT                   RGHKWFFSAPMCDAHLVVARMGESGGQACFYVPRWRPDGSRNAVRVQRLKDKVGNRSNS
FT                   SSEVEFEDAWGILMGEEGRGIPTIIEMATYTRLNCVLGSAAILRSATVQALAYARRRSV
FT                   FGKLLAEQPLMRTVLADLALESEAALQIAMRLAQAYERGGDEGDPLERAWKRIMTPAAK
FT                   LWVCKRGVELTGEAMEVLGGNGYVDTGVMARLFREAPVNSIWEGSGNVMCLDVLRAISR
FT                   EPDGAQLLLQDLIDTAAGEPALLQQAQSLARRLSGPPDQLEAQARRLVQDLVLLAQACL
FT                   LRRHAPPAMADGFIATRLGAQQGAMVAGAFDPAGLDIAAIVQRALPA"
FT   gene            131868..132476
FT                   /locus_tag="Daci_0121"
FT   CDS_pept        131868..132476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0121"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bam:Bamb_0108
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32767"
FT                   /db_xref="GOA:A9BQR5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQR5"
FT                   /protein_id="ABX32767.1"
FT                   /translation="MRRRPLQSRAQATSQALQDAFVRLVIEQGYERTTVREVAAVAGVG
FT                   LGTFYEYFGNMDTLAAMCIHRQVQALHAQGLQTLQDSAGMPLATRVDRLLDTLVDGIAR
FT                   EAPMWAALFMLERKVSAPEPFRRHYQAYVQLWGTALQDCDPPLPAPAQPLARLLHTLTY
FT                   GWVSQSLLALGPQQTLQQLRAPLGWAIHALLREAQAPSA"
FT   gene            complement(132518..133696)
FT                   /locus_tag="Daci_0122"
FT   CDS_pept        complement(132518..133696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0122"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: aav:Aave_4320 histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32768"
FT                   /db_xref="GOA:A9BQR6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQR6"
FT                   /protein_id="ABX32768.1"
FT                   /translation="MALGLRPNRIWVRFGLWITATVLSTIALLAIGVLVFSEIQYRDFY
FT                   SSLPPAVQIELDELNAQSLEDSPRAMQIYGQYWTGDLLFGEKWSLVIGLLVCLPFGLAV
FT                   GFWVSRLVTRPLASMVEVAKRVELGDFSARALPGKAHGEMAEMVVAFNRMIDSLETLEA
FT                   ERRATAASISHELRTPLTVLQARLHAICDGVIAADDTELNTLLFQVEHLGRLVGDLHTL
FT                   SMADAGQLSLQKQRLDLAELVAETLDHLHPQLLQHGMQLEMHLPAPSDIGMADIRADAD
FT                   RMRQILSNLVSNAIRHAASGAWLGVALTVESDIEGRAWAVLRISDAGPGLPSELRAHPF
FT                   QRFAQVPGKRRREGSGLGLSIVKALTVSQGGSVEADDSEQGGARFTLRFPRV"
FT   gene            complement(133681..134406)
FT                   /locus_tag="Daci_0123"
FT   CDS_pept        complement(133681..134406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0123"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: aav:Aave_4321 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32769"
FT                   /db_xref="GOA:A9BQR7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQR7"
FT                   /protein_id="ABX32769.1"
FT                   /translation="MNSTAQPTATTPLVLVVEDEPAIASILTAYLERDGLRSRMASDGQ
FT                   EALQLFRLLRPDLVLLDIHLPGMDGIDVLRAIRDDSQTPVIMVTALADDVDKLLALRLG
FT                   ADDYVVKPFNPPEVVARVRAVLRRTQARKNPAPAPIRVGPIEIDAEAHSAVVYDNEGRA
FT                   LPLPLTLTEFRLLACLAAQPRRCFSRSHLIEHCLPESDALERVIDSHLSKLRRKLQLAG
FT                   QEGLIETVRGIGYRLWPWD"
FT   gene            complement(134540..135544)
FT                   /locus_tag="Daci_0124"
FT   CDS_pept        complement(134540..135544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0124"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: kpn:KPN_03276 putative
FT                   fimbrial-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32770"
FT                   /db_xref="GOA:A9BQR8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQR8"
FT                   /protein_id="ABX32770.1"
FT                   /translation="MSFTAILRHGLATPLLLMFCMAPISSWARCSSQGWNAQFPGSANT
FT                   PTIVNENYPIGSVVYSRTMALQNTGAGSYHISCDNDFYYIEGIGTESGGIYSTAIPSLG
FT                   MRITWERAAPYSGSMLKQGIFHSLPSNNMTIELVKTGELTSGGSLNGSFARIYSGTSNA
FT                   RDLLATVFFSSGITVNVSSRPRPPTCRVSTGKIDVTMAPAPFADFKGIGSVTAAKDFSI
FT                   ELTCAGGEANTRLTAFITLTDATQATNRSSTLTLAQNSKARGVGIQVLRNNVPVSFGPD
FT                   SGSLGNANQWNAGQVAQGQNSLKIPLSARLVQTAGSVTPGMAYGRATFTMSYQ"
FT   gene            135577..137361
FT                   /locus_tag="Daci_0125"
FT   CDS_pept        135577..137361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0125"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: aav:Aave_4322 transcriptional regulator, fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32771"
FT                   /db_xref="GOA:A9BQR9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQR9"
FT                   /protein_id="ABX32771.1"
FT                   /translation="MPWDRWHRARYPANVLTCMRPWNWSVLKINSESSESTVIGRSATG
FT                   SRPGWGREAPARRRVLHVSSIKPATSRKLGRVQWLSGDMVPWPRFPGPSLDHPLPPVHP
FT                   VNHAAATHRLSSLCLGAALALAGCSSPPPAQLDGSVPTQWTQPLPAAAPGAPGSAAAPD
FT                   LQGWWKAWGDESLNTLVEEALAANLDLSQAQSRLRQQRLLAGTAGSAFRPVFTAGARTL
FT                   QDIAAIDSYFHASIDVSWDLGLFGAREAGERNAAASVLDARGRLQAARVALVADVVHRY
FT                   LDIRMAQRQRALIDEQALLDARALQLAQVRQQQRLGTAEAVHQLQLQAGQSAALRASLR
FT                   ETQARSAHMLAALLGRTRPDAQWLQADAKAPLPGAQALGVAALPADLLRTRPDIQVAQA
FT                   AVERAAAEQGIAHAALYPRFVLGGSLLYSFNITQNYRTTQDNAPTFGPQIDIPLFDWGR
FT                   RRSQADASELALQAAVQAYRQSVLDGVAEVESALAALDAQRERIASLQSTQQVLAERER
FT                   VQDQRLKLGLDSEFGGLAPRRAALQARSEQTTALAAHALAYVALYKALGGAPLPAEDRD
FT                   DADSGMARPAPQAEGAPS"
FT   gene            137358..138512
FT                   /locus_tag="Daci_0126"
FT   CDS_pept        137358..138512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0126"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   aav:Aave_4323 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32772"
FT                   /db_xref="GOA:A9BQS0"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQS0"
FT                   /protein_id="ABX32772.1"
FT                   /translation="MIALARKTLVHEWRRFIPSVFAVGFSGVLLAMQAALVLGIFGSAA
FT                   LYVTASSADLWIGYPGTQSVNFGRTIGRDVDMRLRMDPDVAAVEPYVWVDGDWRSDSAA
FT                   GGAASEHGGGVSVYLSGIATDDASMLFSHVLQPWQRQRLRETGAVIVDRADLQTLGTSE
FT                   GGVAWVNNHRVQVVAAVDGLRGLGGVNVLASLATAREIAGDPGQGSTYFVARVRPGASA
FT                   KAVKQRLNQPTPSFGPYEAWTAREFARRSQRYWMFDTGAGAGVLFMAVIVCLVGSVVTS
FT                   QSLKAVVAASSREYAVLNALGVSRAALGRVVVEQACWIGGLGFVMAALASAVLLALAMA
FT                   YRVPVALNASAVLACAVLVAVLSLLSGLGAMRSLLRADPATLLR"
FT   gene            138528..139286
FT                   /locus_tag="Daci_0127"
FT   CDS_pept        138528..139286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0127"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aav:Aave_4324 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32773"
FT                   /db_xref="GOA:A9BQS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQS1"
FT                   /protein_id="ABX32773.1"
FT                   /translation="MNVMNAHSPAPTAAPRTAPSLEAVRLCKSFLSGMVSVQVLQGLSV
FT                   SLYPGELSLISGPSGCGKSTLLSLMSGLQAPDSGHAMALGEDLGKLGTRALEKFRLRHT
FT                   GFVFQGFNLFPALTAIEQVQLPLGYMGLRSDEALRRAQQALDEVGLSHRSHMRPAELSG
FT                   GEKQRVAIARAMAKAPQLLFADEPTSALDAESGQRVIDILHRAARNHGTTVLCVSHDPR
FT                   LVRHADRVLGMEDGAIRSDWRQSCPIKEKE"
FT   gene            139283..140227
FT                   /locus_tag="Daci_0128"
FT   CDS_pept        139283..140227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0128"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   aav:Aave_4325 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32774"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQS2"
FT                   /protein_id="ABX32774.1"
FT                   /translation="MKHPLSGLSASTAGLAAALAAAALLAGCGPSHDAPANAGQASAKA
FT                   QQNGPASVAVARGKIEVEGGLLDLSPAVAGVVQQLSVKEGQSVQRGQLLLRLADDTGQA
FT                   DLAVAESEAQLAKARQKARAARLPQLKQTLSRWQAAAREGAADAQNVDEAAQALRDAQA
FT                   EIDVAAAEAQVAQRKLEQLRAQHKRQELRAPEAGTVVRLATHAGSQAVPGTPAVVLLPQ
FT                   RPLQVRAEINESFAAAVREGMRATVTLDADGAAQQQLPSARVLRISPVYGTARLQDDQQ
FT                   RGPVRVIECVLVFEQAPAAAVRVGQNVRVQFHE"
FT   gene            140220..140924
FT                   /locus_tag="Daci_0129"
FT   CDS_pept        140220..140924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0129"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); 2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase; PFAM: HAD-superfamily hydrolase subfamily IB
FT                   hypothetical 1; KEGG: aav:Aave_4326
FT                   2,3-diketo-5-methylthio-1-phosphopentane phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32775"
FT                   /db_xref="GOA:A9BQS3"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQS3"
FT                   /protein_id="ABX32775.1"
FT                   /translation="MNKRIPLYLDTAAPGWMVQSDFDGTISLLDVTDTLLNRFGKPGWQ
FT                   ELEDAWERGEIGSRECMKGQVALLDMDEAELRAHLDTIEIDPGFAGFVAAAQAHGMVVQ
FT                   VVSDGIDYAIRHVLERHGLGHLQVIANRLVQTGERSWRLDSPWASAQCARASGNCKCER
FT                   LAEQQALHGRVLYVGDSTSDFCVSGRADFVLAKYKLIAHCESRGIAHAPFEHFEQATSL
FT                   LDKVVLGLEALA"
FT   gene            140921..141862
FT                   /locus_tag="Daci_0130"
FT   CDS_pept        140921..141862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0130"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: aav:Aave_4327
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32776"
FT                   /db_xref="GOA:A9BQS4"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQS4"
FT                   /protein_id="ABX32776.1"
FT                   /translation="MNMADGFDAVQRSEPATGLDNVCVTEHEFVMPGTGVAARTGVLLV
FT                   HGLTGTPAEMRLLAKGLNKQGFTVYAVQLAGHCGSMEDLVDTRWTDWLASVEAGLQRLS
FT                   QHMDHVVVGGLSMGAVLSLAVAQRHPDKVDGVCALSTTFRYDGWSIPFYTRLAFLLPLF
FT                   RALGIGRHSVFMKQPPYGIKDEALRARVVEQMHSGDSAAAGLPGNPWWSIIELRRLSAH
FT                   VLARLPQLRSPCLVIHARNDDISSVANAHDIVHGASQAHVELVLLDNSYHMVTIDRDRR
FT                   TVIARTTEFVARIASGAAPREVRAAEAARHGQ"
FT   gene            141852..142220
FT                   /locus_tag="Daci_0131"
FT   CDS_pept        141852..142220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_4328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32777"
FT                   /db_xref="GOA:A9BQS5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQS5"
FT                   /protein_id="ABX32777.1"
FT                   /translation="MGSDLSPLVITLWVLNVLVDSGGQLAFKAAASQPGDLDGLARWRF
FT                   MASRPWLWLGVGCYVAEFVLWLAFLSLVPLSEGVLLGSINIVAIMIAGRLLFAEKLAPM
FT                   RVAGIVLVSIGVAIVGLH"
FT   gene            142385..142879
FT                   /locus_tag="Daci_0132"
FT   CDS_pept        142385..142879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_4329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32778"
FT                   /db_xref="GOA:A9BQS6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQS6"
FT                   /protein_id="ABX32778.1"
FT                   /translation="MKRFYFIGFLVLMAFDTLAQLSFKQAGNAALPLEFSTAWLARVFG
FT                   QPWIYGAFVGYIGAFFSWMTLLKRAPIGPAFAASHLEILSVLALSYWLFDERIGMPQII
FT                   GCLFIVAGIACLAVSETQEAEGPGADDDTPGHAGGNPGAGSASAGAAHLAASAEHGTHR
FT                   G"
FT   gene            142872..144098
FT                   /locus_tag="Daci_0133"
FT   CDS_pept        142872..144098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0133"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   aav:Aave_4330 DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32779"
FT                   /db_xref="GOA:A9BQS7"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQS7"
FT                   /protein_id="ABX32779.1"
FT                   /translation="MAERVLPPTAGLPLRAADLLPWGDADLATALAQWLGVPAVQLECS
FT                   GTSALMVALQTLRRLAPGRSEVIAPAYTCPLVALAVAHCGLQLRLCDLHPDTLDMDPAR
FT                   LRSLCSECTLAVLPTHLCGRVADVATAVDCARAVGAWVVEDAAQALGARLRGEPVGWQG
FT                   DVGFYSLAVGKGLTTFEGGVLLARDPALREALRETHAASVRQDRGWELRRSLELLGYAA
FT                   LYRPAGLDLAYGRPLRAALSRSDWVQAAGDDFDDAIPCHELGAWRRRVGRRALARLADF
FT                   QQQLQRQARERGAWLSAIDGIEVVGDTVPGAQGVWPVLLLRLRDAATRDALLRAQWGLG
FT                   WGLSLPFVHVLPDYGRYDHVLGLARQDVVDQGRDWAQRLVAVGNSLWFDDARFEALLSL
FT                   LEGPHAAPG"
FT   gene            complement(144061..145383)
FT                   /locus_tag="Daci_0134"
FT   CDS_pept        complement(144061..145383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0134"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   mes:Meso_3871 cyclopropane-fatty-acyl-phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32780"
FT                   /db_xref="GOA:A9BQS8"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQS8"
FT                   /protein_id="ABX32780.1"
FT                   /translation="MIDRLTERLLQRSFTPLVREGLLEICLPWGRMLAFGDGGQPQARI
FT                   RFTDRRALWALMRDPDLNLGEMFMQQRLVVERGSIYDVLELVLRNARNLPVPASVRLLD
FT                   AWRMRLRPLLQHNRRGKARANVAHHYDLDDRLYRLFLDGERQYSCAYFEHGDESLEQAQ
FT                   RAKMRHIAAKLLVEPGHRVLDIGCGWGGLSRYLAEVAGAGHVTGVTLSGEQLAGARQRA
FT                   GQSPCADRLSYRLEDYRDTRGTFDRIVSVGMFEHVGTRFHDAFFRQCRELLSDDGVMLL
FT                   HFIGNSDVPDFNNPWIERYIFPGGHIPSLSEFTPAIERSGLVVTDIEVLRLHYARTLRL
FT                   WRERFMARRDEAAALYDERFCRMWEFYLSMSEAAFRYQDIAIFQVQLARRQEAVPLTRD
FT                   YVAERSQALRGREPPPGATTQPGATQAAAVSQARRAAPPAD"
FT   gene            complement(145461..146372)
FT                   /locus_tag="Daci_0135"
FT   CDS_pept        complement(145461..146372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_4331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32781"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQS9"
FT                   /protein_id="ABX32781.1"
FT                   /translation="MERTELNAQPVVLDVDGSVGTLPGELRLPLQDWQEQVRFGCGLRR
FT                   FAQFRAALDAQLPASHGTALMGSGDFHHLSWPLIERCITAQALSAGRPLRVVVLDNHPD
FT                   NMRFPWGVHCGSWVRRVALHPAVSHVHVAGITSGDIGRAHAWENYLTPLRAGRLSYWSA
FT                   GVDTGWARRLGVDAAFRGFASVADLSRTLARMLREQAQPTYLSIDKDVFAPEVVRTNWD
FT                   QGRMQEGEALDIIGALAGQIVGSDITGDVSSWRYTTWWKRWMSAGDGQDTQIDAQTLAT
FT                   WQLGQHAFNERLVEYIQTCTSP"
FT   gene            complement(146354..147427)
FT                   /locus_tag="Daci_0136"
FT   CDS_pept        complement(146354..147427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_4332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32782"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQT0"
FT                   /protein_id="ABX32782.1"
FT                   /translation="MPAERLHNQLEPPGLLAQFAAHPPEGFALLQDWPAPAFTAPFDLL
FT                   TTADDALKARLLSLPGGGWLSRRLRLSTDFVGTTVSEYAVLPMGIPAARQAAALRARAG
FT                   RRMLTIVKDLPQDSPLLPDADNAHARALAQALADAGFILVEGQALAHVPIDFSSLDEYL
FT                   ARLSRSRRQNLRRKLRSRAQLQVQRIPTGAAFADDVCVDAYYALFDAVYAQSEIHFDKL
FT                   TRDFFAALLRDAGNGGTVFEYRALQDDGTPGALLGWNLCFEHGGKLIDKYIGLSYPAAR
FT                   EANLYFVSWMVNLEYAIERGLSHYVAGWTDPEVKAQLGASFTFTQHAVFIRNPLLRALG
FT                   RRFAGHFESDRQWSEQN"
FT   gene            complement(147435..149063)
FT                   /locus_tag="Daci_0137"
FT   CDS_pept        complement(147435..149063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0137"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   aav:Aave_4333 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32783"
FT                   /db_xref="GOA:A9BQT1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQT1"
FT                   /protein_id="ABX32783.1"
FT                   /translation="MLASCRPVRGVLLRDHCSPVCDCSCWLSVILPSIDNDYHLFCLIY
FT                   VTGADPGSARASSTNPTQRLDSAARLPAHTAAAEYLEPFAVINNAQLLADEAKYCSFGD
FT                   TVHYVNPPKIFSGCEGSYMYDEAGTPYLDLQMWYSAVNFGYKNKRLEQKMIEQLQTLPQ
FT                   VASQYLHPTKIELAKFIAQDAERKWGHAGRVHFNVGGAQAIEDSLKVVRNASGGKSLMF
FT                   AFEGGYHGRTLGASSITSSYRYRRRYGHFGDRAQFIPFPYPFRRPKGMTSEEYADSIVR
FT                   EFARKFENEYHAIWDPKTNQCEYAAFYVEPIQGTGGYVVPPPNFFKGLKKVLDDHGVLM
FT                   VVDEIQMGFWRTGTLWSVENFGVKPDVLVFAKALTNGLNALSGLWAREELINPTIFPPG
FT                   STHSTFASNPLGTALGLEVMKMTHEMDFGRQVRESGAYFLEGLKELQKRHKEIGDVDGL
FT                   GLALRAEICTEDGFTPNKALLDKMVDIGLEGGLEYQGQKRGLVLDVGGYYKNVITFAPS
FT                   LMISRPEIDEAMVLLDQLLTKAKAA"
FT   gene            149086..151518
FT                   /locus_tag="Daci_0138"
FT   CDS_pept        149086..151518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0138"
FT                   /product="TonB-dependent hemoglobin/transferrin/lactoferrin
FT                   family receptor"
FT                   /note="TIGRFAM: TonB-dependent
FT                   hemoglobin/transferrin/lactoferrin family receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: kpn:KPN_03087 outer membrane porin, receptor for
FT                   ferric enterobactin and colicins B and D"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32784"
FT                   /db_xref="GOA:A9BQT2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQT2"
FT                   /protein_id="ABX32784.1"
FT                   /translation="MAVSSRSSFLSLSRNPSRTPVLRPSLLAVAVQAAVIGLASPGAWA
FT                   QTQTQTQTHVQTADDEARLMAQAPTKALAQVDVVDAAEPVQRTPGASTTVSGPALEQAG
FT                   SMADVVRYQPLVSAPGTASGTSRNRSSFDRSGTTGYNIRGIEGNRIGMDVDGVEMPDAT
FT                   TRPYVSRVGANTFGVGRDFIDPEMFSAVDILSGTTTARRAAGGIGGSVGFRTKSAEDYL
FT                   VGGKTSYLGGKIGHDTADRSWNESFTAAGRSGDLDGLIAYSRRDGHETRNHSAIVNSYP
FT                   DDWNSNALLLKGGLRINPAHRLVLSADLYRRKNDTSFHGWDTTNTSITESSRQNSDTSR
FT                   NTLQLQHLWTPAGAWVDQLDTRLYFQNTDTNDVTDTTTLATGAKVHNVSGNETRTWGFS
FT                   STGDKRIDRHRLSFGVNASTQDTERPWNVFATGTPVMKPQPDTTTRRYGAFLQDEISFQ
FT                   AGGRRLALIPALRVDRVEIKTRDLDNFVSGVLTAADVEKIYGGTRGNTILSPSLALVYD
FT                   LTPTFSAYAQFKRSGRVPSAGEIFGSWNMASNYNAAGQYALVGNPNLKEESSNAFDFGL
FT                   KGSPTPGVTFNSSVFYTRYSDFIAYTRYLRAGRPDLFVNVPAHIGTIYQAENRDSAKIY
FT                   GFEASARLDHGQWMPAARGLYSTWALGISRGTSKSYYAGDKDVPLDSVLPRKAIVGVGY
FT                   DAPARQWGLNLTGTFVAGKQAVATNRDSYLNAGTGLTDSTTELFRVPGYAIFDLAGYWQ
FT                   VAKNVRLNAGIYNLGDKRYWDYSSTRSLQPGVARDRRDIELLSNPGRTFAVSMNVAF"
FT   gene            151691..152179
FT                   /locus_tag="Daci_0139"
FT   CDS_pept        151691..152179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccr:CC_2193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32785"
FT                   /db_xref="GOA:A9BQT3"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQT3"
FT                   /protein_id="ABX32785.1"
FT                   /translation="MIEFSLSHRMLAAAGLAALLTACASPTAPSASGPAQPAGGHGQSA
FT                   FMGSYDANRDGVVTRQEYDTVRKQRFLAGDTNGDGWLSEKEYVDEFEARLKQQYAGRQP
FT                   DERYAQSMKQAHVRFGIVDRNRDGKYTVEEDMAIAERSFKEADVNADGVVDKNDVKKP"
FT   gene            152186..152995
FT                   /locus_tag="Daci_0140"
FT   CDS_pept        152186..152995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_1336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32786"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQT4"
FT                   /protein_id="ABX32786.1"
FT                   /translation="MAKTPSKRLAWWLPLLSAVCISAQAHTPYLLPTSFEASPRAVISV
FT                   DASFADKFFIPEVAFGETRFTVTAPDGSVTPMADVRQFKTRTVAEHQLPDEKGTYRVST
FT                   GPRLGAVFRSWERNGKVETARDPATPTPADARLLSHYQSLSVSETYITVGKPSRAALAP
FT                   SGKGLEIVPVTHPADLFAGEKFDFTVQYDGKPLAAQKVEIFRSAMDLASQHSVDALTTD
FT                   GEGRISYALPKSGIYLALVRYRADAPAGAAAPQYGNNYTLTFRVLAQ"
FT   gene            complement(153096..155129)
FT                   /locus_tag="Daci_0141"
FT   CDS_pept        complement(153096..155129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0141"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: aav:Aave_0181 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32787"
FT                   /db_xref="GOA:A9BQT5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQT5"
FT                   /protein_id="ABX32787.1"
FT                   /translation="MAAVAASGPQRIFCGKRPHPAPSRASRLCRKKSPLSAAHSVLQAV
FT                   FGYEQFRGPQEAIVSHVVAGGDALVLMPTGGGKSLCYQVPAIVRQQQGHGVAVVVSPLI
FT                   ALMHDQVGALHEAGVSAAYLNSTLSYDETQEVEWRLQSGDITLLYAAPERLNTPRFLGL
FT                   LDDLHAQGKLSLFAIDEAHCVSQWGHDFRPEYRALSVLHERYAGVPRIALTATADALTR
FT                   ADIVERLQLESARHFVSSFDRPNIRYRIAEKKDVSNQLLRFIEREHEGEAGVVYCQSRK
FT                   RVEELAQTLSQAGVPALPYHAGLPFETRQLHQDRFLREDGIVIVATIAFGMGINKPDVR
FT                   FVAHVDMPKNIEGYYQETGRAGRDGLPADAWMAYGLSDVVNQRRMIDESPAEDTFKQVM
FT                   RGKLDALLGLAEATDCRRVRLLAYFGEQYGLGAPGEDAETDLEGRPLQRVAKTACGNCD
FT                   NCMEPPALWDGTDAARKLLSTIYRVHEASQLTFGAGHIMDVLRGKDTEKVRQYGHDKIS
FT                   TFGLGKDYSEPQLRGVMRQLLATGALGLHKITSENSGHSFDTLCLADGSRDVLRGNVPV
FT                   QLREAVAAPRTRTSKRATQPNAAAASLGPDAQVRFINLKAWRAEVAREHNLPAYVIFHD
FT                   ATLAAIAERNPASLDDLQGISGMGAKKLDAYGAEVLRVVATG"
FT   gene            complement(155248..156399)
FT                   /locus_tag="Daci_0142"
FT   CDS_pept        complement(155248..156399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0142"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: reh:H16_B0975
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32788"
FT                   /db_xref="GOA:A9BQT6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQT6"
FT                   /protein_id="ABX32788.1"
FT                   /translation="MNFQRLGTTADDHAIADAVARFADDALAPLAQRMDEEALSATCHV
FT                   PGLSALGVMGMNLPEALGGPGVTPTAMLLSLVAISRACAATSSMIGAHYLGTDAVLIGG
FT                   DDAQRQQWLPRCASGEWLAAFALTEPRGGSHPADMRTRAVRDGDDYLITGVKHFISNAA
FT                   EARFMVVFAKTDMDAGARGVSAFIVPRDLPGIQVSAPEKLMGIRGGHAFEVSLDGVRVP
FT                   ASHRLGAEGTGFKTAMKVLDNSRLDVAATALGVAEAALAAAAQWANQRLVGGEPLATKQ
FT                   GIQWKLADMKLRLEASWALTMQALALRQAGQPFTQHSAMAKLHASEMVGFVTDEALQIH
FT                   GGYGYTREMPLERLVRDARILRIYEGSSEVQRSIIARGVLGGS"
FT   gene            complement(156410..157651)
FT                   /locus_tag="Daci_0143"
FT   CDS_pept        complement(156410..157651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0143"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reh:H16_B0974 predicted acyl-CoA
FT                   transferase/carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32789"
FT                   /db_xref="GOA:A9BQT7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQT7"
FT                   /protein_id="ABX32789.1"
FT                   /translation="MTKSSPLTARPLDGVRILDFTRVLAGPLSTALLADLGAEVVKIEP
FT                   PQGDDYRAIGPMNNGESALFTVMNRNKQSLVLDLKHPEAVALVHEMAAQADVVVENFRP
FT                   GVAERLGIGASQLRALNPRLVYVSVSGFGQTGPLAHRPAYDIIVQAMSGLMEATGEPDG
FT                   APTVVGEAVSDVVAGLFASWATLAALLQARATGQGQQVDVAMFDTTLSFLATSVARYLF
FT                   TGRPARRVGNRHPLSAPFGVYRAGDGHFALAVLNNKLFAAALQAMELGSLAGDPRFASD
FT                   ESRSAHEPALREAIEAWAGRHEVAQVVAALDAAGVPAAPIWNIAQALESPQSQARGLLG
FT                   AVQDPRLPGLRLPTQPVHFSGAAPNRAERAPALGEHTDALLSQWLGRGAEAIAALRASG
FT                   ALGTAAAAPSSPSH"
FT   gene            157746..158636
FT                   /locus_tag="Daci_0144"
FT   CDS_pept        157746..158636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0144"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reh:H16_A0487 transcriptional
FT                   regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32790"
FT                   /db_xref="GOA:A9BQT8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQT8"
FT                   /protein_id="ABX32790.1"
FT                   /translation="MIQISLRQLEYFVAASRHGSTARAAEAIGVSQPSISKAIADLEAL
FT                   WGEALFVRRHARGLDLTAAGAVRSREAQALLGGARSLQGPRTAAMAGVLRLGFLSTLGA
FT                   RWVPALLAQMQRLHPGIALELVEGDIASLTQQVERGELDAALQYDTGLARPRMELLPVA
FT                   ALPPYVLLPQRHALAARTSVGLAEVARYPLVLINLPHSREYFLSLFREAGVTPLVAHEF
FT                   ASIEMLRSMVANGHGLSVLTTRPVVDRAHDGQRLACRRIRGRVAPQGVVLAVPAGNASP
FT                   LIAPFLKVARAVIAP"
FT   gene            158911..159885
FT                   /locus_tag="Daci_0145"
FT   CDS_pept        158911..159885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0145"
FT                   /product="substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="KEGG: aav:Aave_2969 substrate-binding region of
FT                   ABC-type glycine betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32791"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQT9"
FT                   /protein_id="ABX32791.1"
FT                   /translation="MSSIPTFRRLPLGPLAAALCLAAALQPAAAQETKITLGMSGWTGF
FT                   APLTLADKAGIFKKNGLAVDLKMIPQKDRHLALASGAIQCAATTIETHVAWNTNGVPIV
FT                   QIFQMDKSYGADGIAVRNDVKGFADLKGKTVAVSAPGTAPYFGLAWMLHKNGMTMKDVK
FT                   TVSLEPQPAAQAFVAGQNDAAMSYEPYLSTIRANPAAGKILATTIDYPMVMDTVGCDPK
FT                   WLKANAAAAKALAQSYFDAVAMIEADKTKSFEIMGAAVKQGGEQFGKSASYLKWSDKEA
FT                   NQKFFANELVPFMKESAVILKEAGIIRSIPENYGVMYDASFIQ"
FT   gene            159898..160788
FT                   /locus_tag="Daci_0146"
FT   CDS_pept        159898..160788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0146"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pol:Bpro_1046
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32792"
FT                   /db_xref="GOA:A9BPC5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPC5"
FT                   /protein_id="ABX32792.1"
FT                   /translation="MTMQAASTSAVQPANKPMTHATPHAPAPAAAPAPVRRRRMAPLEP
FT                   VSPTAKWVLGVAFFVLFFLVWAAVTLGGFVSPTFLASPMTMAREGVLLFTEYGFLHDIG
FT                   MTVWRVMGGFILASVVAVPLGIAMGAWKPVEAFFEPFVSFCRYLPASAFIPLLILWAGV
FT                   GETQKLLVIFIGSVFQITLMVAVTVGGARKDLVEAAYTLGASNTGVVRRVLIPGAAPGI
FT                   AETLRLVLGWAWTYVIVAELIGSSSGIGHMITDSQALLNTGQIIFGIIVIGLIGLVSDF
FT                   IFKSLNRRMFEWSTL"
FT   gene            160788..161567
FT                   /locus_tag="Daci_0147"
FT   CDS_pept        160788..161567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0147"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_1045 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32793"
FT                   /db_xref="GOA:A9BPC6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPC6"
FT                   /protein_id="ABX32793.1"
FT                   /translation="MNLLSIQGVSRTFTSHKGTSTQALLPVDFEVRENDFVTILGPSGC
FT                   GKSTMLRIAAGLDFPTTGQVLLDGRAVDGPGADRGMVFQSYTLFPWLTVAQNIRFGLRE
FT                   KGVSEALQKERSDYFIAKVGLRGFENHFPKQLSGGMQQRTAIARALANDPKILLMDEPF
FT                   GALDNQTRVLMQELLLGIWEAERKTVMFVTHDIDEAIFMANRVAVFSARPGRIKADIPV
FT                   NLPHPRHYTVKTSPEFMELKARLTEEIRAESLAAAAH"
FT   gene            161577..162365
FT                   /locus_tag="Daci_0148"
FT   CDS_pept        161577..162365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0148"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="TIGRFAM: histidine utilization repressor; PFAM:
FT                   regulatory protein GntR HTH; UbiC transcription
FT                   regulator-associated domain protein; KEGG: aav:Aave_2966
FT                   transcriptional regulator, histidine utilization repressor,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32794"
FT                   /db_xref="GOA:A9BPC7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPC7"
FT                   /protein_id="ABX32794.1"
FT                   /translation="MTTAHTMSSRSTASRLSATTAEVPMALYQQVKDHVLRKIADGSLS
FT                   AGERVPSEQELVQEFGVARMTANRALRELAEQGVIVRVAGVGSFVAEEKPQSTLLRIAN
FT                   IAEEIRQRGHDHRFELISVRRESASPEAAASLQLSAGSSVFHLQGVHFENDVPVQLEDR
FT                   HVNPRMAPDFMEQDFSLIQPSVYLVRNVPFDQIEHVVDAMLPTPEQARWLQMDADQPCL
FT                   TLTRRTWYLGTPVTWVHCVHPGMRYRLGSRFRTDGGSHDG"
FT   gene            162479..164050
FT                   /locus_tag="Daci_0149"
FT   CDS_pept        162479..164050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0149"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: aav:Aave_2965 histidine ammonia-lyase;
FT                   TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32795"
FT                   /db_xref="GOA:A9BPC8"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPC8"
FT                   /protein_id="ABX32795.1"
FT                   /translation="MNTITTPGLTSRPGTALTLQPGQVSLAQLRAIQQGGVRLSMAASA
FT                   YERMRAAQAHVQHIVDEDQVVYGINTGFGKLASTKIAHDRLAELQRNLVLSHSVGTGDP
FT                   LPDAVVRLVLATKAVSLARGHSGVRPELVDALLALANADVLPVIPAKGSVGASGDLAPL
FT                   SHLACVLIGEGQAKIDGQVVSGTEAMRHLGLEPFVLGPKEGLALLNGTQVSTALALVGL
FT                   FQGESVFAAGLVAGCLTLEAIKGSVKPFDARIHEARGQLGQIAVAAAVRELLDGSAIDT
FT                   SHPHCGRVQDPYSIRCVPQVMGACLDNLSHAARVLVIEANAASDNPLVFDNGDVISGGN
FT                   FHAEPVAFAADIIALALAEIGAISERRMALLLDTGLSGLPAFLIADSGVNSGFMIAQVT
FT                   AAALAAENQCLAHPSSVTSLPTSANQEDHVSMATYGARRLGEMARNTAVIVGVEAMAAA
FT                   QGMDFDRSLNSSELIEAQYALIRSQVPHLDRDRYLAPDIETMRQWALATDWPQAIVRHL
FT                   PSLQAA"
FT   gene            164090..165823
FT                   /locus_tag="Daci_0150"
FT   CDS_pept        164090..165823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0150"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: aav:Aave_2964 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32796"
FT                   /db_xref="GOA:A9BPC9"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPC9"
FT                   /protein_id="ABX32796.1"
FT                   /translation="MNANDAILNANAATAATNPRYDASRVIRAPRGSELHCKNWLAEAA
FT                   YRMLQNNLDPDVAENPKALVVYGGIGRAARNWECYDQILESLKKLEADESLLIQSGKPV
FT                   GVFKTHENAPRVLLANSNLVPQWANWEHFNELDQKGLFMYGQMTAGSWIYIGAQGIVQG
FT                   TFETFVEAGRQHYNNDLTGKWILTAGLGGMGGAQPLAGVLAGACVLAIECQQSSIDFRL
FT                   RTRYLDKQARDIDHALELIAQHTAAGEAISIGLLGNAAEILPELVRRAQAGGARPDIVT
FT                   DQTSAHDLINGYLPVGWTVDEWRAAAADPSRHAQLKAAAAQGCAQHVQAMLDFQAMGIP
FT                   TVDYGNNIRQVALDQGVKNAFDFPGFVPAYIRPLFCEGKGPFRWVALSGDPEDIYKTDA
FT                   KIKELFPDNKHTHRWLDMARERISFQGLPARICWLGLGERHKAALAFNEMVKNGELKAP
FT                   IVIGRDHLDCGSVASPNRETESMKDGTDAVSDWPLLNALLNTAGGATWVSLHHGGGVGM
FT                   GYSQHAGVVIVADGTDEAAARLGRVLWNDPATGVMRHADAGYDIAVAAAKRHQLNLPMV
FT                   K"
FT   gene            165829..166407
FT                   /locus_tag="Daci_0151"
FT   CDS_pept        165829..166407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0151"
FT                   /product="protein of unknown function DUF886"
FT                   /note="PFAM: protein of unknown function DUF886; KEGG:
FT                   aav:Aave_2962 protein of unknown function DUF886"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32797"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPD0"
FT                   /protein_id="ABX32797.1"
FT                   /translation="MQDTTAMQRFDLNQIAASPWKNGGGSTREIACWPPGAGMEAFGWR
FT                   ISVATIDQPGPFSAFAGVDRQIMLLDGDGVHLRGEGIDHVLDARWQPFAFSGDVALGCS
FT                   LLGGTSTDFNVMARRGRWRAQVQVLDSAADAGRADAGLCMVLQGNWQADGAALIPGQGL
FT                   WWSAQQPDPQQLVPQTDDARLVQVLLQAC"
FT   gene            166437..167732
FT                   /locus_tag="Daci_0152"
FT   CDS_pept        166437..167732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0152"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="KEGG: aav:Aave_2961 imidazolonepropionase; TIGRFAM:
FT                   imidazolonepropionase; PFAM: amidohydrolase; Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32798"
FT                   /db_xref="GOA:A9BPD1"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPD1"
FT                   /protein_id="ABX32798.1"
FT                   /translation="MTEPHAPASASACALAPSSSADGCWQNLRLAPDMFEAGQAVGDGE
FT                   DACIVVQQGRVAWVGPQQALPPAYASLPRHDGQGMLATPGLVDCHTHLVYGGERANEFA
FT                   MRLDGASYEEVARAGGGIVSSVRATREASEDELFAQALPRLQQLLDEGVCAIEIKSGYG
FT                   LALEHERKQLRVARRLGQTLGVTVRTTFLGAHALPPEYAGRSQDYIDLVAGTMLPALAA
FT                   EGLVDAVDVFCERIAFSLAETEQVFQAARRLGLPVKLHAEQLSNMEGAALAARYGALSC
FT                   DHIEHLSESGITAMRGAGSVAVLLPGAYYTLHDTHMPPIAGLRAAGVPMAVSTDHNPGT
FT                   SPCLSLLLMANMACTLFRLTVPEALAGITRHAARALGLQDEHGLIAAGRPAHFVLWPVR
FT                   HVAELAYWFGSKPDCTIVRQGRIVRTRRQGSH"
FT   gene            167743..169131
FT                   /locus_tag="Daci_0153"
FT   CDS_pept        167743..169131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0153"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bxe:Bxe_B1817 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32799"
FT                   /db_xref="GOA:A9BPD2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPD2"
FT                   /protein_id="ABX32799.1"
FT                   /translation="MPHALFLDELISTLGAEVAQRGDDVPARYHTDWSGTPPQRPLALV
FT                   RPRSTDEVSALMRLCTAHRVPVVPQGGLTGLAGAAVPVAGAVAVSMERMNAIEDVNART
FT                   ALMTVQAGATLQAVQEAAVAAGMVFGVDLGARGSCQIGGNVATNAGGNGVLQHGMMREQ
FT                   VLGLEVVLADGTVLPMLRPMLKNNTGYDLKQFFIGSEGTLGIVTRVLLRLRPAPQARAT
FT                   ALVAVPDFDAALSVLARMQSRFGNGVAAFELMWDSFIQASIRWQKLQPPFGQAHALLAL
FT                   IDVDGKDEATLRADVEEALGEAMEAGEVADAVIAQSVAQARQLWKLREAPAELNTNMHP
FT                   PVNFDVSLPQADIGRFADACRAAFDARWPGHHSLFFGHVGDGNLHVSVDGATANGDCDG
FT                   VEAALYHLVGEFGGSVSAEHGIGLHKKPYLGASRTPAELAVMRAIKQALDPLHLFNPGK
FT                   VFDL"
FT   gene            169128..170273
FT                   /locus_tag="Daci_0154"
FT   CDS_pept        169128..170273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0154"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   aminotransferase class I and II; KEGG: gox:GOX1171
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32800"
FT                   /db_xref="GOA:A9BPD3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPD3"
FT                   /protein_id="ABX32800.1"
FT                   /translation="MNAPAIHAIHTLARPEVPPLPPYNAGLSSEAVRARYGVTEIARLA
FT                   SNENPFGASPAVARALADLALHVGTYPDAQCTALRAAIAVRTGVPAEAIAVGNGSEDIL
FT                   QMLCQAFLSPGDRVLTQRPAFGLHEIYPRMMGARVELLELTPALGFDVDAWCQALARGP
FT                   KIAMLANPSNPVGCMFSAGDFARLLDATPPQTLMVVDEAYYEYALHADGYPDVLALLRG
FT                   RAMPWIVLRTFSKAWGLAGLRVGYGLASDAALVQLLDRVRTPFNVNQAAQAAALAAWGD
FT                   EGFMQRGVAETVRLRDVLAQRLAALPALPALRMAPSAANFLFIDIGRPNGPVNEALLAR
FT                   GIITKPWKEPGFEHFIRVSVGTEADNERFVRALAEILEAGQ"
FT   gene            170270..171670
FT                   /locus_tag="Daci_0155"
FT   CDS_pept        170270..171670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0155"
FT                   /product="formiminoglutamate deiminase"
FT                   /note="TIGRFAM: formiminoglutamate deiminase; PFAM:
FT                   amidohydrolase; KEGG: vei:Veis_3649 formiminoglutamate
FT                   deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32801"
FT                   /db_xref="GOA:A9BPD4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPD4"
FT                   /protein_id="ABX32801.1"
FT                   /translation="MSGIDPTPDSRTLFAEHALLPTGWARNVLLRWDGAGRLLAVQADA
FT                   PPGSAPRAPGPVLPGMPNLHSHAFQRAFAGLTEYRAEAQDSFWSWRDLMYRFAARITPE
FT                   SLEAIATWLYVEMLEAGYTSVCEFHYVHHDRDGRPYADDATLSLALLRAARKAGMGITL
FT                   LPVLYQTSGFGGKPPRADQARFIRSTDNMLALLQRLLPEARAQGAALGLAPHSLRAVPP
FT                   DSLRVAVEGLAALDARAPVHIHIAEQTQEVDDCLAWSGQRPVQWLLEHAPVDARWCLVH
FT                   ATHMTPGEYAGAARSGAVAGICPTTEANLGDGIFDMPQWLGHGGAWGVGSDSHACVNAA
FT                   EELLMLEYSQRLSLRQRNVLAGSDPQVGTALWTAAVQGGAQAAGRSVAGLAVGQQADFL
FT                   ALDAGHVALAGLPVQAMVSAHVFGSHRSSALHSLWVGGERRVQAGRHALHEAAAHGFVA
FT                   ARAATLQS"
FT   gene            171685..172548
FT                   /locus_tag="Daci_0156"
FT   CDS_pept        171685..172548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0156"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase; KEGG:
FT                   aav:Aave_2959 N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32802"
FT                   /db_xref="GOA:A9BPD5"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR010247"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPD5"
FT                   /protein_id="ABX32802.1"
FT                   /translation="MGPQNPPETFQNHTMTDTAPPPFVFHQGTAPLLISMPHAGTHVPP
FT                   DIAARLTEEARHVPDTDWHLPRLYEFAKAMGASILVATHSRYVVDLNRPPDGASLYPGQ
FT                   SVTGLCPVDTFDDTPLYADPADVPTDAEIAARREAIWGPYHAQLRAELDRLKAVHGTVA
FT                   LWDAHSIRSVLPRFFEGKLPDLNLGTGKGTSCALELAEHLLAIAQTTPGHTAILNGRFT
FT                   GGYITRHYGQPEAGIHAVQLEMTQCSYMQEALPFDYLPERAEQIQPTLQRMLQAVLDFV
FT                   TTRRVS"
FT   gene            complement(172549..173052)
FT                   /locus_tag="Daci_0157"
FT   CDS_pept        complement(172549..173052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0157"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: redox-sensitive transcriptional activator
FT                   SoxR; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: bte:BTH_II1612
FT                   redox-sensitive transcriptional activator SoxR"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32803"
FT                   /db_xref="GOA:A9BPD6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPD6"
FT                   /protein_id="ABX32803.1"
FT                   /translation="MKTEDDPLLSIGDVAQRSGVKASALRFYESLNLIESVRSASGHRR
FT                   YHRSSLRRIAFVVFAQRIGFTLEEIAEQLAKLPSRHVPTGGDWQKMSRVWKQRLDDRIG
FT                   ELQRLSESLDQCIGCGCLSLRHCVLHNPGDLCAQNGPGPRRWLGDPPPVAMGGPCPGHC
FT                   HDEG"
FT   gene            173156..173659
FT                   /locus_tag="Daci_0158"
FT   CDS_pept        173156..173659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_4422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32804"
FT                   /db_xref="GOA:A9BPD7"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPD7"
FT                   /protein_id="ABX32804.1"
FT                   /translation="MRASWPDCEILWLSAAMTQLPFIHTVMGLICIEWHRPEVSMYIDS
FT                   SSFPLVRMGYERDKAVPVDRLLEDFSALLARGQAFVFFSDGDMSQEERSPEERKQVVLW
FT                   MKARRPELKSLVRALVHAEPDAHKRAEAEAFAQMFGKAWGYPMLLVASPEEAQQRAREL
FT                   LGSD"
FT   gene            173691..174524
FT                   /locus_tag="Daci_0159"
FT   CDS_pept        173691..174524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0159"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: pap:PSPA7_4421 putative HTH-type
FT                   transcriptional regulator YeaM"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32805"
FT                   /db_xref="GOA:A9BPD8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPD8"
FT                   /protein_id="ABX32805.1"
FT                   /translation="MNAVDSALLKVLPERWDPDHVDRPVIVLPMRSGPGDWGMNFHAHR
FT                   KSQLMVTHAGLITLETDAGVCVVPPRSAAWIPGGTLHRVSCSGAASGYVVFVEAGAVRP
FT                   VPGPCHALAVSPFLSALLDRVQGLPQDYEPDSGDGRLMQVLLDEIQAAQPEGLHLPLPH
FT                   DRRLRRMTNALCEQPQLQARLADWAQRIGMSERSMTRLFLAETGLTVNQWRRQLHVLTA
FT                   LQKLSEGLRIQTVADALGYESAPAFVTMFRKAVGTSPRRFLALRSAPVAGGGAGL"
FT   gene            complement(174545..176521)
FT                   /locus_tag="Daci_0160"
FT   CDS_pept        complement(174545..176521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0160"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.49"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); KEGG: hch:HCH_03958 retron-type reverse
FT                   transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32806"
FT                   /db_xref="GOA:A9BPD9"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPD9"
FT                   /protein_id="ABX32806.1"
FT                   /translation="MSQPQPTRAEIYERIKASSKQEVILDEMQRLGFWPKGEGQPQLAA
FT                   AHIQREGELQRELAELRQQIAVRQNPERALRQMRKERMQKALAQREETKRRQAQERHDK
FT                   ALAWHAKRATHVGYLGPGVSAALQGPQAGEAPPAAGERRQADPQRLARHGLPELADAAQ
FT                   LADAMGINVAELRFLGFHREVARTHHYHSFTLPKKTGGERLISAPMPRLKRAQYWVLDN
FT                   ILAKVPAHDAAHGFLAGRSIVSNAAPHAGHDVVINLDVKDFFPSIAFGRIKGVFRHLGY
FT                   GEAIATLLALLCSENRAQAWQVDGEKLFVGGKARERVLPQGAPTSPMLTNLLCRRLDRR
FT                   LLGLARQLGFVYTRYADDLTFSASGEAARDNVGRLLGRVRWILRDEGFTPHPDKERVMR
FT                   KGRRQEVTGLVVNADKPGVSRETRRRLRAALHRATQASAGKPAHWQGQAAQPSQLLGLA
FT                   QFVYQVDPVQGGPLLGQARQLTRSPIDRANDALLQASRQDRAAARAQPPASAQFRRLAA
FT                   SGQAPALASGKTWWQPAEPAAPVVEKTDQQRREQRLQEREAARAQAAAAARPAVDTQQQ
FT                   QPAQAPGPDAQAPGPSPMPGLLTYWAQIVICFLLGTVFQARLITLIGIVLVLLLRYRRI
FT                   RRWDVFAAAMVVAVLLGLGLRLS"
FT   gene            complement(176829..178556)
FT                   /locus_tag="Daci_0161"
FT   CDS_pept        complement(176829..178556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0161"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="PFAM: zinc finger SWIM domain protein; KEGG:
FT                   hch:HCH_03960 protein containing SWIM zinc finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32807"
FT                   /db_xref="GOA:A9BPE0"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPE0"
FT                   /protein_id="ABX32807.1"
FT                   /translation="MEFRYQYYGSTQVNDTAAEQAFSFAPDLLRPPTRFDGLLRRDGPA
FT                   YLQVREGLSALHSVVVSDLRTRGRDKTAYREWLQEHEAQMLATFMADTGGAQARAKEIS
FT                   AELKDLRETRNQVLSPFYKAQRKYFDWLFVANRDAWYVLDPVITVHPDRLLFEAFSQDE
FT                   SSYCAVSIRHEAFEHAGERICGTTNIDYSASLYEEFQKIRNYRDTRLTLDPAGFAVQVG
FT                   GDPALREEKIDLPDSWLRGFVQVSSAMALPATVLELHPMDLFNICARLRARRERHGPRA
FT                   LRFELAPGQPPAVVFEPWEERLATRRSHVVSDAMGTGGGTIRLWGRRRLLTLERLISQA
FT                   TRVRVHLLGSGMPSFWVIELGLVTVTLGLSGWSANDWAASARFHLMAPQAEVTPAQVEA
FT                   VGRQLQSCWQAGAQDLAQATGLSPAQVHTAMTRWMQAGRAVYDLDAGRYAWRELLREPL
FT                   TAQQLQPANPEEDKALALVRGKAIAPPRIDRKDGFSRITGQIPRADGKRLFDTQLELDA
FT                   DERLTDARCSCNHYQQYRLRQGPCEHMIALRLVAQPQLDAARQPTGPQMKAAGQGEIA"
FT   gene            complement(178588..181731)
FT                   /locus_tag="Daci_0162"
FT   CDS_pept        complement(178588..181731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03961 probable DNA binding protein
FT                   containing WGR domain"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32808"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPE1"
FT                   /protein_id="ABX32808.1"
FT                   /translation="MNLLAHATLSRPQGRNERISTVRVLALEMPGGDTTATAARHVVTL
FT                   QVTQLKAGVVAQVDDSTLTPLPQALEPARQRALAYLRQRLGAGDVLQSHEGFAELDAEA
FT                   GPAPSPGPAPGQATVPPGLPESALQAGAISALCKRLDGSAWRLMPSGQQARLVWRLAEY
FT                   ADPARGGAAQRLLHAQVPRLVALLGTGDDLLDYCLAYLIGRLGDGGAAVALQALSQRGT
FT                   SEATRDLAHQAWLALLEPQERQAALQEYQAQWAGIPPQENGPKEEGPQAEQAFFQALGP
FT                   QALLAADALGAYDGAVHQQLLAWMERIPFTRAWWPALRRIHKRAEWRRDHALLAVLHAR
FT                   FDGPRDEGAVFSRDTSLYLRLRGWRQLRRMASADHSESAAHAAALLQAMDRCCAGLPAS
FT                   RSGRLPESRWLIAARLLLPRWPQLHASARAHTWYTDEPLDLQQLPAQRVEGLSSMWDAH
FT                   PGQLLQLVGRSQSTLLLWSLTRALQDQKAFLDGLDAAATAPLLHKTYAPAAALGLQIAQ
FT                   QRMVSLTDDAARRPWLLALAQCGDGPAASYLGAWLSRDRAGAARDAELVAALLLSPAAS
FT                   SRTQGLALLFYADGAAVALALLAALPTLDAESPALADIRDAVQALFDGNGPLAAQAASV
FT                   PAPPLHRLLAHSVTALVEMATAWLLAHPLGLQTLPPAALRGLLESGEPARMACGIRLMG
FT                   SLADDLLCEQAAMLAEFAVSPHAALRAAAAPLVERLAGIPLYNTRCNAQIAERLHEVLF
FT                   RAEKAEGVHDAALRLLTGPLAAVAPARDASGIWRALQAQAKGAQRYGAWGLKALDLQAY
FT                   TLRQWSTLARHADADVRALSRQSIDARLTPMDRTLPEQAEQLLPLADALFADTQQYARE
FT                   MFGQRLPDGALSPQLLLGWVDHAQPWVQALGRQRLAQHMSAPEASLFLTRLAQHPATSV
FT                   QLFVTQWLLALPDEPAPQRAARLQELQPYFLAVLSQVHRARASKTRVLHFLRSQVQAPE
FT                   TAAVVAAIFARQVVSASHADQPDYVAGLRDIVQRHPQLAQSFMQPLAAERRGQAPSST"
FT   gene            182181..183395
FT                   /locus_tag="Daci_0163"
FT   CDS_pept        182181..183395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0163"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bch:Bcen2424_4746 efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32809"
FT                   /db_xref="GOA:A9BPE2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPE2"
FT                   /protein_id="ABX32809.1"
FT                   /translation="MPVLPPPPLRRALFGGALAALALLAGCRPQAVGDAHASDGPPPAP
FT                   EVLVSEVVPASVRVWDEFNGRIDAVESVQLRPRVSGYIERIAFSEGQEVRKGQLLFVID
FT                   QRPYRAALASAEAELERTRAGAALARTQDQRARQLVAEHAVSREEADTRAGALAQSAAQ
FT                   VRAAEAALAAARLNLDFTEVRAPVSGRAGRALLTVGNLAQADQSVLTTVVSQDPVYVYF
FT                   DADEHSFLRQQQAAKDTKGRPGVQRPVRVGLAGDEGFPHAGSLDFTDNQLNAGTGTVRM
FT                   RARLPNPDRLLTPGLFARVQLQDAQGAGGERQTLLIDDKAVLTDQDRKYVYVVGEGNKA
FT                   ERRDLELGRMVDGRRVVDKGLAAGDSLVVGGLQRIYYPGMPISPKPAPGDGQAAVAKAP
FT                   AVAAQ"
FT   gene            183409..186603
FT                   /locus_tag="Daci_0164"
FT   CDS_pept        183409..186603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0164"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   bch:Bcen2424_4745 transporter, hydrophobe/amphiphile
FT                   efflux-1 (HAE1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32810"
FT                   /db_xref="GOA:A9BPE3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPE3"
FT                   /protein_id="ABX32810.1"
FT                   /translation="MDFSKFFIDRPIFAVVLSIILFAVGLVAIPQLPVGEYPEVVPPSV
FT                   VVRATYPGANPKEVAESVAVPLEEAINGVEGLMYMKSVAASDGSLQVVSTFRPDVDPDT
FT                   AAVRVQNRVSQAQSRLPEEVRQFGVTTQKQSSTPLMYVGLVSQDGQHDALYLRNYVTLK
FT                   IKDVLARIPGIGDVGIYGAGDYAMRVWLDPDKVAARQLTAPEVIAAIREQNIQVSAGQL
FT                   GAQPSPQSADKLLSINVRGRLKTPEEFGSIVLKGGADGQVVRLADVARIELGASDYTLR
FT                   SWSDKKNMAAVGIFLSPGANALGVAEQVYAAMDKLSQDLPEGVAFETVWDPTVFVRDSI
FT                   KAVQSTLIEAVILVVLVVIVFLQTWRASIIPLLAVPVSIVGTFAGLYLLGYSINTLTLF
FT                   GLVLAIGIVVDDAIVVVENVERYIEEGHTPLEAAHLAMKEVSGPIIAIALVLCAVFVPM
FT                   AFLSGVTGQFYKQFAVTIAISTVISAINSLTLSPALAAKLLQPRGAPRDPLARGLDRSL
FT                   GWLFRPFNRFFDRSAHGYQNSVGHSLRRRGLVFAVYAALLAGTAVLFQAVPGGFIPLQD
FT                   KLYLFGGAKLPEGASLNRTDAVTRQMVDAAKSVEGVDMVAAFAGFNALQSTTTPNLTSA
FT                   YIMLKPFGERTRSAEAINAELGAKFSQIEGGFAYALMPPPIQGLGNGSGYSLFLQDRAG
FT                   LGYAALQQALQAFQAEIAKTPGMTYPVSSYQSNIPQLEVKVDRTKAKAQGLALTDLFQT
FT                   LQAYLGSVYVNDFNAFGRVWRVMLQADADHRQTVEDIASLRTRNARGEMVPIGSMVTVV
FT                   PSFGPDPVLRYNGFPAADLIGDSDPRVLSSGEVLAKLQEIAQRTLPRGIELAWTDLSYQ
FT                   QVEQSNAAAVVFAIAVMLVFLVLAALYESWTLPLAVILIVPVCICAALFGVWLAGGDNN
FT                   VFVQVGLVVLMGLACKNAILIVEFARELELRGVGIVDAALQACRLRLRPIVMTSIAFIA
FT                   GAVPLLIGGGAGSEVRAATGVTVFSGMLGVTLFGLFLTPVFYVTLRRLSGRALTGHAPA
FT                   HSTGPAQPASLESPHA"
FT   gene            186596..188029
FT                   /locus_tag="Daci_0165"
FT   CDS_pept        186596..188029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0165"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bch:Bcen2424_4744 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32811"
FT                   /db_xref="GOA:A9BPE4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPE4"
FT                   /protein_id="ABX32811.1"
FT                   /translation="MPEIRKSLSRHALALASAALVGGCAVGPDFKAPAAPRAAAQFARA
FT                   EPAPATPQAEPDAAFWRQFQDPQLTQLVERALGDNQDLQVALARLDGAQALLRESRFDQ
FT                   LPTVTMSGRATQQKLSESEAFYGPRSQRSYTAGLAASWEIDVFGRVRRSIEARHADLRA
FT                   DAADLAALQVAIAAQVAGSYADLRGWQQRLALAQANAANQQDTLRLVQLRLAHGSGTEF
FT                   DLARAQAQLEATRSRIPALQAQIAMAQHRLAVLTGQVPEALIAVLDVPAALPQLPPAID
FT                   PGTPAGLLRRRPDVAVAEARLHAATARIGVATADLFPRLSLGGLLGSTALHGGSLFEGA
FT                   SARSSVFLGVDWSFLDVGRVRARIAASEAGAQAALAQYQQTVLLALEDTENALVRLQRT
FT                   RSEDAHLAQAAEQRQRAEQLAQRRYQLGSVGLYEVLDAQRDLYAAQDAAADSRARGLRA
FT                   AVALYQALAGGWDGKLPPA"
FT   gene            188179..189336
FT                   /locus_tag="Daci_0166"
FT   CDS_pept        188179..189336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0166"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pfl:PFL_0805 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32812"
FT                   /db_xref="GOA:A9BPE5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPE5"
FT                   /protein_id="ABX32812.1"
FT                   /translation="MMESQVLDFAVIGAGMAGASVAWRLAGGGASVLVLEREPQPGYHA
FT                   TGRSAAMFMESYGTAQIRALTRASRGFYSAPPEGFCEHALLQPRSVLYIGTAGQEPQLD
FT                   EALAMYRRDGLRAERIDARQACALVPCLQESLLVGAVHDLDAMDIDVAELHQGFLRGMA
FT                   RAGARLRCGAELSGAEREVDGDGQGLWTLVLQDGSQVRARAVVNAAGAWADAVARLCGA
FT                   RPLGIEPRRRSAFTFAAPEGEDIHGWPAVIGVDESFYFKPDAGQLLGSPANADPVPPHD
FT                   VVAEELDVAMGIDRIETLTRLRIRRPRHVWAGLRSFAPDDDFVIGWDAQREGFFWLAGQ
FT                   GGYGIQTAAGASAAAAALLMREPLPAELLAQGVDALRLSPARFAA"
FT   gene            189398..190483
FT                   /locus_tag="Daci_0167"
FT   CDS_pept        189398..190483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_0803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32813"
FT                   /db_xref="GOA:A9BPE6"
FT                   /db_xref="InterPro:IPR038728"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPE6"
FT                   /protein_id="ABX32813.1"
FT                   /translation="MGAFKEVSRIAGAFVGVIVGAGFASGQEILQFFAGFGAIGLAGCL
FT                   VAALAFVFLSMAFSTMGQRLQAGSHKEVVQALLGRHVGMVFDVLITFFLFAITVVMLAG
FT                   AGSLLHQWLGLPEVWGSVLATVATVLIVCLDVGRVIAFIGAVTPLLVFMTVVVAGYVLL
FT                   TPHGDMAALEAAAASQPRGAGHWLVAALLYVSYNVVAGMPFLVIMGGQASSRRVALWGG
FT                   VAGGLLLGLLMLMIAAAMYWRMDTLGGLSMPMLSLATQISPWLGHLMSLVIFGMILNTA
FT                   VGMLYAFVARILPAGTPRFRWGTGVAGVLALGGSFAGFITLVGMVYPVYGYIGFALMAC
FT                   ALVGWLRMGRRQAPGAGLRGA"
FT   gene            190537..191220
FT                   /locus_tag="Daci_0168"
FT   CDS_pept        190537..191220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0168"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: pol:Bpro_1469
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32814"
FT                   /db_xref="GOA:A9BPE7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPE7"
FT                   /protein_id="ABX32814.1"
FT                   /translation="MPSPRTRSSPRSSPRSSTLPTPDQVLAAVLPGARTAAAMPAGKHE
FT                   VGAKLRKARKERGLTLQQVAESSGLAVSTISKAERGQIALSYEKVLMLGNALDIDMTRL
FT                   FMVGDAQQAAGDTPTVVKDCFEDVQRYETDQYLYSVLCGAFPGKKMQPLVAVINAREAG
FT                   EFSETIRHAGQEFVMVLSGRVRILFENGESVELGRHEAAYFDSGVGHVYVSLSRQPAQV
FT                   VSVCT"
FT   gene            191412..192518
FT                   /locus_tag="Daci_0169"
FT   CDS_pept        191412..192518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0169"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   aav:Aave_0174 methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32815"
FT                   /db_xref="GOA:A9BPE8"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPE8"
FT                   /protein_id="ABX32815.1"
FT                   /translation="MPGTAAPEFLQSLPMSLPQYTRAKELPAILAKRLVILDGAMGTMI
FT                   QRFKLGEAQYRGQGYTGPGSVGDRFKDFPHDVKGNNELLSLTRPDVIRDIHDKYLAAGA
FT                   DLIETNTFGATTIAQDDYHMADLAREMNLKSAQLARAACDKYSTPGHPRYVAGALGPTP
FT                   KTASISPDVNDPGARNVNFEQLRQAYLEQTLALIEGGADVILVETIFDTLNAKAALFAV
FT                   DEAFEQSGECLPIMISGTVTDASGRILSGQTVTAFWHSVRHANPLSIGLNCALGAALMR
FT                   PYVQELNKAAPETFISCYPNAGLPNPMSDTGFDETPEVTSRLVHEFASEGLVNIVGGCC
FT                   GTTPDHIGAIAKAVGSTPTRRLFYPESA"
FT   gene            192541..193977
FT                   /locus_tag="Daci_0170"
FT   CDS_pept        192541..193977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0170"
FT                   /product="putative Fe-S oxidoreductase"
FT                   /note="KEGG: aav:Aave_0187 putative Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32816"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPE9"
FT                   /protein_id="ABX32816.1"
FT                   /translation="MSSPLPPVPSPAAGLPLPVAAPVPGPAAGAPVAPQAPSAAVAPAS
FT                   PASPTSPAPPASSASPSIPVTPPAATAVRWSPEMLQSLRLQAFEQLVAQLARQVQSSPG
FT                   APAPQWPASGVSEALGRLLEALLAQVGTQQGQALQLLAAQPGSAALLQALAAGTTAGAA
FT                   AGTAAGTAAAGGQAQSSQSPQTGTSASAQAGAAPQATSSSPALQAAASLQPSAAAVTLA
FT                   VAAAKAKVVDALLAGSGLAPQAGASAPGGVAGGPTQTLPALQSWWVQQGTLLTPQGERG
FT                   FTLSLQVPQAWAQAQGAAMALAAASASAPGAALFTAAAALPAGAALPLAGAQAAEPGLR
FT                   LPLDASLQSLASGPVAVVVQPRGADALRTSALLLLELQPLRQPGGAMATPAGLASVASL
FT                   SPALAQEVQQMLQQRNDPWLHMAAAQASGALPRERRAFEHQSHFCTTEGCQYEGRAPCA
FT                   QPFCSEMNRLWDVSRTERSR"
FT   gene            194297..195295
FT                   /locus_tag="Daci_0171"
FT   CDS_pept        194297..195295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0171"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: ajs:Ajs_0134
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32817"
FT                   /db_xref="GOA:A9BPF0"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPF0"
FT                   /protein_id="ABX32817.1"
FT                   /translation="MRCTSRLTLASLAVAAALPVAAQSSATGSNVTISGYLDAGVFRDF
FT                   DKTSKLGTIQRSNLAIAGFEDLGGGLKATFRLSTRFDLDTGLTEDYPKKPFWHDESTVG
FT                   LQGSWGHLRLGRALSAMWSQEWQFDPWGNFNRIASPAWHMAHYLTPTDRASNNGSPEYG
FT                   RMSNGVFYDSPKFGGFSLHLSASPERTEAPGRQGRARSVSVNYDQGAVAAMLAHERNGS
FT                   GDTDLYMGGKYRIGTAAVMLAYDRSKSGTPGTGPDKSRMVSLGATYGIGATTLKASYAR
FT                   QRLDRDTNNMLSLGAEYALSKRTMLYTSLGHQRYENQSSRTAFGVGMAHSF"
FT   gene            complement(195296..196948)
FT                   /locus_tag="Daci_0172"
FT   CDS_pept        complement(195296..196948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0172"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: mms:mma_0161
FT                   methyl-accepting chemotaxis transducer transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32818"
FT                   /db_xref="GOA:A9BPF1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPF1"
FT                   /protein_id="ABX32818.1"
FT                   /translation="MQAFRNLKISSKLLLAFVAVLALTTFVGLYAVLQLSRINQASIDI
FT                   ATRWMPSSRMLLDIRATTARYRVNELQYLISTSEQDIGAFDRIMGELWKKTQTSYDNYA
FT                   SFISSAPEKAAYDELGRLRNEYAKEHAMVMALARNGRKDEALVLAQGESLELSRRLYDQ
FT                   IDRMVQIDHEGGQQANDHANALYRSARIWVVGLLGASILLGLALALTLARIVARPLNEA
FT                   LGVAQAVAEGDLTRRIQATTTDETGQLLHALHRMDQSLIHIVRQVRNGTDSIATASCQI
FT                   ASGNNDLSVRTEHQASSLEETAASMEQLTVTVRQNTDNARQANQLAASASAVAQQGGEV
FT                   VSQVVDTMGAIHASSRKIADIIGVIDAIAFQTNILALNAAVEAARAGEQGRGFAVVAAE
FT                   VRALARRCADAAKEIKLLIEDSNGKVSTGSALVAQAGQTMQNIVSSVRNVTDIMGEITA
FT                   ASVEQTAGLEQINQAISQMDQVTQQNAALVEEAAAAAHSLQEQAYGLQQAVSVFKLEQG
FT                   LELTALPATPQPMPAPGLARIASAAQSGRWEAH"
FT   gene            complement(197543..198844)
FT                   /locus_tag="Daci_0173"
FT   CDS_pept        complement(197543..198844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0173"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: ajs:Ajs_0133 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32819"
FT                   /db_xref="GOA:A9BPF2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPF2"
FT                   /protein_id="ABX32819.1"
FT                   /translation="MNHTETPSPSPIHNTATQTAGALGHLRVLDLSRVLAGPWCTQNLA
FT                   DMGADVIKIEKPGEGDDTRHWGPPFFPDAQGNPSDNAVYFAACNRNKRSITVDMSTAEG
FT                   QQLIRELAMQSDVVVENFKTGGLKRYGLDYASLSALNPRLIYCSVTGFGQTGPYAPRAG
FT                   YDLLVQAMSGLMSITGRADSEPGGGPLRVGVAVIDLFTGMYATTAILGAVEARHHTGRG
FT                   QHIDMALLDVAMAVLANQGAGFLNTGHVPGRQGNTHPSVVPYQDFPTADGRMLLAIGND
FT                   GQFARFCGAAGVDWARDERFATNAGRVIHRDALIPLMSDLTRGRPTAEWIALLEDKAVP
FT                   CGPINHIGQAFDDAQVRARGLRVEQERYPGATPPAGETINRVVTTASPLRLSDTPTTLR
FT                   HAPPALGQHTDEVLRERLGLDAQQLQALRVKGVV"
FT   gene            199007..199921
FT                   /locus_tag="Daci_0174"
FT   CDS_pept        199007..199921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0174"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ajs:Ajs_0132 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32820"
FT                   /db_xref="GOA:A9BPF3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPF3"
FT                   /protein_id="ABX32820.1"
FT                   /translation="MAMHFDLVDLRLMVHIADANSMTRGAELSFISLPAASTRIKNLEE
FT                   SIGTKLLYRTSQGVTLTPPGQAFVTHARMVLGQIEHLRGDMQEYVRGIKGHVRVFANTT
FT                   SLGEFLPPVLRHYLRRNPDVNIDLRERLSHDIVRAVTEGQTDIGIVAGLVRTENLETLP
FT                   YRRDRLVLVVPRGHALDGEMQMAFADTLDLDHVGLHESSAIHAFLRQASDQLHRPIKQR
FT                   IQVGNFETACRMIESGVGVGVLPESAASRHAHSMDIAIVPLSDAWSVREMQICVRSLEA
FT                   LPSFAQELVELLVADAQGRLTLE"
FT   gene            complement(199958..200386)
FT                   /locus_tag="Daci_0175"
FT   CDS_pept        complement(199958..200386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0175"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ajs:Ajs_0131 uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32821"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPF4"
FT                   /protein_id="ABX32821.1"
FT                   /translation="MSAPAPDRNAFMRLIGASQVPAPPGKVHVRLPHMREELLNQLPAA
FT                   HGGVLMTLLDSVMSRAAGELPGAPSQTAVTVEMSSRFHRPGKGALLAEGWVVHASRSLC
FT                   SCAAQLLDEDGKLVATATGTFKYWLAPTTLDRDTAQAD"
FT   gene            complement(200383..201540)
FT                   /locus_tag="Daci_0176"
FT   CDS_pept        complement(200383..201540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0176"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ajs:Ajs_0130
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32822"
FT                   /db_xref="GOA:A9BPF5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPF5"
FT                   /protein_id="ABX32822.1"
FT                   /translation="MIRDQETLEALLDSVRRFVRERLVPAENEVAETDEIPESIVQEMR
FT                   NLGLFGMTIPEQFGGLELTMEEEVRVLFELCQTAPAFRSVIGTTVGIGSQGILIDGTPE
FT                   QQAAWLPKLATGEIMASFALTEPEAGSDAASLRTTAIRDGDHYVVNGNKRFITNAPHAG
FT                   MFTLMARTDPANKGAGGVSAFIVDAKSPGISFGKNDVKMGQKGAHTCDVFFDNVRVPAA
FT                   NLIGLKEGQGFKTAMKVLDKGRIHIAAVSVGVAQRILRDALNYALERKQFGQPICEFQL
FT                   VQAMLADSQAELYAAECMVIDAARRRDEGRNVSTEASCCKMFATEMVGRVADRAVQILG
FT                   GSGYLAEFGIERFYRDVRLFRLYEGTTRIQQVIIARNMVREARAA"
FT   gene            complement(201563..202774)
FT                   /locus_tag="Daci_0177"
FT   CDS_pept        complement(201563..202774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0177"
FT                   /product="thiolase"
FT                   /note="KEGG: ajs:Ajs_0129 thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32823"
FT                   /db_xref="GOA:A9BPF6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPF6"
FT                   /protein_id="ABX32823.1"
FT                   /translation="MSARIPQSTLDAAAVNRPLRGRVAIAGAATYGCGEAPGMDDMTLL
FT                   VRAAHAAVADAGLTMQDIDGLATCSVNASMWTMPVIEHLGINPTYVDGTMIGGSSFIAH
FT                   LLPAIRALEAGQCKAVLVCYGSAQRSATFGRKEGQAARRFLDPQPYEFPYEPVLPVTAY
FT                   ALAAARHMHEFGTTREQLAEVAVAARAWAQLNPEAFMRDPLTIEDVLSARPIASPLSVR
FT                   DCCLVTDGAGAIVLVRGERARDLPRPPVYVLGNATAIWNRQISCMPDLTTTAAAQSGAQ
FT                   AFAMAGLTAADMDMAQVYDAFTINTLLFLEDLGFCAKGEGGAFVSKGGIAPGGRLAVNT
FT                   NGGGLSCVHPGMYGIFALIEAVRQLRGEAGQRQLGRHRTAVVHGNGGTLSSQSTAVLGT
FT                   AETL"
FT   gene            complement(202771..203175)
FT                   /locus_tag="Daci_0178"
FT   CDS_pept        complement(202771..203175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0178"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   ajs:Ajs_0128 protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32824"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPF7"
FT                   /protein_id="ABX32824.1"
FT                   /translation="MHLSAQTHYQAELDAGRFCIQQCTQCTRHVFTPRELCPHCGASPL
FT                   RWVRASGQGTVYSTSTVARKSDAGGDYNVALIDLDEGVRMMGRVEGIAPADVRIGQRVS
FT                   AHVASKDGRGLVLFQPALGQAAQGSQGGAA"
FT   gene            203540..204772
FT                   /locus_tag="Daci_0179"
FT   CDS_pept        203540..204772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0179"
FT                   /product="Formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: pol:Bpro_0569
FT                   formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32825"
FT                   /db_xref="GOA:A9BPF8"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPF8"
FT                   /protein_id="ABX32825.1"
FT                   /translation="MTDTLIKVDLNRPPTDNERVHNRWHPDIPMACWVQPGDDFILETY
FT                   DWTGGFIKNNDSADDVRDIDLTTVHYLSGPVGVKGAQPGDLLVVDLLDIGAKPDSLWGF
FT                   NGFFSKNNGGGFLTDHFPSAQKSIWDFKGMFTSSRHIPGVNFPGLIHPGLIGCLPDRPM
FT                   LEMWNERERALIATDPDRVPGLANPPSAGTAHMGQMRGEARDKAAAEGARTVPPREHGG
FT                   NCDIKDLSRGAKVFFPVYVDGAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMKVSLIKG
FT                   GMAKYGIKNPIFKPSPITPRYDDYLIFEGISVDESGRQHYLDVNVAYRQACLNAIEYLK
FT                   KFGYSGAQAYSILGTAPVQGHISGVVDVPNSCATLWLPTGIFDFDINPNAAGPVVQFDG
FT                   SIDMPLSPDLR"
FT   gene            204790..205143
FT                   /locus_tag="Daci_0180"
FT   CDS_pept        204790..205143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0180"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: pol:Bpro_0570
FT                   regulatory protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32826"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPF9"
FT                   /protein_id="ABX32826.1"
FT                   /translation="MPTYDYDCVQCGGFEALRPLRLRDEPAACPGCGTASARVLAAAPR
FT                   LALMADGTRRAMDTNERARHEPASSRDYDHGYARFKHPAGCGCCGSGRRSATVTAPNGA
FT                   KSAPSRRPWMISH"
FT   gene            205290..206315
FT                   /locus_tag="Daci_0181"
FT   CDS_pept        205290..206315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0127 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32827"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPG0"
FT                   /protein_id="ABX32827.1"
FT                   /translation="MPPSSLPSSCPSSFSSQRRRLLSAGGALAASSLLPAARVAHAADA
FT                   WPTRPVRFIVPFPPGGPVDTTARAFTQKLGEIWQQPNLVDNRAGAGGMVGAALAAKEPA
FT                   DGYTLFVGSIHHAVNPALQPKMTYDIERDFAPVSFAAMFPVFLVAHPSVPASNVRELIA
FT                   LAKSGNGLSFGSSGNGGGTHLAGELFNMHAGIKLQHIPYKGSAPAMNDLLGGQVQLMFA
FT                   DAPSALQHIKSGRIKVLGVASRQRSAMLPEVPTIAESGLPEYEAYSWAALFAPARTPPA
FT                   VLARINADFNTALRDAAVRQRLLTAGAEADPGTQQQMRERLSSELRKWAQVVKVAGIQA
FT                   D"
FT   gene            206462..207703
FT                   /locus_tag="Daci_0182"
FT   CDS_pept        206462..207703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0182"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rme:Rmet_1640 putative UreA/short-chain amide ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32828"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPG1"
FT                   /protein_id="ABX32828.1"
FT                   /translation="MRKGLMRGGLTKARAAGCALGAGLLWTAAAQAQQISDDVVRIGVL
FT                   SDMSGLYADTAGRGSVEAAKMAVADFGGQVLGKKIEVVWADHQNKADVGATHARTWFDR
FT                   DGVDLIVDINNTAVAIAVNNLARERGKMVINTGGASDILTNEHCAPTAIHYTYDSYALA
FT                   NGAVRGILAQGKKDWFILGVDYAFGKAMTANVTDFLKEGGGKLVGTTFHPLNASDFSSF
FT                   LLQAQASKASVINLANATSDTVNAIKAAHEFGIAPRQTLVPSLLFINDVHALGLRYGQG
FT                   MVLTTGFYWDRTEATRAWSRRFFEKMKKMPSMIHAGAYSAVTNYLKAVQATRGDDGNAV
FT                   ARQLKQMPIEDFFAQNGKVREDGRMVHDMYLVHIKKPEESRYPWDYYKVLSTIPGDEAF
FT                   RPLSKSSCKLVKTS"
FT   gene            207700..208830
FT                   /locus_tag="Daci_0183"
FT   CDS_pept        207700..208830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0183"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sme:SMc03929 putative zinc-type alcohol dehydrogenase
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32829"
FT                   /db_xref="GOA:A9BPG2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPG2"
FT                   /protein_id="ABX32829.1"
FT                   /translation="MKTRAAVLTRTGAAAPYADSRPLEIWEVDLAPPGPGEVLVKVAAA
FT                   GVCHSDLSIINGDRPRDTPIVLGHEAAGVIQALGEGVTDLEVGDHVVMLFVPGCGNCQP
FT                   CAEGRPVLCEPAGQAGVAGTLLSGARRLSRNGQPISHFVGVSAFAEHAVLSRRGVHRID
FT                   KSVPLELAALFGCAVMTGVGAVANTARVSPGQSVAVVGLGGVGLSSVMGAAAAGAARVV
FT                   AVDLNADKLAMAREFGATDIVNAGDEDAVKQVRELTGGGVDHAFEMVGSAKALEMAYRI
FT                   TRRGGQTVTAGLPSSAQAISLPVWHLVAEERTLKGCYMGSCVPRRDIDRYLALHAAGRL
FT                   PVDRLVTGHLTLDQINEGFDRLARGEAIRQIIRMDA"
FT   gene            complement(208894..210336)
FT                   /locus_tag="Daci_0184"
FT   CDS_pept        complement(208894..210336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0184"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="PFAM: Amidase; KEGG: rrs:RoseRS_3083 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32830"
FT                   /db_xref="GOA:A9BPG3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPG3"
FT                   /protein_id="ABX32830.1"
FT                   /translation="MRRVPRTSTPPFPVRATMRGSPELSIRQMASALRAGKTTSELLTR
FT                   SALGRIRAMDIDIHAFTNLDASGAMEAARSADMARAESADLPLLHGIAVAIKDVYDVAG
FT                   LPTTCQSWLSLDYVPEEDSTPVRRLRDAGAVILGKLATHEFAIGAPSPDLPFPAARNPW
FT                   DLAHIPGGSSSGSGAAIAAGFTRLALGTCTGGSILIPAAWCGAVGLKPTYGRVSKHGVF
FT                   PLAWTLDHCGPLSRSVEDAAIALQVLAGHDPLDPASSTEPVDDYCTGLEQGVKGLTIGV
FT                   PQDHFQSSPQASPTFLSAFDRTAALLAEAGARPIHVSLPHSQQFLAAGRVILSAEMFTI
FT                   HAQDLRSRPLDYGELTAARLLLGATVSSEDYLNALRVRRMLAARVDAALDRCDVLLTAI
FT                   TLDTAPRFDPMPHFRHWPVQTHAFNVTGHPAISVPVGLSPQGLPLAVQVVGRYFDEARI
FT                   LQVARAIERLTGWENQLLPDGT"
FT   gene            complement(210507..211478)
FT                   /locus_tag="Daci_0185"
FT   CDS_pept        complement(210507..211478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   reu:Reut_B3884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32831"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPG4"
FT                   /protein_id="ABX32831.1"
FT                   /translation="MKRILSLFLGGIFLVAASLVHAAWPDRQITLVVPFPAGGGTDVVG
FT                   RIIAKELAQRLRVNVVVENRPGASGNIGARQVSKARPDGYTLLICTTAQTISGALYTQA
FT                   GYDVVNDLEAISTINDSPLVLITRPGLQLSSVQDLIELARRSPGKLTYATPGYGSAGHM
FT                   AAEALSLAADIRMLHIPYQGAAPMMADLVSGQVDIAFDLLITAKQYVSQGKVNRVGVAT
FT                   RERSPLMPDWQTLSEQSPARLGNFNETAWNVLMAPKGTPAAIVNAINAQMKNILADEKV
FT                   QRKFMELGSIPLWKSVGGTKAFVSDDARKWRKVVSDAGIAKI"
FT   gene            complement(211834..213345)
FT                   /locus_tag="Daci_0186"
FT   CDS_pept        complement(211834..213345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0186"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_0126 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32832"
FT                   /db_xref="GOA:A9BPG5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPG5"
FT                   /protein_id="ABX32832.1"
FT                   /translation="MNQRIHHLLDRWLAEAPQRPFIHLPDGSSLSFADLGALADTAEAE
FT                   LRALQVRPGDRVLVVAENCPEHAALILACSRVGAWSCGVNARMAPGEIDAFAAKADARV
FT                   VYFTSAASDSASGHARRFGAGDSALAGMQHSPVRAQAVAESGALQDEVAALIFTSGTTG
FT                   TPKGVMVGHDALTLFARVSAASRGLGPQDRSYAFVPMTHIFGLGTVLLASLHAGAQMVM
FT                   RPQFDPADLLGALARHGISQLQGPPALYARLLAYLQEQGIAHPQAPALRYVYTGAGPLD
FT                   LTLKKRVEAAFGRALHHGYGLSEYAGSVHLTRQGEQRPDTSAGYVVEGAEVRAVDPATG
FT                   RSLPVGERGELWIRGRGLMHGYFRDDQATAAVMREGGWYASGDLGELHADGALFVVGRL
FT                   KEMIIRSGFNVYPAEVELALNELPGVQRSAVVGRPEGDGNEEVIAFVELQPGATLDSAA
FT                   ARSHLRERLAPYKLPARIVPLSELPTSPNGKVLKRLLQEQALRVS"
FT   gene            complement(213360..214358)
FT                   /locus_tag="Daci_0187"
FT   CDS_pept        complement(213360..214358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0125 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32833"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPG6"
FT                   /protein_id="ABX32833.1"
FT                   /translation="MPAQHRRKALATLAHAPLLASLVAALATLPAAAQDAQPVRLIVGY
FT                   SAGGPVDQGARLLSVALTKELGASVVVENKPGANATMAGSEVVRARPDGLTLWFAASPT
FT                   ITISPNVMSKMSFDPARDLTPVAPVLSYYNVLVVNNNEPYKTTAELVAYAKAHPQKLNY
FT                   GSAGVGGSNHLGALLFARRSGIEMNHIPYKGNAPAMTDVIGGQLSMMLDIISTASTYIQ
FT                   SGKVRAVAVTSPQRNASLPDVPTFAESGIEGLKGFDVGGWYGVYGPKGMSPELVARLNK
FT                   SINAALAQPELRKRLKELGYEEWTGAPQKLAERGAKERAMWATVTQGIVVD"
FT   gene            complement(214514..215578)
FT                   /locus_tag="Daci_0188"
FT   CDS_pept        complement(214514..215578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0188"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rme:Rmet_4850 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32834"
FT                   /db_xref="GOA:A9BPG7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPG7"
FT                   /protein_id="ABX32834.1"
FT                   /translation="MLGRQGRRHNPRQQARPGDSRSTMAGPGPAKNAEMDLNLCRVFID
FT                   IAEAKSLTRAAERGGMTRSNVSRRLRALETEMGAQLLRRTTRNVELTQAGQLLYRRCLA
FT                   MMEELQRARDAIHQLRSTVSGEVGVRVPTGFGHFYLKPLILGFCREHPDIRLRLLINDQ
FT                   MADLVASKVDLAVQITSAPLDDLVATRLCDVRWNFVATPACLQALEQSLGRPLRAPADL
FT                   LQARLILPLAMGGRLAWLTGSGDDGVSAALDVLPSLQSGDYRLLYDAVLDGLGLALLPD
FT                   YVTSAALAGGTLVAVLDQVVFSGLGNAMYLVRMPDRQPTMAARAFQQFLREAIVTAAPS
FT                   WQAGAEEAGADLSS"
FT   gene            215624..216832
FT                   /locus_tag="Daci_0189"
FT   CDS_pept        215624..216832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0189"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reh:H16_B2003 predicted acyl-CoA
FT                   transferase/carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32835"
FT                   /db_xref="GOA:A9BPG8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPG8"
FT                   /protein_id="ABX32835.1"
FT                   /translation="MQTAPPAPLAHYRVLDLSQGVAGPYCTHLLSRQGAEVIKVDPPEG
FT                   DWARHVGISRNGHSSLSATYNAGKRSIAVDARQAQGRALLLRLAREADIVVQNFRPQVV
FT                   QRMGVDYDSLRAAGLDPVYVSISGYGPTGPYADRPATDSVMQADTGLMTSNRDAQGQPQ
FT                   RVGLLLADIAAGVYAAQACTAALLGKARSGRGRHVELNLFEVCCALQSTVLAEDTLRGG
FT                   LPAEGVSAPNGVFATADGFITVLALNNDQFERLCRALDLPHWLQDERFASNAGRMAHRH
FT                   VLHAGLQALLAQQPRAHWEQRLAAQGALHAGVRTLADVVAHPQAVHRASFATLAQPGFG
FT                   PLLYAASPWPADAAACGASLGAAPRTGEHTRQILAEAGCTPQEMEQWMASGVVHQCAQE
FT                   VMA"
FT   gene            216889..217908
FT                   /locus_tag="Daci_0190"
FT   CDS_pept        216889..217908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0190"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   reh:H16_B2004 NADPH:quinone reductase or related
FT                   Zn-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32836"
FT                   /db_xref="GOA:A9BPG9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPG9"
FT                   /protein_id="ABX32836.1"
FT                   /translation="MQALVCHQFGAPHEVVSLQSMDRPGQPLGAHQARIAVAYANVSHA
FT                   TGLLIEGRYQRRPPLPFVPGTEGVGRVLECGSAVQHLQPGDAVAFIADWGAFAQETVVH
FT                   ASTVYRLPAGTPWLQALPIPLSYGTAYTALHWRARLQEGDVVLVLGAGSGVGAAAVEVA
FT                   RQTPGVQVIACASTEAKRADALRRGAHQAVTPQDLAAQVKQATQGRGASLVFDPVGGDL
FT                   LLQALRAAAQNAQLLSVGFASGAIPAVPMNLALVKNLTLHGFFYGRYIGWTPADERQAF
FT                   AAQLQPVIATLLDWAARGCIHPQVSQVYEMHELPAALDALHGRNVTGKLALAIQGDKV"
FT   gene            217905..218912
FT                   /locus_tag="Daci_0191"
FT   CDS_pept        217905..218912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   reh:H16_B2005 probable extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32837"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPH0"
FT                   /protein_id="ABX32837.1"
FT                   /translation="MTTQRTGPALSRRTLLGAAAALAAWRTAGAQPSAGAQGYPKAPIR
FT                   VVVPYPPGGPTDVVGRVVTTRLGEALGQPLVVDNKAGASGMVGAALVAKAPADGYTLLV
FT                   NASIHVINPYVYASAPYDAFRDFEPVTQLVDVPLVLVVGSQLPVRNVQELIAWAKAHPG
FT                   QVNFGSAGNASSQHLSGELFRLKTGAQMQHVPYKGSSPALTDLMGGQIQLMFDSMPSAM
FT                   PFIASGRLRALAVTSASRSSSLPDVPTMEEAGMPGFRTSTWYGLWAPKNTPQDVVQKLW
FT                   TESRRVLAEPQIAAQYRRLGAEPVGSTPAEFARYIQAEARKWEEIVKASGARAD"
FT   gene            complement(219150..220358)
FT                   /locus_tag="Daci_0192"
FT   CDS_pept        complement(219150..220358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0192"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: ajs:Ajs_0124 acetyl-CoA acetyltransferases;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32838"
FT                   /db_xref="GOA:A9BPH1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPH1"
FT                   /protein_id="ABX32838.1"
FT                   /translation="MRRAAIVTPLRTPVGTFGGSLRPVSVEELAATTVRAVVEKSGIDP
FT                   ARIDDVVFAQSYASSETPCVGRWAALQAGLPVTVPGMQLDRRCGGGLQAVATAAMMVQS
FT                   GAADVVIAGGVESMSNIEYYSTDMRWGARSGNVRFYDRLDRGRERSQPVERFGKISGMI
FT                   ETAENLARDYGISREAADAYAVRSHQRAAAAWEAGRFADEIVPVKVPQRKGDPVLFTRD
FT                   EGFRADATTDSMGKLRVLMPNGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMATLV
FT                   GWAAAGCEPSHMGIGPVPAVKKLLARLNLTLDQMDLVELNEAFACQVLSVLKGWEWNDQ
FT                   GAIDHKLNVNGSGISLGHPIGATGVRILATLLHELERRKGRYGLETMCIGGGQGIAAVF
FT                   ERV"
FT   gene            complement(220394..221695)
FT                   /locus_tag="Daci_0193"
FT   CDS_pept        complement(220394..221695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0193"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /note="KEGG: ajs:Ajs_0123 acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32839"
FT                   /db_xref="GOA:A9BPH2"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPH2"
FT                   /protein_id="ABX32839.1"
FT                   /translation="MSVLSPDALQERLQALIRPGDTLWWGQATAEPLTLTRAVVAHRHA
FT                   LARHGGQGRLRVFVGMGASDTLQPAHADAIDFFGYAAGGPHRALAQAGVLDILPSHYSH
FT                   LPGLIDEGLLPADVVLLQVSPPDAQGRYSLGLVHEYLPAAIRKARVLIGEVNPAIPWTH
FT                   GSLHLQAGDFALLVDAEHPPLDQARSAPGPAEQAIAGHVAALIEDGATLQVGVGNLPEA
FT                   VLAALHGHRDLGLHSGAVGDGIAALAEAGVLTHARKSQDRGVGIGGILMGGESLRRWAH
FT                   RNPALQLRETRYTHDPEVLAASHRLAAINSAVEVDLTGQINSEVAGGVYVGAVGGAVDF
FT                   LRGAARSRGGLPIIALSATARGATRIVARLSGPVSTPRSDAGLIVTEHGVADLRGQTLS
FT                   RRVKRLIDIAAPEHRADLEQQAHTLLRQCGAAFS"
FT   gene            complement(221692..222489)
FT                   /locus_tag="Daci_0194"
FT   CDS_pept        complement(221692..222489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0194"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   ajs:Ajs_0122 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32840"
FT                   /db_xref="GOA:A9BPH3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPH3"
FT                   /protein_id="ABX32840.1"
FT                   /translation="MNTSPVLTSVQDGIGTITLNRPEARNALNQAMRPALAAAVAQMRD
FT                   DAQVHTVILTGAGGAFCSGGDISQMMDASQAGLPWRQRMRSLHQWFPELVNLEKPVIAA
FT                   VDGPAFGAGLSLALAADFVLCTRRAKFCAVFGRIGLVPDLGAMHMLPRIVGLQKAKELV
FT                   FTARTVQAEEARSLGMVYEIVEDGEALQAAAVALARRFGEASTAAIGMAKTAMNQAFEL
FT                   DARAMAELEAYAQTMCRGSDYHQEAVQRFKDKQPTRFDWDRAP"
FT   gene            complement(222541..223488)
FT                   /locus_tag="Daci_0195"
FT   CDS_pept        complement(222541..223488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0195"
FT                   /product="3-alpha,7-alpha,
FT                   12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoAhydratase"
FT                   /EC_number="4.2.1.107"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   ajs:Ajs_0121 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32841"
FT                   /db_xref="GOA:A9BPH4"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPH4"
FT                   /protein_id="ABX32841.1"
FT                   /translation="MKAVGIAPAQSITEMTRSMTIRYDHLKQRPFEPVRQHYGERDTML
FT                   YALSLGLGSDPLCADALPFFYEGAPGGLRALPSQAVVLGYPGFWAREADTGIDWVKLLH
FT                   GEQRMRLHRPLPASADVVGHNRITHLTDKGEGKGAIMVTERRLETAGGELLATVQQVSF
FT                   LRGDGGYSLLDGGQPSDAPLAPLRPTPEDRAPDFTDTQAIRPEAALLYRLMGDYNPLHA
FT                   DPAVARKAGFERPILHGLASYGLVAHAVLRQCGDRNPARLKALDVRFTAPVYPGETLVT
FT                   EIWRTPDQPCQLQLRARVLERDKVVLSHGYAELA"
FT   gene            complement(223606..224610)
FT                   /locus_tag="Daci_0196"
FT   CDS_pept        complement(223606..224610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0196"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ajs:Ajs_0120 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32842"
FT                   /db_xref="GOA:A9BPH5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPH5"
FT                   /protein_id="ABX32842.1"
FT                   /translation="MIGEWRGAAFAGILGPDFFPTNTERGRQAMAQKMMQDKVVVVTGA
FT                   GGGIGRDMALAMAAEGAKVVVNDIGTSTTGEGTDAGPAQKVVDEIKAAGGQAVANTDSV
FT                   AEAASAGRIVQCAVDSFGRIDGVVNNAGILRDRFFHKMSLDEWDAVIKVHLYGSYYMSR
FT                   AAANHFKEQESGAFVHMTSTSGLIGNLGQANYSAAKLGLTALSKSIALDMQKFNVRSNC
FT                   IAPFAWSRMIGSIPTDTPEQQARVAKIQQMTPNKIAPLAVYLLSDAARDVNAQVFAVRN
FT                   NEIFVMSQPRPLRSVHRSEGWSPQFIAEHGMPALKASFVPLDRSADVFSWDPV"
FT   gene            224731..225636
FT                   /locus_tag="Daci_0197"
FT   CDS_pept        224731..225636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32843"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPH6"
FT                   /protein_id="ABX32843.1"
FT                   /translation="MAAMTDKQATDTLDAAALAHLQSWQGRSETLADSITAAPVAALSA
FT                   TLDREDPEPADGTALPPLWHWMYFLPHARQSELGPDGHPRRGGFLPPVPLPRRMWAGGR
FT                   LRWEAGNALQVGQKVQRRSTIGSVSHKSGRSGELLFVLVEHAYSNDQGLALTEEHDIVY
FT                   RAAAQPGDPAPTPQKPPLDGQQTWSRTIVPDDVLLFRYSALTFNGHRIHYDRRYVTGVE
FT                   GYPGLIVHGPLIATLLLDLLRRELPQAQVLSFEFKAVRPTFDLHAFSVHGKPSADGKTI
FT                   ELWAQDHEGWLTMTGKATLA"
FT   gene            225667..226833
FT                   /locus_tag="Daci_0198"
FT   CDS_pept        225667..226833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0198"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: reh:H16_B1367
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32844"
FT                   /db_xref="GOA:A9BPH7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPH7"
FT                   /protein_id="ABX32844.1"
FT                   /translation="MIEHTLSNNFPEIRDAIRALCAEFPDEYFRKIDEQRAYPETFVDA
FT                   LTKAGWLAALIPQEYGGSGLGLTEASVIMEEINRCGGNSGACHGQMYNMGTLLRHGSQA
FT                   QKEKYLPRIASGEWRLQSMGVTEPTTGTDTTKIKTSAVKKDGRYVVNGQKVWISRVQHS
FT                   DWMILLARTTPLAEVKKKSEGMSIFMVDLAEAQKSGLTVRPIPNMVNHETNELFFENLE
FT                   IPEENLIGEEGKGFKYILDGLNAERTLIAAECIGDGYWFLDRVTNYVRDRNVFGRPIGQ
FT                   NQGVQFPIADAFIEVEAANLMRWKACEMFDANQAMGAQANMAKYLAAKASWEAANACIQ
FT                   FHGGFGFACEYDVERKFRETRLYQVAPISTNLIYSYVAEHILGLPRSF"
FT   gene            226844..228046
FT                   /locus_tag="Daci_0199"
FT   CDS_pept        226844..228046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0199"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: ajs:Ajs_0117 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32845"
FT                   /db_xref="GOA:A9BPH8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPH8"
FT                   /protein_id="ABX32845.1"
FT                   /translation="MTQQRLRPLDGTTVVSLEHAVAAPFCTRQLADLGARVIKVERPGS
FT                   GDFARGYDQRVQGQSSHFTWINRSKQSLALDLKQDEAMQALLQLLEGADVLVQNLAPGA
FT                   AARMGLSYAALRERFPRLIVCDISGYGADGPYRDKKAYDLLIQSEAGFLSVTGTPEVPS
FT                   KAGISVADIAAGMYAYTNILSALLLRGRTGEGSHIDVSMLEALGEWMGYPMYYAFDGAP
FT                   PPPRTGASHASIYPYGPFEAGDGGTVMLGLQNEREWKLFCEQVLLQPALAADARFDSNA
FT                   RRNANREELRALILGVFNALDAAQVVQRLDAAGIANARVNDMAGLWAHPQLAARQRWCS
FT                   VDTPAGPVQALLPPGANSAFDYRMEAVPAVGEHSAAILAELGWSAERIAALCPTPGKTA
FT                   P"
FT   gene            228088..229452
FT                   /locus_tag="Daci_0200"
FT   CDS_pept        228088..229452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0200"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: ajs:Ajs_0116
FT                   MmgE/PrpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32846"
FT                   /db_xref="GOA:A9BPH9"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPH9"
FT                   /protein_id="ABX32846.1"
FT                   /translation="MKNDTQVSIHPLAQFAASLRWDDVPAAVQQRAEDLWVDWFGSVLA
FT                   GQGARPVQSITRFALSQGPAQGPSEILGSADTTSPMMAALANAAASHVAEQDDVHNGSV
FT                   FHPAAVVFPPALAVAQSIGASGAELMAACVAGYEVGIRVGEFLGRSHYRIFHTTATAGT
FT                   LAAAAAVGRLLGLTPAQMQHAFGSAGTQSAGLWEFLRTGADSKQLHTAHAAAAGLMSAY
FT                   LARDGFTGAQDIFTGPQGLAAGMSTDADPTRLTDGIGTRWATAETSFKWHASCRHTHPA
FT                   ADALLQVMQDHGLAPADLAQVTCHVHQGAIDVLGPVVDPGTVHQSKFSMGTVLALAARH
FT                   GHAGLDEFDNEYLAATTVALREKVGMVLDPEVDAAYPQRWIGKVTVLTTDGRTLHGRVE
FT                   EPKGDPGNTLSREEITAKALRLIAYGGALQDDPAQAAVARLWQIAHWPRVQRLLD"
FT   gene            229556..230563
FT                   /locus_tag="Daci_0201"
FT   CDS_pept        229556..230563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0115 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32847"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPI0"
FT                   /protein_id="ABX32847.1"
FT                   /translation="MQRTTSFRRRLVYAAAAACALAAGGATTGALAAAWPEKPVVLVVP
FT                   YSAGGPTDVVARLLAVPMGQVLGQSVLVENTVGAGGTIAPNRVAKAKADGYTILIHHMG
FT                   MATAPALYKKLPYDPLKDFEYIGQVLDVPMTLLSRKDFPANNFAELLDYVKKNQEKVSL
FT                   ANAGIGAVSQLCGMLFMHQAGVKLTTVPYKGAGPAMNDLMGGQVDLLCDQTTQTVPVIK
FT                   DGQRAKVFGVTTPKRLSSLPDIPTLDEQGLKGFDVKVWHGMYAPKGTPKDVVMAINKAL
FT                   NVAIKDENVKKRIAELSSDLVTPDKATPEGLRTHLQAEVARWDKVIKAAGVSAE"
FT   gene            230587..231459
FT                   /locus_tag="Daci_0202"
FT   CDS_pept        230587..231459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0202"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: ajs:Ajs_0114
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32848"
FT                   /db_xref="GOA:A9BPI1"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPI1"
FT                   /protein_id="ABX32848.1"
FT                   /translation="MHDLARQATSFLFVPATRPERLGKALDSGADMVIADWEDAVAPAD
FT                   KDGARQALAQAVGALEGPARARLLVRINAEGTPWHADDLRALAQLVEQGVAGAMVSKAE
FT                   RAQTLHAVAQAAGARAAVLPLIESVAGLDAADALAAAPQVVRLAFGHLDFQVDAGMACE
FT                   QGEEELLPMRMALVLASRRAGIGAAVDGVTVDTRNPERLAQDAARARRMGFGGKLCIHP
FT                   AQVQPLHAVFDPDAAAVAHAQRLRQALAEAGGGVCVLDGRMVDAPVLKQAEQVLLRHAW
FT                   AQQRSAARS"
FT   gene            231646..232713
FT                   /locus_tag="Daci_0203"
FT   CDS_pept        231646..232713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0101 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32849"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPI2"
FT                   /protein_id="ABX32849.1"
FT                   /translation="MAVISGTASNSGFNGQLNDRLNDRLNNRLNRRQALALAAGAAAAG
FT                   PASVLAQAGFATRPVRIVVPFAAGGATDVIARILGERMAQQLGQTVVVDNKPGAAGLIG
FT                   GEMVVRSAPDGLTLLLGTTSTMLTNKYLYKKTAYDPLTDLTPLSRVCMAPIALVVTADV
FT                   PATNLREFMAWAQANAGKLSYGSYGIGSHGHLACAVLSDMAGAGMAHAAYRGEALMVQD
FT                   MLGGRIPIGMGSLLTLKPHIDAGKLRALAVTGTRRVPLLPEVPTFAEAGYRHEAMELSG
FT                   WLAIAGPRGLPADLTRQWGEISNRAVASREGTARIIAAGFVPVDDDSPQRFGKAWAQEA
FT                   PVWGRLLQAAGVQPG"
FT   gene            232852..233397
FT                   /locus_tag="Daci_0204"
FT   CDS_pept        232852..233397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32850"
FT                   /db_xref="GOA:A9BPI3"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPI3"
FT                   /protein_id="ABX32850.1"
FT                   /translation="MSALVIKAWKASEQPIDDKGNHIAITGREGGLVAWILSKVNIDPT
FT                   TTIRVGSERLEFSSASLSGTQSRLIPLQGICSTYYGYHKPWKTALGIGALSLFMGGSMM
FT                   AQSFFAGLVVMLIGWGIAAVIYFLNRTLTLGFIENSGAVNGIQFKRSVIENIDITQEQA
FT                   RQVCELMQKLIEAKEKRL"
FT   gene            complement(233475..234017)
FT                   /locus_tag="Daci_0205"
FT   CDS_pept        complement(233475..234017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_1934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32851"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPI4"
FT                   /protein_id="ABX32851.1"
FT                   /translation="MVLTIGLTGAALAQAAADAGLVGLLDARRPDSANLSSEEPRPSTA
FT                   PRPYIRLLPEPSQTPECCVTAGQPAESGILRYQGKKDTEAVAAAARAALFMPPVAEGFI
FT                   GLQLAEGARVRVLGPQRLLVWWPDRPRLTRVDHCLSREGLHVQWREQVASGRWASAQHY
FT                   YLPLGMDVEPNCSPSAQ"
FT   gene            complement(234050..234460)
FT                   /locus_tag="Daci_0206"
FT   CDS_pept        complement(234050..234460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0206"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0283 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32852"
FT                   /db_xref="InterPro:IPR041238"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPI5"
FT                   /protein_id="ABX32852.1"
FT                   /translation="MTCIRAMVLRPISVLCLAWGLGTSVCAHADTRLTRPTADSQRLII
FT                   ENNNLTAQAFFSAYMSKEVPERRYAEMYLLGVLDATEGRAWCDYRHLKTITLAEVLHSS
FT                   LRSMDARQRATRAAHVITDILAKQFPCQAGPQ"
FT   gene            complement(234499..234981)
FT                   /locus_tag="Daci_0207"
FT   CDS_pept        complement(234499..234981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0207"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ajs:Ajs_0100 uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32853"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPI6"
FT                   /protein_id="ABX32853.1"
FT                   /translation="MSHADAMIARMNTPIKDHPANPFEGEAPGILFGLPMPMARAMKLS
FT                   GERIGEDRAQIRMGFQPDQANSRGDVHGGAIASLLDCALASACRSHDPTAFGVATIDLT
FT                   LHYVSAGSGDLIATAHCERRGRSISFARGEVRSEDGTLVALATGTFKLMARGGAQA"
FT   gene            complement(234978..235985)
FT                   /locus_tag="Daci_0208"
FT   CDS_pept        complement(234978..235985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0099 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32854"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPI7"
FT                   /protein_id="ABX32854.1"
FT                   /translation="MKRSPPMPMHPLPRRRLLSCLALATCALLAPAAHAAEAWPAKPIQ
FT                   LVIPYPPGGSADLLGRPLAVQLQQQLGQPVVLEYKPGAGGTLASQYVARARPDGYTVLM
FT                   VLAAHAINDSLYPKLPYDTRRDFAPVSLVANLPMVVAASSKLPAKNIQELIQAAKANPG
FT                   KLTFGSAGNGNTGHLAAEYFGSMAGVRMTHVPYKGSAGVVNAMLAGDIDLTFDSISTSM
FT                   PHIRSGRMHALAVTSPQRSALAPEVATIQEQGIAGFDVTGWYAVIAPAGTPAEATQRLS
FT                   REIASALRQPALQAQLAAGGYEPVGSTPEALQAHIDKEITRWATVVKSTGARVD"
FT   gene            complement(235982..237562)
FT                   /locus_tag="Daci_0209"
FT   CDS_pept        complement(235982..237562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0209"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_0098 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32855"
FT                   /db_xref="GOA:A9BPI8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPI8"
FT                   /protein_id="ABX32855.1"
FT                   /translation="MQEDIAALLRQPFGSLPELVALQASQRPRHTALAMDGRSLDYAAL
FT                   RLGMDRVALRLQRQGLGPGDVVAICAGSSPEYVLAFLGALRAGVAVAPLAPSATAGHLS
FT                   AMLDNCGARLVLRDADTAAQWPLQGGQDLQCVALDGAVEAGMPWSQWLAADEADHGTAP
FT                   TPIHPQPDWPFNVIYSSGTTGVPKGIVQSWAMRWAHVQRAIHNGYGPDAVSLCATPLYS
FT                   NTTLVAALPTLGLGGTLVLMRKFDAAHYLELAERHHATHTMLVPVQYQRLMQCPGFDGA
FT                   DLSRLQHKFCTSAPFHPALKAEVLRRWPGRLIEYYGMTEGGVRCELHCHDFPDKLHTVG
FT                   RPGPGADIRFIDEQGRELPPGEQGEIVGRSAGMMSGYHRLPDKTQEAEWFDAQGLRFIR
FT                   SGDVGRLDEDGFIVLGDRKKDMIITGGFNVYPSDIESVLLQHPQVAECAVIGVPSDAWG
FT                   ETPVAYAVARPDATPSAAELREWLNARVGKTQRVAELRLAASLPRSEIGKVLKRALREQ
FT                   YQAGALSSS"
FT   gene            complement(237592..238560)
FT                   /locus_tag="Daci_0210"
FT   CDS_pept        complement(237592..238560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0097 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32856"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPI9"
FT                   /protein_id="ABX32856.1"
FT                   /translation="MTVRRSLLALLAALPFFSLAPAAALAAAWPERPITIVVPAAAGGT
FT                   TDIAARVLAEKMGKDLGTSVVVENKGGGGGSIGTAQVARARPDGYTLLMGNIGPVAINF
FT                   SLYKQLSYKESDLRGITNVISVPNILVVHADSPVRSVRELVELARTRRLNVSTSGVGQS
FT                   PHMSSEMFRQKAGIEVTLVPFPGAAPAVTALLGQQVDYMIDNLPSSMPHIRSGKFRALA
FT                   ITSATRSAQLPEVPTMTEAGVPMQVTAWFGLLAPAGTPDAVVERIQQSARRAMQTAEVR
FT                   QRFADLGGVPGGETPAEYDAFIAQERKSWAQIVKAAGLSLE"
FT   gene            complement(238881..240185)
FT                   /locus_tag="Daci_0211"
FT   CDS_pept        complement(238881..240185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0211"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   aav:Aave_0188 Glu/Leu/Phe/Val dehydrogenase, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32857"
FT                   /db_xref="GOA:A9BPJ0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPJ0"
FT                   /protein_id="ABX32857.1"
FT                   /translation="MQQPASAGVTNHAIPSYLQADHLGPWGNYLQQVDRVTPYLGHLAR
FT                   WVETLKRPKRILIVDVPIELDNGTIAHYEGYRVQHNLSRGPGKGGVRFHQDVTLSEVMA
FT                   LSAWMSVKNAAVNVPYGGAKGGIRVDPKTLSRGELERLTRRYTSEIGLLIGPSKDIPAP
FT                   DVNTNGQIMAWMMDTYSMNTGATATGVVTGKPVDLGGSLGRVEATGRGVFTVGVEAAKL
FT                   TGLSVQGARIAVQGFGNVGGTAGKLFADVGAKVVAVQDHTGTIHNANGLDVPALLAHVA
FT                   AKGGVGGFDGAEAMDAADFWSVDCDILIPAALEGQITKENAGKIKAKMVIEGANGPTTT
FT                   EADDILTEKGVLVLPDVLANAGGVTVSYFEWVQDFSSFFWSEDEINARLVRIMQDAFAA
FT                   IWQVAQQHGVTLRTATFIVACQRILHAREMRGLYP"
FT   gene            240362..241180
FT                   /locus_tag="Daci_0212"
FT   CDS_pept        240362..241180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B1174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32858"
FT                   /db_xref="GOA:A9BPJ1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPJ1"
FT                   /protein_id="ABX32858.1"
FT                   /translation="MMNTPRTPTALAHALLQARHSGELLDADDWADVVRTPADAQAVQA
FT                   AMAPALGWRVAGSQQGPGRVPGYWKSGAPRRDAPLTHAPLPEEGVWASPSVAGGAPLHL
FT                   RGIEAEIALRLGRDVTAEMAAALQPGEGLELIDGITAAIEVVDTRWRQHLKAPPLLLAA
FT                   DGLCHGALVLGPWQDASRLLPRESPRDWSAQVCRLRVGAAPLQAFTGTHPLGDPLWLLA
FT                   GWLQELVRRYGSVPAGTVVTTGTWNGLAFAQAGDLVVAELDGIAEARLQL"
FT   gene            complement(241205..242077)
FT                   /locus_tag="Daci_0213"
FT   CDS_pept        complement(241205..242077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0213"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   aav:Aave_0190 protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32859"
FT                   /db_xref="GOA:A9BPJ2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPJ2"
FT                   /protein_id="ABX32859.1"
FT                   /translation="MDAFNPFSSRDAAVQKLWEQWQPRSAKSDKDKPIALADFDPGAKP
FT                   FSNGNGKTEDKAAVEALAEEIDALQNLLYADRRYKLLVVLQGTDTAGKDGTIRGVFGRT
FT                   SALGVNAVGWKAPTDAERAHDYLWRIHQRVPGAGEITVFNRSHYEDVLVPVVNGWITPE
FT                   QQRQRFAHINDFERMLSETGTVVVKFLLHISADEQRARLQERLDDPAKHWKFDENDMKV
FT                   RTQWKDYQQAYGQLLGATHTPWAPWTIVPADSKTHRNLMIATLLREVMRNLDLRFPEGD
FT                   PALKDYKIT"
FT   gene            complement(242106..242519)
FT                   /locus_tag="Daci_0214"
FT   CDS_pept        complement(242106..242519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32860"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPJ3"
FT                   /protein_id="ABX32860.1"
FT                   /translation="MTAMTQTSHTAVARALPLLLAGSLSLLATACAAPPPPPATAPAPA
FT                   SASAAPAAPDAGQPLTLQGRLVLRGNAPHEQPVLQTASGETWQLKGLSAEQVTQWQRQN
FT                   VEVRGQPGPRPAAGAAPSMVPPQLQVQSIRAQP"
FT   gene            complement(242516..244165)
FT                   /locus_tag="Daci_0215"
FT   CDS_pept        complement(242516..244165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0215"
FT                   /product="putative hemagglutinin-related transmembrane
FT                   protein"
FT                   /note="KEGG: rso:RS01899 probable hemagglutinin-related
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32861"
FT                   /db_xref="GOA:A9BPJ4"
FT                   /db_xref="InterPro:IPR019501"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPJ4"
FT                   /protein_id="ABX32861.1"
FT                   /translation="MFQDHFGGKALVALALGAGLAGCGGGGGGSTPGDSITTQLSPACT
FT                   GASCGATDATTYSGQGVGVWSYTNATAAEQPVAVGLRNLGTRPVTLIYTNTGDAAVALP
FT                   PITLTPPAAAAQGIAAQQSLSAAQLVNQIPQRVRDFKPSLPAPVAGQSVQPSRAVSAAV
FT                   LPVGSQRSWFVNTESPTVETRSATLRRQTTAPTPTGTRTINLWLEDSEYGGAKVSDALL
FT                   DTVIQRFASGPDSVHALVTGLAGQPWGPQAHSELIAADQPIDIVFVNFTPDSQPYGLLG
FT                   YFWAVNNFKRTAGNSQFQYSNESLSFYMDTETLYLGGANGLTTQISTLSHEFIHMINFY
FT                   QRGALKGSDYMFDTFLEEMSALMSEDILAERLTPGTNPMRDGRITGWMSKPGFNCDLAS
FT                   WASDVNATCFGYNVTGSLGAYLLRQHGVGFYQQMLRNTSSPDSLQVLGNAIAQAGGPSL
FT                   PVTLQRWGANIALLPSSGPAGYGWPARTDQGFTLVGIDGQRYAAARRLPATVPAQLAAR
FT                   GHFPFVRQPDAQGLYQEQLRVPAGTTLTAIVQ"
FT   gene            complement(244318..245229)
FT                   /locus_tag="Daci_0216"
FT   CDS_pept        complement(244318..245229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0216"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ajs:Ajs_0137 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32862"
FT                   /db_xref="GOA:A9BPJ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPJ5"
FT                   /protein_id="ABX32862.1"
FT                   /translation="MSFPADQVPLFLAVLDHGSFSAAARRLGRVPSAVSMAIAQLEAEL
FT                   DLQLFDRSGREPRPTAAARALEPQARLLAAQLQQLNHQALALHQGLEERLTLVIAPELL
FT                   STAWAAPLQPLVEEFPGLEVEVLVAAQVDALKELHSGRAHLALVFERPAIDGREDFQEM
FT                   GQETMVAVMAARHPLARQLGVDGQQRLDVGQLAGARQILLASRDLAHTDPRFVFSHQLW
FT                   RTDSHLAALSLVSAGLGWGWLPFSVAEPLLQTGALLRIPLCNISNGTQLFVDWVWSKER
FT                   PLGLAARRFVEQLQVPVQLEPR"
FT   gene            245304..245798
FT                   /locus_tag="Daci_0217"
FT   CDS_pept        245304..245798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0217"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   ajs:Ajs_0138 transmembrane pair domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32863"
FT                   /db_xref="GOA:A9BPJ6"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPJ6"
FT                   /protein_id="ABX32863.1"
FT                   /translation="MTLQTHKKGLQGPKRKVVFVTLYELIAIAASSLLFMAIGQSAGHS
FT                   GGMAIAASTLAIVWNLTFNHLFEQWEARQSVKGRSVMRRVVHALGFEGGLAMVLIPLMA
FT                   WWFGVTLWEATVMEAGLLVFFLVYTYVFNWCFDHVFGLPASASASAAVAPRAQGEPACS
FT                   N"
FT   gene            complement(245771..246790)
FT                   /locus_tag="Daci_0218"
FT   CDS_pept        complement(245771..246790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0218"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: pol:Bpro_0562 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32864"
FT                   /db_xref="GOA:A9BPJ7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPJ7"
FT                   /protein_id="ABX32864.1"
FT                   /translation="MNENPQRPQMTTADSSRHPSHPPHNAHVILVVDDALDSLRMLCDA
FT                   LAAEGYVVLAARDADEALQRFALTVPDGVLLDAVMPGMDGFTLCRTLKATPAWAHVPVV
FT                   FMTGLSDTDQIIRGFASGGVDYVVKPLRIPEVLVRLATHVRNARATRQAQEAVDVAGLG
FT                   VVVLDGQGRVAWRSPQASRWLEEAFADQPFPLEAAGDWLAGARQPDQHGKADQPGQADQ
FT                   EGQPAPQDLALALADGRQLLARHMGASGLGESMVLLSHEAPQTPAARRLQQVALTPRET
FT                   EVLSWLSKGKTNRDIADILGMSPRTVNKHLEHIFEKLGVETRTAAAAVAGQLLQAGSP"
FT   gene            complement(246783..250283)
FT                   /locus_tag="Daci_0219"
FT   CDS_pept        complement(246783..250283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0219"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: pol:Bpro_0563 periplasmic sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32865"
FT                   /db_xref="GOA:A9BPJ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPJ8"
FT                   /protein_id="ABX32865.1"
FT                   /translation="MHSAPPPDSPASTSPAPQTIFRFRREYNAWVADETMEDYALRYTP
FT                   RSFRRWSEFRVANTAFGSLSFLALEAIGGAIALNYGFANAMWAIVTVGLVIFLTGLPIA
FT                   VCAARYGLDMDLLTRGAGFGYLGSTITSLIYAVFTFIFFALEAAIMALALQLVVDWPLQ
FT                   WCYALSALVVLPLAMRGITLISRLQAWTQPLWLFLLVLPFVWMALSQPQLYRDFASLTG
FT                   LRSGSSQFDPLMFGAAAAVIFALVVQIGEQVDFLRFLPPRTRANRLRWWGAVLVAGPGW
FT                   AVMGMLKMAGGAFLAFAAMQLEGVDASRAAEPTQMFLVGFQQVLQALGLPGLAVAVTVV
FT                   FVVISQVKINVTNAYAGSLAWSNFFARITRSHPGRVVWMVFNVVIATLLMTLGVFGALE
FT                   KVLTIYSNVAIAWVGALVADLVINKPLGLSPPGIEFRRAHLYDFNPVGPGAMLLAAAVA
FT                   CCAYAGLLGETAAAFSPFIALALSMLLSPLLAWLTGGRYYLARPAGNLWKPGETVRCAV
FT                   CQKHFESEDMAHCPAYGAPICSLCCSLESRCHDRCKTGSRAGEQLHALASALLPPRWAT
FT                   KVNFRAGQYLVVMLSLCAVTAFMVGVVYMQESLQAGSVDGGALRIPFLKVFALLALLCA
FT                   VAAWWVVLSTDSRRMAQDESERQNQLLLQEIAAHKRTDAELQAAKDHAEQASQAKTRYV
FT                   AGMTHELRSPLNSLLGYTQILLKSPQVDGWVRETLSTMQHSGQHLRALIDESLELASIE
FT                   AGRLRLDLAPLPLPALIDGIEAMMRPQAQARGLQFSVETLGTMPRWVRADAKRLRQILI
FT                   NLLSNAVRFTQRGEVRLRMDFRPHVSRIEVIDTGIGIEPQDMERIFVPFERGSAGRRVS
FT                   EAGTGLGLTITHLLTELMGGQLTLSSTPGEGSCFTVRLYLPEMAPDASWVPPGAAATLH
FT                   TVIGYLPPRRTLLVVDDQPLQRQLLAGLLLPLGFEIREAASGRECLEIVEQSPPDLVLL
FT                   DISMDDLDGWQTAALLRARWDAQQLPVVFVSANLFDNDPPRLADARCQGFVAKPVTESE
FT                   LLQVLERVLRLEWVHDNRPLLLPAPRAEQAEAKAEEAPSAAPFPPDLREDLARLARSGQ
FT                   ATALRERLRQARQQAPAHAALLDALQACANRFDFDALARMLPRPEQEDEEDEEREETDE
FT                   "
FT   gene            250498..251763
FT                   /locus_tag="Daci_0220"
FT   CDS_pept        250498..251763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0220"
FT                   /product="urea ABC transporter, urea binding protein"
FT                   /note="TIGRFAM: urea ABC transporter, urea binding protein;
FT                   KEGG: mpt:Mpe_A3587 branched-chain amino acid ABC
FT                   transporter, periplasmic amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32866"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPJ9"
FT                   /protein_id="ABX32866.1"
FT                   /translation="MSHPSDPRTPGSPGTEMGRRRVLQALGAASVAGLPAWSFAQPTAQ
FT                   VNTTKLAVTDTEVVVGQLHSATGTMAISETGSIQAEQLAIDQINAMGGILGRKIRVIKE
FT                   DGASDWPTFAEKSKKLLINDRCAAVFGCWTSASRKAVLPVFEKENGLLYYPTFYEGLEQ
FT                   SKNVIYTGQEATQQILYSLDWAKAEKKAKTFFLIGSDYIWPRTSMKIARKHIENFQKGK
FT                   VVGEEYYPLGSTNFGSLVNKIKLQKPDCIFVAVVGGSNVAFYKALKAAGITGDKQLLVT
FT                   LSVTEDEMTGVGGENFTGFYSSMKYFQTLDNENNKKFVAAFKAKYGPNAVIGDVTQAGY
FT                   LGPWLWKAAVEKAKSFDVDKVVAASPGLELKTAPEGYVKVDANHHLWSKSRIAVGQPDG
FT                   TFKVVSESPELIKPDPFPKGYQ"
FT   gene            251874..252788
FT                   /locus_tag="Daci_0221"
FT   CDS_pept        251874..252788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0221"
FT                   /product="urea ABC transporter, permease protein UrtB"
FT                   /note="TIGRFAM: urea ABC transporter, permease protein
FT                   UrtB; PFAM: inner-membrane translocator; KEGG:
FT                   mpt:Mpe_A3588 branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32867"
FT                   /db_xref="GOA:A9BPK0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPK0"
FT                   /protein_id="ABX32867.1"
FT                   /translation="MSFSDMMNIGLMQGFAGLSLFAVLLLMGLGLAIIFGQMGVINMAH
FT                   GEFMTIGAYTIYLGSTLTAQHAPELMPYYFPLAIVAAFLFAFAAGWLVEWGLIRHLYKR
FT                   PLDTLLATWGVSLALQQCFRTFIGPKEVSPTLPDWLMGSWAPAEGLDIPINGLFVLALT
FT                   AVVTAGVLIALHKSRWGLRVRATVSNRVMANAIGIDTKKTDRLTFAIGCGIAGVAGAAF
FT                   TTIGSTGPTSGSLYIVDAFLVVTFGGAASLLGTVVSAFGIAQTQSITEFFLAGSMAKVI
FT                   TLSLIVFILMLRPQGLFASKVRR"
FT   gene            252860..254050
FT                   /locus_tag="Daci_0222"
FT   CDS_pept        252860..254050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0222"
FT                   /product="urea ABC transporter, permease protein UrtC"
FT                   /note="TIGRFAM: urea ABC transporter, permease protein
FT                   UrtC; PFAM: inner-membrane translocator; KEGG:
FT                   mpt:Mpe_A3589 branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32868"
FT                   /db_xref="GOA:A9BPK1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPK1"
FT                   /protein_id="ABX32868.1"
FT                   /translation="MQALKAWIQRYQLASLVLLTVLLAVVLPLALDIFRLNLVGKYLTY
FT                   AFVAIGLVMVWGYGGVLSLGQGVFFGLGGYAMAMFLKLEASDPISTKIQSTPGIPDFMD
FT                   WNQLTELPSFWLPFKSLPFSLAAVIAVPTLLAWLISFAMFKRRVGGVYFAIITQAVALI
FT                   VTVLIIGQQGYTGGVNGMTDLKTLWGWDTRTDSAKYILYYVCVALLIGAIVLCRWIQTG
FT                   KVGTLLLAMRDKEDRVRFSGYDVANFKVFVFCLAAALSGIGGAMFTLQVGFMSPSFVGI
FT                   VPSIEMVIYAAVGGRMSLVGAVYGTLLVNAGKTYFSESFPDLWLFLMAGLFIGVTMAFP
FT                   MGLAGLWESRIVPWWNSRRKGTAPAAAQGAQAAPAPAPAATKPTSALSEGMGRQGA"
FT   gene            254070..254813
FT                   /locus_tag="Daci_0223"
FT   CDS_pept        254070..254813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0223"
FT                   /product="urea ABC transporter, ATP-binding protein UrtD"
FT                   /note="TIGRFAM: urea ABC transporter, ATP-binding protein
FT                   UrtD; PFAM: ABC transporter related; KEGG: mpt:Mpe_A3590
FT                   branched-chain amino acid ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32869"
FT                   /db_xref="GOA:A9BPK2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017781"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPK2"
FT                   /protein_id="ABX32869.1"
FT                   /translation="MSNTDFTLAVEDLTVSFDGFKAIDALNLYIDKNELRVIIGPNGAG
FT                   KTTLLDLICGKTRATAGSIKFKNEELTRMAEHKRVRLGIGRKFQTPSIYENLSVFQNLE
FT                   VSYPQGRSVFGALAFKCTEAVRDRVQAVAADIGLDERLDTEAGLLSHGQKQWLEIGMLL
FT                   MQEPELLMLDEPIAGMSARERELTAELLQRICKNRSVIVIEHDMEFVARIAHKVTVMHQ
FT                   GKILAEGPMDKVQADPKVIDVYLGH"
FT   gene            254834..255523
FT                   /locus_tag="Daci_0224"
FT   CDS_pept        254834..255523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0224"
FT                   /product="urea ABC transporter, ATP-binding protein UrtE"
FT                   /note="KEGG: mpt:Mpe_A3591 ABC transporter ATP-binding
FT                   protein; TIGRFAM: urea ABC transporter, ATP-binding protein
FT                   UrtE; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32870"
FT                   /db_xref="GOA:A9BPK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPK3"
FT                   /protein_id="ABX32870.1"
FT                   /translation="MLQVKDLYVAYGQSEALHGISFEGRENETVAIMGRNGMGKTTLFK
FT                   SLMGVMPAKSGQITVAGQDVTKDESFRRVAKGIAYVPQGRMIFPTLTVEENIQTGLENA
FT                   KTRQVPDDIYALFPVLWDMRRRKGGNLSGGQQQQLAIARALVTDPKVLLLDEPTEGIQP
FT                   SIIKDIAKALNEIRKLRRITIVVSEQVLSFAMDVADRLFVIEGGRLVHETARADTDEQR
FT                   IKSYLSV"
FT   gene            255560..256789
FT                   /locus_tag="Daci_0225"
FT   CDS_pept        255560..256789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0225"
FT                   /product="Formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: bxe:Bxe_B1706
FT                   formamidase (FmdA)"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32871"
FT                   /db_xref="GOA:A9BPK4"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="PDB:2WKN"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPK4"
FT                   /protein_id="ABX32871.1"
FT                   /translation="MAETLIKVDLNQSPYDNPQVHNRWHPDIPMAVWVEPGAEFKLETY
FT                   DWTGGAIKNDDSAEDVRDVDLSTVHFLSGPVGVKGAEPGDLLVVDLLDIGARDDSLWGF
FT                   NGFFSKQNGGGFLDEHFPLAQKSIWDFHGMFTKSRHIPGVNFAGLIHPGLIGCLPDPKM
FT                   LASWNERETGLIATDPDRIPGLANPPNATTAHMGQMQGEARDKAAAEGARTVPPREHGG
FT                   NCDIKDLSRGSRVFFPVYVDGAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMKVSLIKG
FT                   GMAKYGIKNPIFKPSPMTPNYKDYLIFEGISVDEKGKQHYLDVTVAYRQACLNAIEYLK
FT                   KFGYSGAQAYSLLGTAPVQGHISGVVDVPNACATLWLPTEIFDFDINPTAEGPQKIITG
FT                   GVDLPIAQDK"
FT   gene            256836..257195
FT                   /locus_tag="Daci_0226"
FT   CDS_pept        256836..257195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0226"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: mpt:Mpe_A3593
FT                   regulatory protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32872"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPK5"
FT                   /protein_id="ABX32872.1"
FT                   /translation="MPTYDYHCTACGGFDALRSLSQRNEPAPCPSCEAASPRVFVSAPR
FT                   LACTSPEQRRAHDTNERARHEPRRSRDVAEGSYARMRHPSGCGCCSGASKRGSTVTAPN
FT                   GAKTFPTKRPWMISH"
FT   gene            complement(257266..258012)
FT                   /locus_tag="Daci_0227"
FT   CDS_pept        complement(257266..258012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0227"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc2106 probable amino-acid ATP-binding ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32873"
FT                   /db_xref="GOA:A9BPK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPK6"
FT                   /protein_id="ABX32873.1"
FT                   /translation="MPLVDVRAVHKHYGNNHVLKGVDLSVDSGQVVAIIGRSGSGKSTL
FT                   LRSINGLEAIQSGQIVVDDAVLKGSEGSAPSPAQLRALRLNVGMVFQQFNLFPHLTAGE
FT                   NVALSPTVVKGVKKPEAAALARQMLAKVGLGDKYDSYPDQLSGGQQQRVAIARALAMQP
FT                   KVLLCDEITSALDPELVNEVLAVVKQLAAEGMTLIMVTHEMRFARDVGDQLVFMHQGLI
FT                   HESGPAKQLFANPQTPELAGFIGAVH"
FT   gene            complement(257999..258652)
FT                   /locus_tag="Daci_0228"
FT   CDS_pept        complement(257999..258652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0228"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: aav:Aave_0209 polar
FT                   amino acid ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32874"
FT                   /db_xref="GOA:A9BPK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPK7"
FT                   /protein_id="ABX32874.1"
FT                   /translation="MIADIPLLPILAKLAEGLLATLALSLLAFVLGGATGLLVLFARVG
FT                   RSQNLRRLAKAYIQAFQNTPLLMQMFIVFFGSSMAGLDISPWTAAAIGLTLYTSAYLAE
FT                   VWRGCVESIPSGQWEASSSLAMGYLQQMRHVVLPQALRLSIAPTVGFSVQIIKGTAVAS
FT                   IIGFSELTKLGSMLANATFQPFLIYGLVAAGYFLLCWPLSLYASHLEKKLYAAR"
FT   gene            complement(258649..259377)
FT                   /locus_tag="Daci_0229"
FT   CDS_pept        complement(258649..259377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0229"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rso:RSc2104
FT                   probable amino-acid transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32875"
FT                   /db_xref="GOA:A9BPK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPK8"
FT                   /protein_id="ABX32875.1"
FT                   /translation="MAYQFDFGAVFDYSGLLAQGAGFTLALTAAGAVLGGAIGVAGGVS
FT                   RAWRIAPLHWLFKVYVEGIRNTPFLVQLMFVFFGLPSLGVQINEWQACLLTTVINLGAY
FT                   ITEIVRAGIQETQRGQLEAAGALGMGRWALFRHVVLRPALQRVWPSLSSQIVIVMLGTS
FT                   VVSQIAAQDLTFAANFIQSRNFRAFETYLVVTAAYFVLALALRQLLAWIGQRFVVGRRT
FT                   PRAARPAAPAAPATTAGDAA"
FT   gene            complement(259409..260215)
FT                   /locus_tag="Daci_0230"
FT   CDS_pept        complement(259409..260215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0230"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: ionotropic glutamate receptor; KEGG: aav:Aave_0211
FT                   extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32876"
FT                   /db_xref="GOA:A9BPK9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPK9"
FT                   /protein_id="ABX32876.1"
FT                   /translation="MTSPLTTRRAFIRTALAAATLAAAGLGGAAHADMLANIQKAGVLR
FT                   VAIPQDFPPFGSLGTDLKLQGYDIDMAALVAQELGVKVELVPVTSTNRIPFLTTGKADI
FT                   VISSLGKNAERAKVIDFTQAYAPFPKSVYGPKDVSIKAPADLAGKTVGVTRGSTEDLAL
FT                   TQVAPASATIKRYEDNNATAQSYLTGQVQLVTLGNIVANAVNERTRLRQLDVKFAVEDT
FT                   PCYIGVAKGEPALLQKVDAIITKLKADGRLTGLSQRWMKMPLPATL"
FT   gene            complement(260212..261018)
FT                   /locus_tag="Daci_0231"
FT   CDS_pept        complement(260212..261018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0231"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: rso:RSc2102 probable transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32877"
FT                   /db_xref="GOA:A9BPL0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPL0"
FT                   /protein_id="ABX32877.1"
FT                   /translation="MQSIPISMAQTLQQHILSGHYPGGSQLPPQRELARQLGISRASLR
FT                   EALSMLEALGLVEIQPGKGVRINGPHSGRARMHRAYATPALGTLSPRQLIELRLVLEPG
FT                   WAALAAVRADDSGLRQLQWTQSQLAHALARSDLLAAADADLQFHLLLAQLSGNPGLVAM
FT                   ARQLELAISHSLRLPFAWSGADDQPVREHDAIVQAVCAGDAPGAAGAMRAHLLSAARRS
FT                   GIDLDTPDNAAASDATAPDATAPDTSAPDPDPLSFRLTPPSEGAFA"
FT   gene            261450..264206
FT                   /locus_tag="Daci_0232"
FT   CDS_pept        261450..264206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0232"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: aav:Aave_0214 methionine synthase; TIGRFAM:
FT                   methionine synthase; PFAM: dihydropteroate synthase DHPS;
FT                   Methionine synthase B12-binding module cap domain protein;
FT                   Vitamin B12 dependent methionine synthase activation
FT                   region; cobalamin B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32878"
FT                   /db_xref="GOA:A9BPL1"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPL1"
FT                   /protein_id="ABX32878.1"
FT                   /translation="MSSSFTPPPMRLSGLEPVSIGEGTLFVNVGERTNVTGSKAFARMI
FT                   LNEQYEEALSVARQQVENGAQVIDVNMDEAMLDSKAAMVRFLNLIASEPDIAKVPVMVD
FT                   SSKWEVIEAGLRCLQGKGIVNSISMKEGLDEFKRQARLIRRYGAAAVVMAFDEKGQADT
FT                   YQRKIEICERAYRILVDEVGFPPEDIVFDPNIFAVATGIEEHDNYAVDFIEAVRWIKKN
FT                   LPGAKVSGGVSNVSFSFRGNDPVREAIHTVFLYHAISAGMDMGIVNAGMVGVYDDLEPQ
FT                   LRERVEDVVLNRRPDAAERLLEIADAAKGAAKDDSKKLEWRGTPENPKTVGERLSHALV
FT                   HGITDFIVTDTEEAYQQIVVQGGGRPLHVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSA
FT                   RVMKQAVAHLVPYIEEEKRQQEAAGLDVSSKGKIVIATVKGDVHDIGKNIVTVVLQCNN
FT                   FEVINMGVMVPCHEILARAKAEGADIIGLSGLITPSLEEMQYVAGEMHKDDYFRIKKIP
FT                   LLIGGATCSRVHTAVKIAPKYEGPVVYVPDASRSVSVAQSLLGENKGNYLAEIQADYDK
FT                   VRTQHANKKKTPLWPLAKARANATPVDFSQAPVAPRALGRRVFRNFDLAEIAEYIDWGP
FT                   FFQTWDLAGPYPAILDDEIVGVQARQVLADGQAMLKKIIEGRWLQANGAIGLFPANRVG
FT                   DDIEFYADESRSQVLMTWYGMRQQTEKQMVEGPDGQPVMRPSRCLSDFVATKESGIQDY
FT                   AGLFAVTAGIGAEKKDKEFEDALDDYSGIMFKALADRLAEAFAECLHQRVRKDLWGYAP
FT                   DEDLSNEALIKEQYKGVRPAPGYPACPDHSAKTDLFAVLKADEIGMTLTESLAMNPASS
FT                   VSGFYIGHPDSVYFNVGEIGEDQLADMAARRGMDIEELRRLLAPNLA"
FT   gene            complement(264389..264733)
FT                   /locus_tag="Daci_0233"
FT   CDS_pept        complement(264389..264733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bov:BOV_A0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32879"
FT                   /db_xref="InterPro:IPR018696"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPL2"
FT                   /protein_id="ABX32879.1"
FT                   /translation="MFGGSAFAAHADQITFQNDLSACVSITATKTSTESNVVWANTRVQ
FT                   LRKSIGECGCLSALATYTSSVNRGGVRQVLQEGLIDLGSGGERKLVLATDPALVANKEV
FT                   RVRLACTGPL"
FT   gene            complement(264762..265268)
FT                   /locus_tag="Daci_0234"
FT   CDS_pept        complement(264762..265268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpa:BPP0722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32880"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPL3"
FT                   /protein_id="ABX32880.1"
FT                   /translation="MEFDGQKLTWNGSGSFKATTGLPGFQMPENQCIKDSGPIPEGVYK
FT                   VLVTDRGAAKDDGAGRCNLSPGWGVQTIPRGAAAGSCEAYWANWGQNRARMEPADTQTR
FT                   IACNPVRSGFYLHDSTKGFSHGCIEVEHRFFPILRSKAKSSSRSYFILKVNYVPARVTN
FT                   GGTRA"
FT   gene            complement(265592..266950)
FT                   /locus_tag="Daci_0235"
FT   CDS_pept        complement(265592..266950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0235"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: pol:Bpro_3128 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32881"
FT                   /db_xref="GOA:A9BPL4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPL4"
FT                   /protein_id="ABX32881.1"
FT                   /translation="MTQRPMSFSRTPLLASLCAAAVLTACGGDGGSFYLTLDGKQPQVI
FT                   AHRGFSGKFPEQTRMAYEAAADAGADMLELDMHMTKDCQLVARHNAWLSDSTNVADVAK
FT                   TNAEVARRQRTAAGVLVNVKYPAIPANGPAQYLSDQLDANDPKSVLKALVVDGEDHRND
FT                   WSISDFTLQELRSWLTGTILDNRSERPTEWNGKLPLISAQDVLDIAAAKSKALGRTIPV
FT                   YAETKNPYWNNQQAIANGCGAPGSRPFEDAVIKLLDQNKLNAKDSPIYIQSFDPASLKY
FT                   LRQAGMKAKGVQLIDGNDFSLRDGSMVYITNDEWTFISGRPYSWTLAGDARTFAAMLTP
FT                   AGLADIKTYADGIGPWKPQVLAHSVVPYKDGAGLKDVNTVKDTGLIRDAHKAGLIVHSF
FT                   TFRNEPGRLAGLYKGDPVQEYLTYYRLGIDGVFTDFTDTAVAARKAYNKEIGL"
FT   gene            complement(267107..267793)
FT                   /locus_tag="Daci_0236"
FT   CDS_pept        complement(267107..267793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0236"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: aav:Aave_1099 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32882"
FT                   /db_xref="GOA:A9BPL5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPL5"
FT                   /protein_id="ABX32882.1"
FT                   /translation="MTPVSPQHIAERVVEAILAQKLAPGERLGEQELADNFAVSRTMVR
FT                   EALMQLQARGFVQVQPRRGWYVVQPSAEEAQDAFAARRIIETGILGEAGRPMQSVIGQL
FT                   RRHIAQEQDAIAGADAATRAFLLADFHVCLAEQMGHRLLALTLRDLTARTTLAATLFQS
FT                   THSASQSCAEHERIVEALERGDTEGAKALLLEHIGTVERSLEIRPPEAPDASDRLRATL
FT                   APLFGG"
FT   gene            complement(267790..269133)
FT                   /locus_tag="Daci_0237"
FT   CDS_pept        complement(267790..269133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0237"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   pol:Bpro_1420 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32883"
FT                   /db_xref="GOA:A9BPL6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPL6"
FT                   /protein_id="ABX32883.1"
FT                   /translation="MRRFARSLFGQVVIALILGVLAGILAPEWAVKLKPLGDGFIKLIK
FT                   MIIPVLVFCVVVHGIAGAGDLKRVGRVGVKSLIYFEVLTTIALVLGLVLAFVFQPGAGM
FT                   NVDPSKLDASAMSAYASNADKLTSGGTVDFLMKLIPTTVVQAFATGDVLQVLLFAVLFG
FT                   CALTMLGERGAPVHALIDTLSNVLFKIMGILIKLAPLGVLGAISFTVGQYGIGSLKQLG
FT                   MLVLLFYVAVIFFVFVVLGLVMRFSGFSLIKLLRYLREELMVVFATTSSDSVLPQIMAK
FT                   LRNMGVRDSTVGLVIPTGYSFNLDAFSIYITLAAVFIAQATNTPIGMADLLTILAIALV
FT                   TSKGAHGVPGSAIVVLAATLHAIPAIPAIGLVLVLSVDWFMGIARALGNLIGNCVATVA
FT                   IAAWEGDIDRERAHAVLNGLADNQGPDAEPSGAAAVPATVTSAHPATQ"
FT   gene            complement(269452..270765)
FT                   /locus_tag="Daci_0238"
FT   CDS_pept        complement(269452..270765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0238"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bja:blr0239 probable
FT                   citrate-proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32884"
FT                   /db_xref="GOA:A9BPL7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPL7"
FT                   /protein_id="ABX32884.1"
FT                   /translation="MDPALTKQTVSTRNIVAAVIGNALEWYDFLVFAFMTPIVAKLFFP
FT                   SNPDNPDDNINRILMTTAVFGVGFFMRPVGGILLGLYGDRKGRKAAMVMVTGLMAVAIA
FT                   LITLAPTYAAVGILAPLFIVLARLLQGFAAGGEFGTSTALLIELAPPGKRGFYGSWQMA
FT                   GQMLALLIGAATGTLITEIFTEEELMAWAWRVPFAVGLLIVPVALYIRRHVEEPEVFKE
FT                   MQAAQASGKARQIGIMEMLRTHARETLVGMGLVVTATVSIYITFTYLVTYATVTLKLPM
FT                   RDAFMVQMAGAALMVVIMPFFGALSDRVGRRMLTIGSLIGYLVVLYPLYAWLTDGPTVQ
FT                   KLLITQLVVCVFVAVFFGVFSTVMAELFPPQVRSAGMSMAYNVAVMIFGGFAQFIVTWL
FT                   IRSTGSPMAPAFYVMFGVTLGLFAAFFIKDRAMERNLR"
FT   gene            270807..272093
FT                   /locus_tag="Daci_0239"
FT   CDS_pept        270807..272093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0239"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   bpe:BP3588 putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32885"
FT                   /db_xref="GOA:A9BPL8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPL8"
FT                   /protein_id="ABX32885.1"
FT                   /translation="MGRRACPGRNPGVHCFAICNAYAMACVVHEGRRRPWRRWNHMTTW
FT                   KNTRDWLETLVAFDTTSRNSNLALIECVRDELATLGVSARLFHSPDGAKANLFATLPAH
FT                   NGETQGGIVLSGHTDVVPVDGQQWSTNPFALTEKGGRLYGRGSCDMKGFIAASLALVPE
FT                   FLATQRARPVHLAFSYDEEIGCAGAPVMINQLKAEGARFDGCVVGEPTSMQVVVAHKGI
FT                   NLYRCRVHGKAAHSSLTPRGSNAIEYAARLICRIRDIADHFKAHGPYDEFFDVPFTTMT
FT                   TNQIQGGIAVNTIPELCEFAYEFRNLPGMSVDGIQAQVESYVRDELLPRMRAEFADARI
FT                   EIETGASAPALEASEEAAITQLVRALTADQEKRKVAYGTEAGLFHNAGIPTVVCGPGSI
FT                   EQAHKPDEFVELAQLDACERFLRKMGTSL"
FT   gene            272174..272587
FT                   /locus_tag="Daci_0240"
FT   CDS_pept        272174..272587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0240"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="TIGRFAM: alkylphosphonate utilization operon protein
FT                   PhnA; PFAM: PhnA protein; KEGG: rfr:Rfer_3747
FT                   alkylphosphonate utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32886"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPL9"
FT                   /protein_id="ABX32886.1"
FT                   /translation="MPGTARPPRPFVFTESVHPMPQTTPACPQCGLENTYPDATSYICP
FT                   DCAFEWPMQAEEEAGEAAAGDGIVRDANGNALADGDAVILVKDLKVKGSSTVLKKGSKI
FT                   KGIRLVDGADGHNVDCKTELGSMLLKSEFLKKA"
FT   gene            272590..273621
FT                   /locus_tag="Daci_0241"
FT   CDS_pept        272590..273621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32887"
FT                   /db_xref="GOA:A9BPM0"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPM0"
FT                   /protein_id="ABX32887.1"
FT                   /translation="MLALSLAVSAVLGLLALWVFAPLFIALTAGAVVALLLLTLAGRTG
FT                   LSGLMGRTARTLPVAGWWAVALCAGAACVAMLVLLPDRLDGAPFLAFGMGLLAATCAGA
FT                   LVWLTGWLIAGRQPVPVSWWTGSAMAGLGAFLALLLGGPDTAGWMAWRDQLRGYEAVPL
FT                   RITLAEAPTAQREQALAELLQPLLEQGSRAVRHRQSTRFGNSVEHAVVPARWRIEGRLL
FT                   EIMLAEKPPAPLLSAHVALLEQFAASGPAQAGQAPSWLMLASAQCLPPPRLRELSRLLG
FT                   QGSELLARARRCTQQRSAQLQRLWPLLAGSVERVEVGEARRFRPWLGLQRWQAVAPTDN
FT                   PEP"
FT   gene            complement(273618..274253)
FT                   /locus_tag="Daci_0242"
FT   CDS_pept        complement(273618..274253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0242"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: ajs:Ajs_2497
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32888"
FT                   /db_xref="GOA:A9BPM1"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPM1"
FT                   /protein_id="ABX32888.1"
FT                   /translation="MQPRKRPPSRSFAGPSRRLQTAFADRPDTGPSRLLCFNKPYGVLS
FT                   QFTPEGRWRGLKEYIDVPGVHAAGRLDADSEGLLLLTNDGPLQARIADPRFKMEKTYWV
FT                   QVEGLPDEAALQALRQGVQLNDGMTLPAQARRLEPPPVLWQRDPPIRVRQNIPDCWIEL
FT                   VIREGRNRQVRRMTAAIGHPTLRLVRAAIGPYTLDGLEPGQWKDVEPA"
FT   gene            complement(274258..275166)
FT                   /locus_tag="Daci_0243"
FT   CDS_pept        complement(274258..275166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0243"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bpd:BURPS668_0024 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32889"
FT                   /db_xref="GOA:A9BPM2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPM2"
FT                   /protein_id="ABX32889.1"
FT                   /translation="MDLRALRYFVEVVRCNSFTRAAEALHVTQPTISKMVRALEEELGG
FT                   PLLLREGRGVQLTDAGQVVHARGLQVLEQSRQLLQEVAEVDGIARGSLSVGIMPTAGHY
FT                   MAPVIARFQQLHPGVELHVQEQGARAQRQLLLDGKLDMALGLHGAGEAGGDLAGEGLEY
FT                   CTIAHQKTRVAFAAHEVPDPDAPVHWSELARRPFVFYTSDFALHQAVLEHCAAAGFSPQ
FT                   VRLQTRYWDFIGDLVAEGVGVAVMFEHVIARFDPRRVSSRPLVGPELHWDVVQLWRSGY
FT                   LSRAARAWLECVRAVYPDDNR"
FT   gene            275243..275716
FT                   /locus_tag="Daci_0244"
FT   CDS_pept        275243..275716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0244"
FT                   /product="LrgA family protein"
FT                   /note="PFAM: LrgA family protein; KEGG: cvi:CV_1151
FT                   probable murein hydrolase exporter"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32890"
FT                   /db_xref="GOA:A9BPM3"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPM3"
FT                   /protein_id="ABX32890.1"
FT                   /translation="MSKISAMPVLRPQVFQGLLHRCWPLLRGVLQVGLLSALWVAMEAV
FT                   RAHFGWGMPAGLIGFALLATGLFSGLVKARWLQGGTNWLLAEMLLFFVPAMLVVTEYTD
FT                   LIQHQGLRILGVIVASTACVMAATALAVDRVYRLELWLARRRSTRAGLHREQE"
FT   gene            275722..276414
FT                   /locus_tag="Daci_0245"
FT   CDS_pept        275722..276414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0245"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: spe:Spro_4427 LrgB
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32891"
FT                   /db_xref="GOA:A9BPM4"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPM4"
FT                   /protein_id="ABX32891.1"
FT                   /translation="MSDQAIGLLSLLATLACYAANKRVYRRHPHPLLMPIVATPMVLIA
FT                   LALPTHVRYPQYIAQTHWLVWLLGPTTVAFALPLHENRHLLRKHWMSIATGVLVASGVS
FT                   IATTIWFAQAFGLPVDLQKGLAVRSVTTPFAIEAERVLGGPTDLAALFVLLTGVSGMLM
FT                   GETILRLLPHVRSKLAAGAILGGAAHGSGVAKARQFGDVQAVVASLVMMIAGALNVVVA
FT                   PWVRVLFF"
FT   gene            277305..277619
FT                   /locus_tag="Daci_0246"
FT   CDS_pept        277305..277619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc1866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32892"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPM5"
FT                   /protein_id="ABX32892.1"
FT                   /translation="MSTASTTLTQPTPQQLSHAVTEIGRLTLQGSSEVYSLGQLALAWL
FT                   ERPEGYRNLEVVANALQAICGAAQRMEELVEDEVNHVHCLQEDPAYLRRMAAAAAAFQR
FT                   "
FT   gene            complement(277724..279172)
FT                   /locus_tag="Daci_0247"
FT   CDS_pept        complement(277724..279172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0247"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: ajs:Ajs_1126
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32893"
FT                   /db_xref="GOA:A9BPM6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPM6"
FT                   /protein_id="ABX32893.1"
FT                   /translation="MSRYDNLINGQWKAADGYSANTNPSDLSDVIGEYAQGNAADVEAA
FT                   IAAAAAAFPAWSTSGIQARHDALDRIGNEILARKEELGDLLAREEGKTRPEAIGEVGRA
FT                   GQIFKFFAGECLRLAGETLPSVRPGIGVEITREPVGVVGLITPWNFPIAIPAWKIAPAL
FT                   AFGNCVVLKPADLVPGSAWALADIIHRSGIPAGVFNLVMGPGRVIGDALVRHSDVAAIS
FT                   FTGSVGVGRGIARACVESGKKVQLEMGGKNPQIVLDDADLTQAVELSAQSGFYSTGQRC
FT                   TASSRLIVTDRIYPAFIEALQARMARIKVGDARAAGTDMGPVVSQAQLEQDLSYVEIAK
FT                   AEGAVLAAGGAAAACHTGSGNKGYYMAPTLFVDTAAAMRINREEVFGPVASVIRVKDYE
FT                   EALAVANDTPFGLAAGIATTSLKHATHFKRHSQAGMVMVNLPTAGVDYHVPFGGRKGSS
FT                   YGPREQGRYAQEFYTTVKTAYTLA"
FT   gene            complement(279209..280546)
FT                   /locus_tag="Daci_0248"
FT   CDS_pept        complement(279209..280546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0248"
FT                   /product="Glucarate dehydratase"
FT                   /EC_number="4.2.1.40"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: ajs:Ajs_1990 glucarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32894"
FT                   /db_xref="GOA:A9BPM7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPM7"
FT                   /protein_id="ABX32894.1"
FT                   /translation="MSSTPTITEIEVIPVAGRDGMLMNLSGAHAPYFTRNIVLIHDSAG
FT                   HTGVGEVPGGEGIRQALEDSKALLIGQSVGNHLKLLQNLQQALAGRDTGGRGLQTFDLR
FT                   IAVHAVTAVESALLDLLGQHLGVPVAALLGEGQQRDRVEMLGYLFFTGPTDKTDLPYVQ
FT                   PGEDQSGTDDWTQVRHMTAMDPAAIVRQAEAAHARYGFNDFKLKGGVLAGEQEVEAVTA
FT                   LARRFPQARVTLDPNGGWLLKDAIRLMRDMHGVLAYAEDPCGAENGFSGREVMAEFRRA
FT                   TGLPTATNMIATDWRQMVHALSLQSVDIPLADPHFWTMAGSVRVGQTCRDWGLTWGSHS
FT                   NNHFDISLAMFTHVAAAVPGKVTAIDTHWIWQDGQYLTQNPLQIKGGFVEVPKTPGLGV
FT                   TVDRAALQRANALYLEHGLGARNDAMAMQYLIPGWTFDNKRPCMVR"
FT   gene            complement(280591..281577)
FT                   /locus_tag="Daci_0249"
FT   CDS_pept        complement(280591..281577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0249"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: ajs:Ajs_1991 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32895"
FT                   /db_xref="GOA:A9BQU0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQU0"
FT                   /protein_id="ABX32895.1"
FT                   /translation="MATSRPRVLQFGKMPLPQLDAELAQAYEVTLLSEQPDRERFLAEH
FT                   GAQFEYLVTSAAMGVPASVVQALPRLRFVSSFGVGFDALDRESLLRQGARVGYTPGVLD
FT                   DCVADMAFALLLDAARGLSESDRFVRRGDWSRGRFGIRTRASGKRLGIFGMGRIGSTVA
FT                   RRAAGFDMEVAYHNRRPVEGSPHLYQPSLLELARWADFLVITAAGGDGTQHLVNAEVLD
FT                   ALGPQGFLINVARGSVVDEAALVQALQQGRIAGAGLDVFEDEPRPHAELLSQDNVVLAP
FT                   HIASGTHETRRAMADLVLRNLAQFIATGRPEAEVPWSAAQQAATAAA"
FT   gene            complement(281683..282642)
FT                   /locus_tag="Daci_0250"
FT   CDS_pept        complement(281683..282642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_1992 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32896"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQU1"
FT                   /protein_id="ABX32896.1"
FT                   /translation="MKKILITLGAALALTAQAAGSFPDKAVNIIVPFPAGGSTDTVARA
FT                   MALSMGEQLGKPFVVENRPGATGTIGAGAVKRAPADGYTLLVASLGPFVVTPHLVKNVP
FT                   YDAGKDFDYITIPVQAPNVLVASPAQKARTVAEVIAALKANPGKISFASSGNGSSDHLS
FT                   AELFWQQSGTEGMHVPYKGGAPAITDLIGGQVDFSFQNVNAVLPHLRSGKLHAIAVTGS
FT                   QRSPVLPDVPTLAEAGVKGAEVYSWQGLAAPKGLPADVKAKLAKAAIASVQQPDIRKRF
FT                   VEQGLEIVGNTPEEFTRYQAQESERWKQLIQTRKITAD"
FT   gene            complement(282701..283612)
FT                   /locus_tag="Daci_0251"
FT   CDS_pept        complement(282701..283612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0251"
FT                   /product="5-dehydro-4-deoxyglucarate dehydratase"
FT                   /note="TIGRFAM: 5-dehydro-4-deoxyglucarate dehydratase;
FT                   PFAM: dihydrodipicolinate synthetase; KEGG: pna:Pnap_1596
FT                   5-dehydro-4-deoxyglucarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32897"
FT                   /db_xref="GOA:A9BQU2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BQU2"
FT                   /protein_id="ABX32897.1"
FT                   /translation="MTPQDLKDVMSSGLLSFPVTDFDSNGNFNAKGYAARLEWLAPYGA
FT                   SALFAAGGTGEYFSLYGEEYGQIIKTAVDTCRGKVPIIAGAGGPTRTAIAHAQEAERLG
FT                   AHGVLLLPHYLTEAGQEGLIAHVEQVCKSVKFGVIVYNRDRTRFTPESLAILAERCPNL
FT                   VGFKDGMGNIETMSAIFMKMGDRFAYLGGLPTAEVYAAAYKALGTPVYSSAVFNFIPKT
FT                   AMAFYEAVRTDDMATQHKLLKEFFMPYLKIRNRVEGYGVSIIKAGAKLVGHDAGPVRAP
FT                   LTDLKPSELEELKALIDKLGPQ"
FT   gene            complement(283659..284636)
FT                   /locus_tag="Daci_0252"
FT   CDS_pept        complement(283659..284636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   aav:Aave_2588 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32898"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQU3"
FT                   /protein_id="ABX32898.1"
FT                   /translation="MTLSRKQFLRAAGATALVASGAGALAQSNWPTRPLRLVVPYPPGG
FT                   SSDIIARAIGPLLSAELKQPVVIENKPGANGNLGADMVAKAQPDGHTLMLCDLGALAIS
FT                   PSLYTKLSFDLSRDLRGTAMLAYSPHLLVVHPSVPANNLQELVALSKKEDLSFAVTATG
FT                   SAPHLAGVELARATGARWEYVPYKGGVQSIQDTVAGQTQVLMNGMLATYPHVQSGKLKL
FT                   LGLSKGTRMPLAANVPTIAEQGVPGFETGTWQGVVVPAKTPEAVVQRLHEALITAIRSP
FT                   EVRARLTGQGAEVVTMNPAETARFLTTERQRWQKVVQTAGLKLD"
FT   gene            complement(284785..285573)
FT                   /locus_tag="Daci_0253"
FT   CDS_pept        complement(284785..285573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0253"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: ajs:Ajs_1995 GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32899"
FT                   /db_xref="GOA:A9BQU4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQU4"
FT                   /protein_id="ABX32899.1"
FT                   /translation="MISTMESSAKGFPASPPTIELPLRGKSGRSGRNLAALLFDEFASK
FT                   IRNGLLAEGEKLPTESSLVQTYEVSRTVVREALSRLQASGLVETRHGIGTFVRAAQPAS
FT                   TLMLNADELTAAVDVMAVLELRISLETESAGLAALRRSPEQLQGIRMALQAFEIAFARG
FT                   EDTVAHDLAFHTQIAEATGNRYFGDILRHFGAQLIPRTRIASIHQPQRDPDYLRRVNRE
FT                   HEEILAAIERQDADSARAAMRIHLTNSRERLRLAQKTSAA"
FT   gene            285656..286972
FT                   /locus_tag="Daci_0254"
FT   CDS_pept        285656..286972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0254"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: ajs:Ajs_1996 mandelate racemase/muconate
FT                   lactonizing enzyme, C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32900"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQU5"
FT                   /protein_id="ABX32900.1"
FT                   /translation="MSTTHAIHAIRHIRITPIAFRDPPLLNAAGIHEPWALRSIIEIET
FT                   ASGLVGINESYGDQPMLDALAKAAPALVGLSPWALNEMEVRVAALVAPPALTASEFLGQ
FT                   QVSLAPGTHVSKTVAKVVSAFEVAMLDLQGQMAGAPIVDLLGGAARDSVPFSAYLFYKY
FT                   AEHIDRPYGPDSSPDAWGEALAPQQLVEQARRMIAQYGFQSIKLKAGALPPEQEAAGIL
FT                   ALADAFPGTPLRIDPNGNWTVETSLKIVQQLQGVLEYYEDPAPGLDGMAAVARECDVPL
FT                   ATNMVVTDFAEFRRNADMGCPVKIVLSDHHYWGGLRATQRLSTLCRTFDLGLSMHSNSH
FT                   LGVSLVAMTHLCASVPLLTYACDTHYPWQDEEVVEGGRLQFEQGSLRVPTAPGLGVRLD
FT                   REALARLHDNYLHCGIRNRDDLGQMRKYDPAFTGHQPRF"
FT   gene            287023..288021
FT                   /locus_tag="Daci_0255"
FT   CDS_pept        287023..288021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_1997 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32901"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQU6"
FT                   /protein_id="ABX32901.1"
FT                   /translation="MQRRTLIQHSLASALLLGTALAAMPAAAQGNWPTGKPITYLVPFP
FT                   PGGNTDTLARVIAQPLSKALGTPVVIENKGGAGGSVGSAIAARAPADGYTILGGTISSH
FT                   AINVSLYAKLDYDPVKSFTPVAMLGSGPLVLVVPASSPYKTLADVLAASKAKAAAGGLT
FT                   SASPGSGTSNHMALELLGYQTGVKFTHVPYKGSGPAVQDVIGGQVDMMFDTALVVGPHV
FT                   QAGKLRPIAVTSAKRLESLPDVPTIAEAGEKGFDMGSWQAVFAPAGTPKPIVDRLHAEI
FT                   MKIVATPEVQARLKNFGMLPSQMTPAELGEYQKAEVVKWGKVIKAAGIKAE"
FT   gene            288195..289760
FT                   /locus_tag="Daci_0256"
FT   CDS_pept        288195..289760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0256"
FT                   /product="galactarate dehydratase"
FT                   /EC_number="4.2.1.42"
FT                   /note="KEGG: ajs:Ajs_1998 galactarate dehydratase; TIGRFAM:
FT                   galactarate dehydratase; PFAM: D-galactarate
FT                   dehydratase/Altronate hydrolase domain protein; SAF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32902"
FT                   /db_xref="GOA:A9BQU7"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQU7"
FT                   /protein_id="ABX32902.1"
FT                   /translation="MSTPLPLSIRMHPADNVAIVANDGGLPAGTVMPGGLVLVDKVPQA
FT                   HKVALVDIAEGGEVRRYNVVIGYALQAIAAGSWVHERLLRMPGALSLEGLPIATVQPPE
FT                   LPPLTGYTFEGYRNADGTVGTRNILAITTTVQCVAGVLDFAVGRIKAELLPRYPNVDDV
FT                   VGLEHSYGCGVAIDAVGAEIPQRTLRNISHNPNFGGEVMVVSLGCEKLQPERLLPPGSF
FT                   PIVDEREPALDVVCLQDEAHVGFMSMVDSIMGSARVHLERLNARRRETVPASALVVGVQ
FT                   CGGSDAFSGVTANPAVGFCTDLLVRAGATVMFSEVTEVRDGIDQLTSRASSPEVAQAMI
FT                   EEMAWYDAYLDKGRVDRSANTTPGNKKGGLSNIVEKAMGSIIKSGTAPITGVLSPGQRL
FT                   ADRGIQSGLVYAATPASDFICGTLQLAAGMNLHVFTTGRGTPYGLAQVPVIKVATRSDL
FT                   ARRWHDLMDVNAGRIAEGQASIEDVGWEMFRLMLDVASGRRKTWAEHWKLANQLVLFNP
FT                   APVT"
FT   gene            289777..290829
FT                   /locus_tag="Daci_0257"
FT   CDS_pept        289777..290829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0257"
FT                   /product="Gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: ajs:Ajs_1999 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32903"
FT                   /db_xref="GOA:A9BQU8"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQU8"
FT                   /protein_id="ABX32903.1"
FT                   /translation="MDAHCHSGGAATRRSFVAGALATVAGAASAQAFEFKPQQRYPDPS
FT                   VQVLDPEFARYRIYSSSVEQIATGFRWVEGPVWVADGRYLLFSDIPNNRMLRWDETTGQ
FT                   VGVFRSPANFSNGLARDRQGRLLACEHLTRRVTRTEYDGSITVLADGFGGKSLNSPNDI
FT                   VCARDGGIWFTDPPFGIGGHWEGDKAQAELPQSVYRIDPASGRLDAVLTDLAGPNGLCF
FT                   SPDEKRLYVVESRHQPHRVVWAYDVGEGGRLSNKRLHIDANGPGALDGIKCDEFGNLWC
FT                   GWGSNGAPGAQAAELDGVMVFNPAGKPIGHIRLPERCANLCFGGSKNNRLFMASSHSIY
FT                   ALYVEARGAA"
FT   gene            290899..291894
FT                   /locus_tag="Daci_0258"
FT   CDS_pept        290899..291894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0258"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: aav:Aave_0221
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32904"
FT                   /db_xref="GOA:A9BQU9"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQU9"
FT                   /protein_id="ABX32904.1"
FT                   /translation="MRAMPSDTPETPPASPWSARLQRLMELNPLRAMWNAVQLWLDADG
FT                   LRMSAAMSFYGILSLAPLLLLLVGLLGWWVDRSYVEHQLIDQVQDVIGERGAQVVRGAL
FT                   ESAQRPDEGRLASLFGFILLMSGATGVFVELQSALEKLWTSNGEPPPPKAVWWRMAALR
FT                   LRGLTYVLALGFLLLVSMALSTAIQLITNWAGTKLQMQPLGPLISLINECVSFGIAVLL
FT                   FVGLMRIGSGPKPRLRYLIFGAIVGALLFTLGKQALAWYLSTAAVVSAYGAAGSLVVLL
FT                   MWIYFSSAILLLSAATAKAFSDAEVRFTHPIRWAPPAGPAQARDTSDGKG"
FT   gene            291965..292957
FT                   /locus_tag="Daci_0259"
FT   CDS_pept        291965..292957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0259"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: aav:Aave_3911 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32905"
FT                   /db_xref="GOA:A9BQV0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQV0"
FT                   /protein_id="ABX32905.1"
FT                   /translation="MEQCSESPRAPRPGAKDNMDRLQTMRVFQTVADEAGFSAAARRLD
FT                   MSVPTVTRLVADLEQHLGTRLLQRTTRSVSLTEAGEAYLERVRGILADVEDAFSLAQAH
FT                   TLELSGAVRVLTPPVFAEHVLAPLVADFHRLHPRICIEVFVESASEAAVGEYDITFLNA
FT                   EEGYDGNVVARPIVTTCGLACASPEYLDAHGVPAVPEDLAGHQCLLRRRAQGRSDVLRL
FT                   RRLDGNAGEAEVAVQPVLVANHTGTLLRATLDGAGISTQPLDLIARHLRSGRLRHVLPE
FT                   WTTGHFTLYATLPTRKFMPARVRSFLDFVAEHTQRSMQGLPANLPALSI"
FT   gene            293194..294057
FT                   /locus_tag="Daci_0260"
FT   CDS_pept        293194..294057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0260"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   reh:H16_B2037 ABC-type transporter, permease component:
FT                   HAAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32906"
FT                   /db_xref="GOA:A9BQV1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQV1"
FT                   /protein_id="ABX32906.1"
FT                   /translation="MDVFLQQVLNGLTLGGIYGLVALGLTLVYGILHVPNFAHGGFYMI
FT                   GAFVAFQAMVAWSWGYWAAMLTAAVAVAVLGIVSERLIFHPLRKASPLHPKIASIGLLL
FT                   FLEAGAQALWGADFQRMPTPYTSIVEMGGITAPAQRLLIIGAAFALMVALHLFLTRTIT
FT                   GATIIAMAQNREGASMVGIDANRVSMLTFAISGVLAAVAATLYAPINLVYPAMGHLVIT
FT                   KAFVIIILGGMGSIPGAVLGGLIIGFAESFGAYYISTDYKDIIAFVLLVVILSLRPQGL
FT                   FAKRSH"
FT   gene            294058..295032
FT                   /locus_tag="Daci_0261"
FT   CDS_pept        294058..295032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0261"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   reh:H16_B2038 ABC-type transporter, permease component:
FT                   HAAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32907"
FT                   /db_xref="GOA:A9BQV2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQV2"
FT                   /protein_id="ABX32907.1"
FT                   /translation="MNGFIDSRVAWGLLLAAGIAFPWLAGNDYHLTVMSTAYIFAIATL
FT                   GLNLITGYTGQLNLAHAGFMAAGAYTVGILTVDHGWPFWGGLVMSGVVCAVLGYLIGIV
FT                   SLRLKGHYFSIFTLCVGYIMFLVIEKWEGLTHGTVGIMGIPAPEALGALSFESPLALYY
FT                   LVLAFLVASVWVMRRIVRSLLGRTFMAIRNSDELAEALGINLMRNKVLAFMLSVVYAGV
FT                   AGGLYAGFVRFIGPDMAGVHHTFDMMIFAMVGGMGTVLGPLLGAIGMPWITQYLQFLQE
FT                   YRFIVFGPILVMLVIFMPYGVVGSFTAWRARRNAKEGKPHAQD"
FT   gene            295019..295783
FT                   /locus_tag="Daci_0262"
FT   CDS_pept        295019..295783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0262"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: reu:Reut_B3658 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32908"
FT                   /db_xref="GOA:A9BQV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQV3"
FT                   /protein_id="ABX32908.1"
FT                   /translation="MLKIDHLTKTFGGLAAVSDVSTVIEEGRINAIIGPNGAGKTTFFN
FT                   LISCVHKPTSGTITFNGQDVTSLRTDQVAKLGVARTFQTTALFDRATVLDNLIVGHRLR
FT                   TRSGLWDVLRGSSRLREEERVCREKARDALDFVGLSHVAGRIAGDITQEERKRVAFALA
FT                   LATDPKLMLLDEPAGGVNPEETEGLAELIRKLVRHGITVALIEHKMGMIMSLADKILVL
FT                   SYGEKIAEGTPEEIRRNPAVIDAYLGSEHAEV"
FT   gene            295770..296477
FT                   /locus_tag="Daci_0263"
FT   CDS_pept        295770..296477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0263"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: reh:H16_B2040 ABC-type transporter, ATPase component:
FT                   HAAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32909"
FT                   /db_xref="GOA:A9BQV4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQV4"
FT                   /protein_id="ABX32909.1"
FT                   /translation="MLKFENVSLRYGSFLALDGVSLHADRGELVVLLGANGAGKSSLFL
FT                   TASGIHKAAGGSIVWNGRELAGSKPSAIVQSGVVQCPEGRKLFPQMSVLRNLQLGAYVH
FT                   RRDPGPSQKTLQEVMELFPILREKQHDPAGSLSGGQQQMVAIGRAMMGRPQALLLDEPS
FT                   LGLAPLVIKQMFEAIQRINAAGTTVLLAEQNAYAALKIAHRAYVMESGRIVREGKPAEL
FT                   LADDSIRKAYIGA"
FT   gene            296655..297830
FT                   /locus_tag="Daci_0264"
FT   CDS_pept        296655..297830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0264"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rme:Rmet_3976 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32910"
FT                   /db_xref="GOA:A9BQV5"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQV5"
FT                   /protein_id="ABX32910.1"
FT                   /translation="MTAFAPLTRRRVGTLALACAAVAAAGPALAQEVVKIGYSGPLSGG
FT                   AAQYGKNVLDGMQMAVSEINAAAPEIGGKKVKIEIVPLDDKYNPSETAINAQRLVQQHK
FT                   TAAILVPHSGGIFALQTTNERSNFIVLAYSSVPQITNRGNKLTLRIPPEFTSYIDPFSK
FT                   YVMGRFGKKVALVGADHDYAKAWVAAFKPGWEKLGGTVVAENAMSYNRATDFYSGVSKA
FT                   LAEKPDVLFVGGASEPTALVVKQARELGFKGGFVVMDQAKLDEMARVVGGYAPLEGAIG
FT                   VMPVSEDTKPENKAFVERFGKVYPGRIPGSEAQWNYTAVHATVKAMQLAGSASDTKAIH
FT                   AKLDEAYKSLRPDVNPGGVKGVDERGGTLTTERGAAVRDGKIEAVMTVGSR"
FT   gene            complement(297871..298209)
FT                   /locus_tag="Daci_0265"
FT   CDS_pept        complement(297871..298209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xft:PD0997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32911"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQV6"
FT                   /protein_id="ABX32911.1"
FT                   /translation="MVKSLKALQAMDTEKLAQAIEADAGEAVPGLRQALQEAKTGQFAA
FT                   VHTPEQIAARKRGRPQGSVKADAKIATNIRFDPDVLQALKATGQGWQTRVNELLRADIE
FT                   SGRLKRSL"
FT   gene            complement(298329..299102)
FT                   /locus_tag="Daci_0266"
FT   CDS_pept        complement(298329..299102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0266"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rso:RSc1763 gluconate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32912"
FT                   /db_xref="GOA:A9BQV7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQV7"
FT                   /protein_id="ABX32912.1"
FT                   /translation="MSVKALFNLTGKTALITGGSRGLGLQMAEALGEMGARLAITARKS
FT                   DELAEAKAHLQGLGYQVETFTNDLQKFDTIPALVDDVLTRCGDIDILVNNAGATWGAKA
FT                   EEYPDEAWNKVMNLNVSAPFFLTREVARRVMIPKGQGNVIITASVAAFKGTPPGMNTVA
FT                   YNTSKAAAVHLARTLASEWGHYGIRVNSICPGFFPSKLANGLIDKLGDQLIARAPLRRI
FT                   GGEEDLKGAVVYLASDASRHMTGQALVLDGGASLL"
FT   gene            complement(299247..300053)
FT                   /locus_tag="Daci_0267"
FT   CDS_pept        complement(299247..300053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0267"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; KEGG: reh:H16_A2948
FT                   transcriptional regulator, IclR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32913"
FT                   /db_xref="GOA:A9BQV8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQV8"
FT                   /protein_id="ABX32913.1"
FT                   /translation="MPPSRTPPPQPGDDDRNFIVALARGLDVLSCFRSGEKLLGNQDIA
FT                   RRCGLPRSTVSRLTHTLTTLGYLIHVPEEGKYRLGTATLALGSAMLSRLDVRQIARPLM
FT                   QKLAATTDAEVALAARDRHNMVYIEHCPSARFTHRDLDMGSRIPLATTAVGRAWLAASP
FT                   ASERQRALDYLQSHAPEQWAAAQAQLPLWPGASTHPQPWLSCSFGDWQPEVNAIALAFS
FT                   PGRGLPLMAVSLGGPSRFVTADALRQDGVPALQRMVRRLQQDIDRA"
FT   gene            complement(300098..300871)
FT                   /locus_tag="Daci_0268"
FT   CDS_pept        complement(300098..300871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0268"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   ajs:Ajs_0153 ferredoxin--NADP(+) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32914"
FT                   /db_xref="GOA:A9BQV9"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQV9"
FT                   /protein_id="ABX32914.1"
FT                   /translation="MSAFLEERVLSVHHWTDRLFSFTTTRDTALRFSNGHFTMIGLKVD
FT                   GKNLLRAYSIASPNYEEHLEFLSIKVPDGPLTSRLQNIQVGDTILVGKKPTGTLLIDYL
FT                   LPGKNLYLIGTGTGLAPWLAVARDPETYERYEKVVVVHGVRHASELAYQELFEKELPEH
FT                   EFLGEIVKDKLVYYPTVTREPFRNQGRISNQITAGTFPQNIGLPELNPETDRVMLCGSP
FT                   AMLNELKELLEHRGFKEGNTTTPGDFVVERAFVEK"
FT   gene            complement(301132..302145)
FT                   /locus_tag="Daci_0269"
FT   CDS_pept        complement(301132..302145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0269"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ajs:Ajs_0158 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32915"
FT                   /db_xref="GOA:A9BQW0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQW0"
FT                   /protein_id="ABX32915.1"
FT                   /translation="MVCNDSDCIEGRFLDKLAVSDLFVRLMQTIKLLEQMQIFSRVAEM
FT                   ASFTRAADSMGLPKASVSQAVQQLEARLGTRLLHRTTRRVQLTQDGQACYERCQDLLAD
FT                   VDEFQGQFQQAGDAPLQGKVRLDMTTGLARHVVMPLLPQLLQSHPALELELSCTERRVD
FT                   LVREGFDCVLRLGPVDEPGLVARPLGLVALATCASPGYVQAHGLPATLQDLGGHRLVHY
FT                   QRTLGARPLGFEYEEDGQPRYLPMAGALTVNNAEAYLAACQAGLGLIQVPRLAVQPLLD
FT                   AGELVEVLPRHPPPPMPLYLIYAQRRQLPRRVRVLMDWLAEAVLPWTLGAGPAEKP"
FT   gene            302161..302952
FT                   /locus_tag="Daci_0270"
FT   CDS_pept        302161..302952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0270"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ajs:Ajs_0159 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32916"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQW1"
FT                   /protein_id="ABX32916.1"
FT                   /translation="MTASPSTASSPAARRIVLITGGSRGLGRNTAGHLARQGLDVVLTY
FT                   RERADEAQAAVAAIEALGGRAAALQLDVARSAGFADFAARVRQALADTWQADRLDALVH
FT                   NAGIGINAPFATTTEAQFDELVAIHLKAPFFLSQHLLPLLRDGGSIIHLSSGLTRFTQP
FT                   GYAAYASMKGGVEVLTRYLARELGARGIRVNTVAPGAIATDFGGGRVRDDAQMGAALAS
FT                   QTALGRVGQPDDIGPVMAALLQPGMGWVQGQRIEASGGMFL"
FT   gene            complement(302970..303251)
FT                   /locus_tag="Daci_0271"
FT   CDS_pept        complement(302970..303251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_0928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32917"
FT                   /db_xref="GOA:A9BQW2"
FT                   /db_xref="InterPro:IPR021762"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQW2"
FT                   /protein_id="ABX32917.1"
FT                   /translation="MSMAHLFCQLLALGAFACLALAMDRHQSDLFGKELPPARTRRLRA
FT                   AGWVLLALSLWAALQVEPWSLGLVAWFGHIAAAAAIVLLSMVARERLR"
FT   gene            complement(303248..304975)
FT                   /locus_tag="Daci_0272"
FT   CDS_pept        complement(303248..304975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0272"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: rpb:RPB_3524 PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32918"
FT                   /db_xref="GOA:A9BQW3"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQW3"
FT                   /protein_id="ABX32918.1"
FT                   /translation="MSTNTTDTTNTAGKPTKPAKAAKPGKAAKAPGIRQTMSDLHTWVG
FT                   LLLGWFLYAMFLTGTVSYFRNEITQWMQPEQPHQSQASEPALVAQRVGDAMARLAPQSP
FT                   RWLINLPDERSTVATVFWSPPEGQDKRRFENGRFDPATGTRLEGPVRETRGGEFFYRFH
FT                   FQFHYMPVLWGRYLAGLCAMFMLVAIVSGVITHKKIFADFFTFRWGKGQRSWLDAHNAL
FT                   SVLGLPFHLMITYTGLVTLALMYMPWANLATTMTPEQRVVAGQQLSAFVPAGKPSGQAA
FT                   PLAPLADMVRQAEQRWGAGQVERLNVNLPGDANARVTAIRGENGRVSISPQFMMFDGVS
FT                   GQLLQAQDSVGAAAETRGVLYALHMGRFGDLPTRWLYFIVSLAGTAMVGTGLVLWNVKR
FT                   RSKLPDPERPHFGFRLVERLNIATIAGLSIGMAGMLWANRLLPVEMAQRAEWEVHAMFI
FT                   AWGATLFWALGRPAKRAWIELLWAGAAALALLPVVNALTTDRGLLASLRAGDWVFAGMD
FT                   LMLLALAALHAHLALRTQRHQPKAKPVRAARPAPKAATAAAATAVAATAAAAAAETSA"
FT   gene            complement(304972..305298)
FT                   /locus_tag="Daci_0273"
FT   CDS_pept        complement(304972..305298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_2857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32919"
FT                   /db_xref="GOA:A9BQW4"
FT                   /db_xref="InterPro:IPR022109"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQW4"
FT                   /protein_id="ABX32919.1"
FT                   /translation="MPSPTLARTHDWFRDWFRDYGPLISRILAALFGGYAVAALASVAV
FT                   LALPADRTQAAISGTLLSFAVYAGAVIWVFAVRSAWRAWAGLLVAALVLAPVAWWTWGK
FT                   GLGA"
FT   gene            complement(305443..306303)
FT                   /locus_tag="Daci_0274"
FT   CDS_pept        complement(305443..306303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0274"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: vei:Veis_4138 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32920"
FT                   /db_xref="GOA:A9BQW5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQW5"
FT                   /protein_id="ABX32920.1"
FT                   /translation="METLDLDLLRTLAAIASHDSFAAAAVQMGRTQSAITQQMQRLEEK
FT                   IGHALFEKQGRQKRLTDHGQRLLGYARHMLAIHDEALRNLQHRQVQGLVRIGAPHDAAD
FT                   NMLPPVLQEIALNFPAMQIDIHVGRSPFLMESLKQGELDLAISNREDEGFEGFALRSTP
FT                   TVWLCGAGYAHDPGKPVPLVMADGPSIFRRLGCDALDAAGIAWTPRHTCTSLVGIRAAL
FT                   RAGLGVTARGVEQLDPGLRVLGAGDGMPPLPDLVYRLYIRSHVISPVTRQIFENLQARM
FT                   RQPAG"
FT   gene            306334..307014
FT                   /locus_tag="Daci_0275"
FT   CDS_pept        306334..307014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_4137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32921"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQW6"
FT                   /protein_id="ABX32921.1"
FT                   /translation="MRGLLRAGRLTTVDFNDDKEPPLNTTTTTNNNTITEQRSAAVAAA
FT                   IDSMKQAIGEDAATRASLDAVLQQLLGLAARRDFWQQADYAAPEEGEHQARYLIAEDAD
FT                   QSYALYLNVMRPGKRIVPHNHTTWACIAAVEGTEHNRVYERTDDGSVPGKGTLRETELV
FT                   VVAPGQGIALMPEDIHSVEIQGDQVIRHLHMYGRALETLNERTSYDLATGTCQTMAIGV
FT                   QTRR"
FT   gene            307146..308717
FT                   /locus_tag="Daci_0276"
FT   CDS_pept        307146..308717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0276"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: vei:Veis_4136
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32922"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQW7"
FT                   /protein_id="ABX32922.1"
FT                   /translation="MTASIDAHTLKSWLHDGQEIALLDVREHGQYGESHLFYATPLPYS
FT                   RLELDVPRLVPRRQVRVVTYDGGEGDASAGVAERAARRLEALGYTRVAVLEGGAKAWSA
FT                   AGYTLFAGVNLPSKTFGELAEHAYGTPRITAQQLAARQAAGLPLVVLDGRPVSEFHKMN
FT                   IPGAICCPNGELALRVSRLVPDAATPIVVNCAGRTRSIIGAQTLINLGIPNPVYALENG
FT                   TQGWYLADLPLEHGGTQRYGDDSASSALQAQARALAERFDVPEVDADTVRTWSQDAART
FT                   LFLCDVRTPEEFKAGSLPGAQHTPGGQLMQAGDQYVGVRGARLVLFDSDGVRAPVVASW
FT                   LRQLGHDACVLRGGLHSGLDLAPAQLPQAPALAGITAQALHERMRQGEVAVVDLRAGMK
FT                   YRAGHIAGARWSIRPCLASDLAGETRQIVLVADEPGMAQWAALELQGAAPLLLEGGLAA
FT                   WQQAGLPVQATPDSPTDAECIDYLFFVHDRHDGNKEAARRYLAWETGLVPQLDAQELAA
FT                   FRLPSA"
FT   gene            308911..309909
FT                   /locus_tag="Daci_0277"
FT   CDS_pept        308911..309909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   vei:Veis_4135 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32923"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQW8"
FT                   /protein_id="ABX32923.1"
FT                   /translation="MFAILNLARMLAASLAALAMLSQATAEPLAARNGYPAQPIRFISP
FT                   FPPGGGNDASTRWVTTRLTEATGQPSVVENRGGAGGNIGAKAVAEAKPDGYTVLTGQVS
FT                   LMAVNPALYSAPGFDPLKNFVPITQINAAPLAIVVASASPLKSFADLVARSKGEPGRVT
FT                   YATPGNGTLSHLVGVVLSKENGVPMTHVPYKGAGPAINDLLGQQVDVLITSTSSVAGMI
FT                   QAGQVRALAVTSPRRIGVFGKVPTLEELGLRNARFEDWYGFFAPAGTPPERVAFLHDAI
FT                   VRTLQLPEVTKLVVDGGSEVVANTPEAFAAQLRQDMERWSRVVKLSGAKID"
FT   gene            309909..311126
FT                   /locus_tag="Daci_0278"
FT   CDS_pept        309909..311126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0278"
FT                   /product="cystathionine beta-lyase"
FT                   /note="TIGRFAM: cystathionine beta-lyase; PFAM: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein; KEGG:
FT                   vei:Veis_4134 cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32924"
FT                   /db_xref="GOA:A9BQW9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQW9"
FT                   /protein_id="ABX32924.1"
FT                   /translation="MAAEHAPLPGSSAPGAPALDLQTRLLHAGKRPAYAGGTAVNPPLV
FT                   RASTVLFESTAQQREMRERRAGERIFSYGARGTPTGFALEDAVSELEGAHRTRLLPTGL
FT                   AAIGMALLSYLRPGDHVLLTDSAYQPVRHLAGQWLRPYGIEYDFFAADGSDAQARMRPN
FT                   TRMVYAECPGSLVYEMCDLPALAAMAHARGALVVADNTWGSGCQYRPLALGADVSVMAA
FT                   TKYLSGHSDVMMGTVATTEAAWEPLAARCDAFGMAVSPDDAWLVLRGMRSLAARLQMHE
FT                   AHALEVAHWLQQHPAVATVFCPALPTHPGHALWLRDCQGTNGLVSLELQPGTAEAAVDR
FT                   FIDGLRLFGIGASWGGYESLATAAHMAHARSVTDWSARGPVVRLHIGLESPRDLIADLE
FT                   QGLAAL"
FT   gene            complement(311140..312213)
FT                   /locus_tag="Daci_0279"
FT   CDS_pept        complement(311140..312213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0279"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   reu:Reut_B5128 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32925"
FT                   /db_xref="GOA:A9BQX0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQX0"
FT                   /protein_id="ABX32925.1"
FT                   /translation="MSTEKTAWMARLGMRHPIIQAPMAGTSTPALAAAVTEAGGLGSLG
FT                   IGASGTEQARQQIVQTRALTSGAFNVNLFCHRPARADAQREAAWLAHLAPEFARFGAKP
FT                   PAGLNEIYATAVGNAALQAMLLQERPAVVSFHFGLPEQGFIDALRAAGVVTLASATSLD
FT                   EARQVEQAGVDAIVAQGVEAGGHRGTFDPAQDRMMGTFALVRVLARNTALPVIAAGGIM
FT                   DGEGIAAALGLGACAAQLGTAFILCPESSASPAFRAELRSERAHHTGITAAISGRPARG
FT                   MVNRLHALGASHGQPLPDYPRVYDAGKALHQAASAQGSSDYAAHWAGQGAPLAREMPAA
FT                   ALVQTLAGELASAQAGR"
FT   gene            complement(312248..313435)
FT                   /locus_tag="Daci_0280"
FT   CDS_pept        complement(312248..313435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0280"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1; KEGG: mms:mma_1602
FT                   transporter of the MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32926"
FT                   /db_xref="GOA:A9BQX1"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQX1"
FT                   /protein_id="ABX32926.1"
FT                   /translation="MIQRNETSLLLTGFMATLSGVGLARFAYTALMPQMVHAGWFSGEQ
FT                   VAYLGAANLLGYLIGALAAAPLAERLGALRVLLWCWVALALSFAACAWPLPMPWFFAWR
FT                   CISGIGGAILMVLGPSVALAATPLQRRAALGPLMFCGIGAGALLSATLIPLLARQSLGA
FT                   VWWALAAVCAWAGWLGWRHVRRLPAPAPIAITPHARPVPAAPLWTLPVVLVMLAYMTDA
FT                   FGFVPHTVFWVDYLARELQLGDAYASTQWAVFGLGAIAGPLVASLCATRFGWWGTTTGA
FT                   YAVKTLAIAMPLFWVGFAGHATSSFLVGALSPGMAAITSGYLMQLIGPAQHKRMWGYAT
FT                   AAFALMQAVSGYFMAWSYAGLGSYQRLFVIGSVSLLLGTLMIAASRASARRQAAA"
FT   gene            313552..314475
FT                   /locus_tag="Daci_0281"
FT   CDS_pept        313552..314475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0281"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mms:mma_1603 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32927"
FT                   /db_xref="GOA:A9BQX2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQX2"
FT                   /protein_id="ABX32927.1"
FT                   /translation="MQLKSLRMFLAVCDSGSFGAAAQQLHTVQSNVTAHVKKLEDEAGV
FT                   QLLERSAPVHATPAGRLLEQYARRMLADHDEALALLQGSSRAAGALRIGSMETTAALRL
FT                   PPLLARLHQAQPGLDLELRTATTAELLADLLAGRLDCAFVSGMPPQSRLQGWRVFEEEL
FT                   VLVTAFALPRFPDAAQLSAVPFLAFRQGCSYRQRIELLLAARGVAARIMEMGSLDAILG
FT                   CVAAGMGYGLLPRSVVQAQQHRFGVHITALPGALAQEVARVETWFVVPARQGWSPALHA
FT                   CVEVLGIEGVQGEEALGMEAVPAASA"
FT   gene            complement(314479..315834)
FT                   /locus_tag="Daci_0282"
FT   CDS_pept        complement(314479..315834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0282"
FT                   /product="HipA N-terminal domain protein"
FT                   /note="TIGRFAM: HipA N-terminal domain protein; PFAM: HipA
FT                   domain protein; KEGG: bam:Bamb_4540 HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32928"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQX3"
FT                   /protein_id="ABX32928.1"
FT                   /translation="MATPPSLSLSLWNDVGTHVADVTHDPHNDLWGLRYAPAWLEQERP
FT                   FYLAPCLPLAAPEGGYDSRSIRRFIENLLPEGAALDVVARSQGIGKGNIFGLIRALGAE
FT                   TTGAFRFQADGSKPDPQAANAARPISTAELAQRIADRDTRPFIEWDGKVRMSVAGYQDK
FT                   LPVHVEGESVQEGTIFLPDNVPSTHILKPQPRDSAMPHMVVNEHFCMRLAAAMRLPAAE
FT                   VQMLHVPQPVLAVRRFDRVRQAPQRRVLRTHIIDACQAGDLPVSYKYEHHIGSVGDARL
FT                   YRDGMSFPRLFGLLEHSVAKAADKLAMIRWALFQILIGNGDAHGKNFSFHVLPQGLATA
FT                   PWYDLVSVAQYPDVSQDLAMAFGDCFALEELTPFEFAHFAHLCAIDRRLLAREAQRMAK
FT                   AAPVAAAKVLRESPYTPEEHAFAQRIAAYATTQAQRLVDIAQKAAALPSDLF"
FT   gene            complement(315842..316141)
FT                   /locus_tag="Daci_0283"
FT   CDS_pept        complement(315842..316141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0283"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bam:Bamb_4541 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32929"
FT                   /db_xref="GOA:A9BQX4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQX4"
FT                   /protein_id="ABX32929.1"
FT                   /translation="MPSSTLMNGPQQEPLQPAAVVIADLSGLGAQIRAMRKAQQLRIDD
FT                   TAALCGVSLDLLSRLENGKGGVGSDKLLAVLDGLGLAMVIAPKQDALMARLPRA"
FT   gene            complement(316313..317962)
FT                   /locus_tag="Daci_0284"
FT   CDS_pept        complement(316313..317962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0284"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: vei:Veis_3316 Mg chelatase, subunit ChlI;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32930"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQX5"
FT                   /protein_id="ABX32930.1"
FT                   /translation="MGLALVQSRALLGLAAPRVTVEVHLANGLPSFTLVGLADVEVKEA
FT                   RERVRSALLNSGLEFPSNKRIIVNLAPADLPKDSGRFDLPIALGILAASGQINGDALAD
FT                   YEFAGELSLSGALRPVRGALATALALHRQQDGARLVLPPGSAQEAAFVPSAQVFCAHHL
FT                   LDVVRRFITRSANALVQTEQETDDACCSDESEDTGEIDETDETDALPAAGDTQTCSGPG
FT                   WHAVQPQPAAPVRSSLDLAEVRGQAQARRALEIAAAGGHGLLLVGPPGSGKSMLAQRFA
FT                   DLLPPMSDDEALEAAAIASLAGRFTPERWRQRPTASPHHTASAVALVGGGSPPRPGEIS
FT                   QSHHGVLFLDEFPEFARSALEALREPLETGQITIARAAQRCEFPARFQLVAAMNPCPCG
FT                   HWGSTVQRCRCTPDKVARYQARISGPLLDRIDLHVEVGALPPQELLAARSGETSEAVRE
FT                   RVVQARALAVQRQGSANHQLQGQALDDHLGLSPEALAFAHKAAARLGWSARSTHRALKV
FT                   ARTIADLAGSAAVETGHVAEAMQYRRVLRLPS"
FT   gene            complement(318129..319511)
FT                   /locus_tag="Daci_0285"
FT   CDS_pept        complement(318129..319511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppf:Pput_3076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32931"
FT                   /db_xref="GOA:A9BQX6"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQX6"
FT                   /protein_id="ABX32931.1"
FT                   /translation="MEALLTNDIAVAAAMGLIGAVVFAAIGLVSGTDETTTLAPLTLLV
FT                   VLLGVPPAGVFTFFLAGAVAKHMTHAVPTALLGIPGDTLATPLLQDANMLRKLGVPHIA
FT                   LRKMVSGGIVAAFVAVPLAVLFAVMLAPFGSMITKTAPWIFLAAALLIAYFSAGRWASV
FT                   MLLIPFVVVIIALQSLTAKYEVKLSISYFLGIAIGPLIADLFTVISPAGRQRMLRDKVR
FT                   QFNLAPDVKGWSGYFPNPLKVLDRVQTRWTLATATISSATFVFSPVAMTVVLGELVGSR
FT                   IKHAYHRLTTVLSARNGVTEATYIAEALIPLIAFGLPLSPVAAGPAAPLFNAPPRFTVD
FT                   AATGQVNNLHNLLSHWEFLGYGMLAVLLAALVSYPFAMNFARSAALFVSRRVSHEAIIA
FT                   TFVGLIIVISVWEGQLLGLLVILTMGLLGGLLSRGFGFNTGVQFMGYYTAVLSVPALVK
FT                   LF"
FT   gene            complement(319513..319938)
FT                   /locus_tag="Daci_0286"
FT   CDS_pept        complement(319513..319938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppf:Pput_3075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32932"
FT                   /db_xref="GOA:A9BQX7"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQX7"
FT                   /protein_id="ABX32932.1"
FT                   /translation="MTSKDPADWRLAEVWGDTVDLRHLAWAIAIGTGISVLGFYLASRW
FT                   LVTVVESRQLAHAYAMLAGLAGCVIAGVICARAFAPKREVTELDTSNDPEWRREVLEEL
FT                   ARQPGGLGTVQDLPPAVVQELKELKLYELFADKAGRA"
FT   gene            complement(319980..321269)
FT                   /locus_tag="Daci_0287"
FT   CDS_pept        complement(319980..321269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0287"
FT                   /product="hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /EC_number="1.1.1.88"
FT                   /note="TIGRFAM: hydroxymethylglutaryl-CoA reductase,
FT                   degradative; KEGG: bch:Bcen2424_3505
FT                   hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32933"
FT                   /db_xref="GOA:A9BQX8"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="PDB:6DIO"
FT                   /db_xref="PDB:6EEU"
FT                   /db_xref="PDB:6EEV"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQX8"
FT                   /protein_id="ABX32933.1"
FT                   /translation="MVADSRLPNFRALTPAQRRDFLADACGLSDAERALLAAPGALPLA
FT                   LADGMIENVFGSFELPLGVAGNFRVNGRDVLVPMAVEEPSVVAAASYMAKLAREDGGFQ
FT                   TSSTLPLMRAQVQVLGVTDPHGARLAVLQARAQIIERANSRDKVLIGLGGGCKDIEVHV
FT                   FPDTPRGPMLVVHLIVDVRDAMGANTVNTMAESVAPLVEKITGGSVRLRILSNLADLRL
FT                   ARARVRLTPQTLATQDRSGEEIIEGVLDAYTFAAIDPYRAATHNKGIMNGIDPVIVATG
FT                   NDWRAVEAGAHAYASRSGSYTSLTRWEKDAGGALVGSIELPMPVGLVGGATKTHPLARL
FT                   ALKIMDLQSAQQLGEIAAAVGLAQNLGALRALATEGIQRGHMALHARNIALVAGATGDE
FT                   VDAVARQLAAEHDVRTDRALEVLAALRARA"
FT   gene            321388..322794
FT                   /locus_tag="Daci_0288"
FT   CDS_pept        321388..322794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0288"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bch:Bcen2424_3504 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32934"
FT                   /db_xref="GOA:A9BQX9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQX9"
FT                   /protein_id="ABX32934.1"
FT                   /translation="MADTRGRSAPIAEKLADLIGQQIADGVYRPGDKLPSLRELAQLHR
FT                   YAKNTVVSAFDLLVSRGIVEPRRGSGFYVLGSGRGAQRTDEDAGQLGRAMDIVWLMREQ
FT                   LKTQPDCVGVGDGFPPVEWLADMRLDRYHQKVVRTGLGSLFRYGSRYGYAPLRDSLVRK
FT                   LGDFGLQATPGQLVLTHGANEAMDLVIRYFVPPGATVLVDEPGYYPLFGKLRLAGAHVV
FT                   GVPRLADGPDVAALESLLAQHRPRLFFTQSLAHNPTGSDISAAKAYKVLQLAERHNLLI
FT                   VEDDPLADFKPTSAVRLSTLDQLERTIYIGSFSKSFSAALRVGFIACNDALASDLADLK
FT                   ALIHVSGSEYCERMVDVMLREGHYERHLVRLRHKLGQATAQALGWLDAHGCEVFARSPQ
FT                   SLYLWVAFPGVQDSLRLAEQLVPRKLSMAPGRVFHVDPSAVSRWSRCNVSAMLDPRFQA
FT                   AMGQVLAHPA"
FT   gene            complement(322782..323801)
FT                   /locus_tag="Daci_0289"
FT   CDS_pept        complement(322782..323801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0289"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B1032 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32935"
FT                   /db_xref="GOA:A9BQY0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQY0"
FT                   /protein_id="ABX32935.1"
FT                   /translation="MLNKSNFGHIRYLALMPANTPESAPPVLHRSLLNRLRYKHLHMLV
FT                   ALGSSLNLHRASLSLAMSQPAATRMLREIEDMFGCQLFERLPRGMRPTALGAQLVRFAE
FT                   ASLNSLDRCAEDLAARRQGGYGYLSIGTIMGAAPDLVMTAVARMKAQSPQLRLRIMGDT
FT                   SDQILRLLDQRRIDMAIARRSPAAHSSSYSFEELGNERLLVVVRSGHPLTRRRKLGWQE
FT                   LVGDWPWILQPATSPARIALDQLLQRLELPVPADIIECSSVYSMQQLVQLTDAVMLLSE
FT                   SALKDYLRMGLVRALPVCIDVPMAPFGILTRTDDAPTQEQQRFIALLRAQARGLAQAG"
FT   gene            323988..325301
FT                   /locus_tag="Daci_0290"
FT   CDS_pept        323988..325301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0290"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_1492 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32936"
FT                   /db_xref="GOA:A9BQY1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQY1"
FT                   /protein_id="ABX32936.1"
FT                   /translation="MPARKVMKKLPAPLLARISWRLLPFLLLMYIMAFLDRANVGFAKV
FT                   AFQADTGISDAAFAFGAGVFFAGYALLEVPSNLIMHRVGARMWMCRIMVTWGLVSAAMM
FT                   FAHDQTTFYVLRFLLGVAEAGFFPGVILYLTYWFPAAHRAQAMGFFYFGAPLAFIFGSP
FT                   LSGLLLELDGMGGWHGWQWLFAVEGLMAVAVGIWAYFHLDNRPADATWLSREDKALLQD
FT                   ILDSEERAKGSHGHSLLAALCQPRVLYLALIYLLIQASVYGVVFYLPSQVAGLLGTKVG
FT                   LLVGVVSAIPWLCALLAAWWIPGHAERTGQPRGIASLTLVMAAVGMAASVSFSSPLLGV
FT                   AALCLAAAGFIAVQPVFWTFPANTLAGAAAAGGIAFINSLGAVGGFIAPIVKNWAEGFF
FT                   HSPAAGLYLLAGTTLLAAALVLGVRARLAPALAAPSAA"
FT   gene            325307..326518
FT                   /locus_tag="Daci_0291"
FT   CDS_pept        325307..326518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0291"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: pol:Bpro_1493 mandelate racemase/muconate
FT                   lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32937"
FT                   /db_xref="GOA:A9BQY2"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023444"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BQY2"
FT                   /protein_id="ABX32937.1"
FT                   /translation="MHTEQNHPMTQIPTIKQVRAFTLKGGGADYHDQSDGHWIDDHIAT
FT                   PMAKYPEYRQSRRSFGINVLGTLVVEIEDSAGRVGFAVTTGGEPAAYIVEKHLARFLEG
FT                   ARVTDIERIWDQMYLSTLYYGRKGIVINTISGVDLALWDLLGKVRGEPVHQLLGGAVRD
FT                   ELQFYATGARPDLAQKMGFIGGKMPLHHGPAEGEEGLRRNLQELATMRERVGPDFWLML
FT                   DCWMSLDVNYATRLAQGAQAHGLKWIEEALPPDDYWGYAALRKNVPTGMLVTTGEHEAT
FT                   RWGFRQLLEMGCCDIIQPDVGWCGGITELLKISALADAHQALVIPHGSSVYSYHFVATR
FT                   HNSPFAEFLMMAPKADEVVPMFHPQLLGEPVPVNGRMRLSALDRPGFGVELNPECALHR
FT                   PYTH"
FT   gene            326530..327339
FT                   /locus_tag="Daci_0292"
FT   CDS_pept        326530..327339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0292"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: csa:Csal_2517
FT                   2-dehydro-3-deoxyglucarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32938"
FT                   /db_xref="GOA:A9BQY3"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQY3"
FT                   /protein_id="ABX32938.1"
FT                   /translation="MQLPANPFKAALRRAEPLYGIWAGFATPYAAEIIATTGYDWMLVD
FT                   GEHAPNTVPTLLGQLQAVAPYATHPVVRAVQGDTVLIKQLLDVGVQTLMVPMVETAEQA
FT                   RELVRAMRYPPHGVRGVGGGLTRATRWDAVPDYIRTAHEQLCLIVQIESPRGVAHAAEI
FT                   AAVEGVDAVFIGPADLSTGMGHAGDASQGEVQEAIRRTVQATLAAGKACGILAPREEDA
FT                   RRYADWGCRFIAVGIDISLLRQAALANLGRYRATQATDQAAPASRTY"
FT   gene            327356..328789
FT                   /locus_tag="Daci_0293"
FT   CDS_pept        327356..328789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0293"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: mpt:Mpe_A0361
FT                   lactaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32939"
FT                   /db_xref="GOA:A9BQY4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQY4"
FT                   /protein_id="ABX32939.1"
FT                   /translation="MASLPVLRNFIAGSFTDSAELHEVTNPATGAVLARSPLSSQADVD
FT                   RAIAAARGAHKAWARRPAVERAQYLRRVAARIRDNAARIARTITEEQGKVLGLAEVEVN
FT                   FTADYLDYMAEWARRIEGEVITSDRANEQIFLLRKPLGVVAGILPWNFPFFLIARKMAP
FT                   ALLTGNTIVIKPSEETPINCHAFTELLAQCELPAGVFNVVYGQGGTGAALAGHAGVDMV
FT                   SFTGSVATGERIAAAAAPHITKLNLELGGKAPAIVLADADLDLAVRAIRDSRITNTGQV
FT                   CNCAERVYVQRQVADEFTARIAQAMAATRYGDPIARPDVEMGPLINQKGLDSVQAKVRQ
FT                   AIADGAQLVTGGQAADLGAGFHFQPTVLAGCHAGMEIMRKEIFGPVLPIQVVEDLDEAI
FT                   ALANDCEYGLTSSLYTRDLSKAMQAMREIDFGETYINRENFEAMQGFHAGVRKSGVGGA
FT                   DGKHGLYEYTHTHVVYLQG"
FT   gene            complement(328811..329326)
FT                   /locus_tag="Daci_0294"
FT   CDS_pept        complement(328811..329326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0294"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: aav:Aave_4468
FT                   transcriptional regulator, TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32940"
FT                   /db_xref="GOA:A9BQY5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQY5"
FT                   /protein_id="ABX32940.1"
FT                   /translation="MTDLHRWRHPAVLDDMFLYHLARLQAAAGSRVVRLCEGRYGITRR
FT                   EWRMLCLLAEAGQLQPSQLAEQAQLDRTRTSRAVTALLAKGLLWKESQVGDARRALLRL
FT                   SDTGRALHAELFPQVQAINRELMDAVPEPELQAMASAFARIRTRARELEASSPPPKAPR
FT                   NRRKPAAP"
FT   gene            329429..330406
FT                   /locus_tag="Daci_0295"
FT   CDS_pept        329429..330406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   reh:H16_B0482 probable extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32941"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQY6"
FT                   /protein_id="ABX32941.1"
FT                   /translation="MPSPLAAMARAAVALTAAVLCAAPALAQEWPKARPIRIVVPNPPA
FT                   GPSDISLRPVAAAMQAALGQAVVVDNKPGANGNIGAAEVARSAPDGYTWLWAMDPVLTV
FT                   NPHVYKNMGYKADALETLVVAARFSQTLVCSPGTGFKSVKDMVAASKTRELTYASGGAG
FT                   SPGHLVMESLLATSGAKMVHVPYKGPAPAMQDLLGGQVDCGFLAGPTVFPQVQSGKLIA
FT                   LATSGKTRSALAPELPTIAESGFPEFDGTFWILLAAPKGVPPAVQKRFVDAMNEAIRAP
FT                   EQKERAKALDIEMVGSTVAEAQARAKGQSAQWAALVKRIHLTND"
FT   gene            330492..331820
FT                   /locus_tag="Daci_0296"
FT   CDS_pept        330492..331820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0296"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: aav:Aave_4466 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32942"
FT                   /db_xref="GOA:A9BQY7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQY7"
FT                   /protein_id="ABX32942.1"
FT                   /translation="MATQRPNLIFILADDLGYADLGCTGARDAHSRATDVSPRLDAMAA
FT                   QGMRFTRGYSNSAVCSPTRFALATGRWQYRLRGAAEEPIASVHGDKVLGLPPDHPTVAS
FT                   LLRDAGYATALVGKWHLGYPPHFGPRMSGYEEFYGFHAGGADYFAHCDPRGRPDFWINE
FT                   EPHEEEGYLTDLLSRRAVDFVERQTADKPFYLSLHYSAPHWPWLTRDDLEESRRIGGFG
FT                   KHTDGGTIETYQRMIHHMDEGIGWVLDALEKKGMAENTLIVFTSDNGGERFSNNWPFIG
FT                   QKMDLLEGGIRVPLVARWPDRMPAGAVSDTPNLTMDWSATFLAAAGVHGHADYPLDGIS
FT                   LLPLMDDGAWNPERDLCWRMKHRAQRALVRGDWKYLQIEGVEYLFNVAQDPRERANLRD
FT                   REPQRLAELRAAWQQWDASLPPIPEEAKVSLVFSRQDLPSATF"
FT   gene            complement(331889..332752)
FT                   /locus_tag="Daci_0297"
FT   CDS_pept        complement(331889..332752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0297"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32943"
FT                   /db_xref="InterPro:IPR025115"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQY8"
FT                   /protein_id="ABX32943.1"
FT                   /translation="MTAKPTQTLIRILLATLSLSAATATYAAQCPLIPDGNATLEESER
FT                   AALLSEFKFEALDKELARKHKKNLSSSGGDLLTMRDMLGLQQLSLQEENVMRMWADQQP
FT                   KSFFAQLNAGLYYGNKAFGARGEAPASRVTGSQWNNVKQLSAKAQPYLQKAMVLDARSA
FT                   LPQTMLIGLAAMENQVGGRTAAQWLQAADQADPKNLAARVNALNYLSPRWGGSLEGLDQ
FT                   MVSQAVKSLPSASASYLQYNLVLAKASHYEVMEKDKSKAQALYKQAKDMCENSEAARAG
FT                   MVRTYQ"
FT   gene            complement(333618..333899)
FT                   /locus_tag="Daci_0298"
FT   CDS_pept        complement(333618..333899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS06029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32944"
FT                   /db_xref="InterPro:IPR028968"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQY9"
FT                   /protein_id="ABX32944.1"
FT                   /translation="MIIYLSYSVVDKSITLSYSNQGCESARADIDNVISLIEREWRGLD
FT                   MEQIKYKIKTASINKKEIDSQIKMENDLIWYGDVRFIFSSGRLVKVEY"
FT   gene            complement(333949..338526)
FT                   /locus_tag="Daci_0299"
FT   CDS_pept        complement(333949..338526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0299"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: RHS protein; YD
FT                   repeat-containing protein; KEGG: aav:Aave_4283 YD repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32945"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQZ0"
FT                   /protein_id="ABX32945.1"
FT                   /translation="MSGKPAARITDSVVKGKIVTGSRTVLIGSQGGLACSVCPGGITVG
FT                   SPVNPQLGAKVLLGAQDLDFALPSAALPVAWQRQYSSYVNPEHGAACGLLGHGWHLLQE
FT                   LSIRLQEEATLLLDASGRVITFDQPLVPGGQLHSASEDLWLLRGGSMEPDGGTAPWAAN
FT                   PRWSHVEQALVRNPQAILAVSGDGDTLWGFGPAPGEPVDGPWRLMAQIDRFGRRQLYHY
FT                   SDGTTPEAGHSAGKEAVPAGRLVSLSDGTGRRYRLLHQRIHGGKDAQGLNGLWGADDGW
FT                   RVTGVDLTQDPLHPLSTPIALVRYGYSSAGDLITVHDRAGQLVREFEWDHHRISAHRHA
FT                   SGPWHRYRYESAQPGARVIEHSNQEGLSYRFDYLAQPPGPDGQPRAATRVSDSLDRIET
FT                   YYFEGAAGLSRLIAHHKADGSRWLQAFDSFGRLASRTDPLGRSVHLRRDGQGRLIGVQL
FT                   PDGRSTQQEHDEATGRLLQSTDTAGATTGYEYDSWGRLTQITQADGSTERYHYPDPKEA
FT                   PLTCDSPRRIEDAQGGSKQLAWSDAGQLLSYTDCSGHSTHYHYDRWGALIEVDNALGQR
FT                   QRHQRDGQGRIVASELPNGQIERYHYDSAGHLTRIEPAQPAGTSSETQTADPSIHLRYD
FT                   LWGRLVQRTHGGLTLAFEYDSAGRLLRLVNENGSQSRFAWDALDRLVQEEGFDQRLQRY
FT                   RWDAAGQLLEATDGNAAQQSSSHYRWDEGGRLAERQLPATPHAPAQTHRYEWDAAGRLT
FT                   AASVWQHTGENTAENTIQLQSRIALERDALGRITAEVQQLYRPGKDGGGNGGTEQIEYE
FT                   HRIAHTLDALGARQHSQLQGLGDIAWLTYGSGHVHGLQLNGASLIDFERDNLHREVRRS
FT                   LHPPTPAADAHHPLQVQRQWDSLGRLTALGTTGLQALQPTDAQAHALIGQILGRRYHYD
FT                   SLGQLVAIEQAGAPGQAAQLLRYGYDGAGRLRAATDSQDPQTTTRWQIDPAGNRLPAPG
FT                   APGASGQTNTQDNWAAQVHAHWRHTDFNLMGLGHLAGQRQGPVQRWEDNRIGFTEDRVW
FT                   RYDPCGNRIAQMQADHSQQQLHYDGAHQLIAVRSSQIQGNAEQLRHHSRYTYDALGRRL
FT                   KQQVESADSTESTRTHYYGWDGDRLIHTERLQGGDDTRHIEHTIYEPGSFTPLVRLSTT
FT                   ASGDPQNEPHLLVQAIAAGLPDQDDPNHTPALAMMQTMLSAMPRDMQQDAARHLRHTLD
FT                   HGLPPSAQAMLGEQADSTTRLLNGMQAQLQKQEKEQHARIAIHHYHCDHLGAPMALTDQ
FT                   TGQVAWAAKLDPWGNVLQEYNPQGIHQAIRLPGQHHDRETGLYYNRHRYYDPVVGSYIN
FT                   QDPIGLMGGNNHYIYPVNPTGWIDSLGLQQACVVNFPDYPVEYAEGKTSTWLGGHSGVL
FT                   TYDTSGKTQYFEYGRYNPNAKGIMGSKLPQDDGNVRQTPMPNLKIGKDGVPTDDSMRNL
FT                   EEQLSKRSGKGTPAKLTCSSADPKKVADYAKEISENKDREKYNWNPFNSNHCRTFARDA
FT                   AKAGQ"
FT   gene            complement(338605..340989)
FT                   /locus_tag="Daci_0300"
FT   CDS_pept        complement(338605..340989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0300"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; PFAM: Rhs element Vgr protein; Gp5 domain protein;
FT                   KEGG: aav:Aave_2735 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32946"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQZ1"
FT                   /protein_id="ABX32946.1"
FT                   /translation="MTRRVTIHTPLGEQLHFRELRGQENISQLFSLDVEMLSESESIDP
FT                   KALLGKNATIEIETQGGGRRFIDGIVTRFGMQGQDHRHYAYKARLSPWLWLATRKSDFR
FT                   IFQNQTVPDIIEQVLGVYGHPLQRKLTRAYRSWDYCVQYNESDCDFVSRLMEHEGIYYH
FT                   FAHAMGEHTLVLCDDIIASHSVLPGGASIPFYPPEKAAAGDQENIHAWQLEQEIKSGRH
FT                   YSDDYDFKKPRADLTHLRRDPPGHAHDGHEIYEWPGGYTQLSDGEDYIRVRLKESLTGQ
FT                   SRVRGQSCHRALATGYTFSLYNYPRGDQNQQYLITGLSYHLKENPRVSAVAPGAKGSAA
FT                   EDGSFQRYELQAQPTSLAYTPARTTPKPRTTGPQTAVVVGPAGEEIWTDEYGRIKVQFH
FT                   WDRLGAMNENSSCWIRVATNWAGPGFGAISIPRIGHEVVVDFLNGDPDYPLVTGCVYNA
FT                   ANMPPWALPANATQSGIKTRSSKGGAPGAGMKNGQGDANAIRFEDKAGAEQLWLHAQKD
FT                   QLTEVENDEDKWVGNDRRKTIDRDETSVIHRDRTETVDRNETITVHNNRTERVDHDEKI
FT                   SIGDNRNEDVGIDENISIGKNRSKTIGKTETDKIGQNWHVTVGLLKTQTIGMAYMQNVG
FT                   VMKMMNIGVNYMENIGVAMQTTVGMSQNLTVGQERQVKVGSKQSTEVGSQYSLTVGGGG
FT                   GAGGGGGAGGGMAMNITSPGGGGGGGGGGGGGGGGGSGGGGGGGGGKASQLTMDGQSIE
FT                   LNAAKIRLEAQQEILLTCGESTIRITPGDIQILSPTDRLNC"
FT   gene            341464..342195
FT                   /locus_tag="Daci_0301"
FT   CDS_pept        341464..342195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32947"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQZ2"
FT                   /protein_id="ABX32947.1"
FT                   /translation="MSRASLKSLAIACVAIAPLWAHAQLTANVSLTTNYKFRGQDQDSG
FT                   RNKAVKPALQGGFDYTFGDSGWYIGNWNSSVDWLPRNSLETDFYGGYKFKAGEVDLDFG
FT                   ALQYLYSGNSAGNTTELYGAATYGPFTAKYSHTVSKDYFNWAGEKAGSGLSGRNTGYLW
FT                   LGFTQEVMPKVTVKASLGFTRFASDIKGLGVPNYMDYSVGGAYDFGDGVSLGAAVTGAN
FT                   KKSYFGDVNKARLIVTLTKTL"
FT   gene            342219..342557
FT                   /locus_tag="Daci_0302"
FT   CDS_pept        342219..342557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0302"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   pna:Pnap_0120 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32948"
FT                   /db_xref="GOA:A9BQZ3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQZ3"
FT                   /protein_id="ABX32948.1"
FT                   /translation="MKLVTAIIKPFKLDEVREALSDIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKLRLEAAVPDALVDQVIDAIEAAARTGKIGDGKIFVLPIEQAVRIRT
FT                   GETGDSAL"
FT   gene            342589..343962
FT                   /locus_tag="Daci_0303"
FT   CDS_pept        342589..343962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0303"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: ajs:Ajs_0164 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32949"
FT                   /db_xref="GOA:A9BQZ4"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQZ4"
FT                   /protein_id="ABX32949.1"
FT                   /translation="MTKRLLSMGLGLGLLAAGAAALAQEPAAAAAVADAAAAAAPAAAA
FT                   AAEAPAPALSAGDTAWMLTSTMLVILMVIPGLALFYGGLVRTKNMLSVLCQVFVIFSLI
FT                   TLLWAVYGYSLAFAGEGNFFGGFGKIFLKGIAPDTLSGALPTIPEYVFVAFQSTFAAIT
FT                   VALIVGAFAERIKFSAVILFSVLWFTFSYIPMAHMVWGGGLLGKDGALDFAGGTVVHIN
FT                   AGIAGLVGSYMLGKRIGFGREALPPHSLTLTMVGASLLWVGWFGFNAGSAGAANGIAGL
FT                   AFINTIVATGAATISWLAAEALHKGKASMLGAASGAVGGLVVITPAAGLVGPMGAIVMG
FT                   LIAGPVCLWGVSGLKKLLKVDDVCDVFGVHGVGGILGAILTGVFCASSLGGIEPADFNM
FT                   GHQVWVQVKSVLLTIVWSGVVAGISYKICDLVVGLRVSEESERQGLDITTHGEVAYYR"
FT   gene            344041..345309
FT                   /locus_tag="Daci_0304"
FT   CDS_pept        344041..345309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0304"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   vei:Veis_3312 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32950"
FT                   /db_xref="GOA:A9BQZ5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQZ5"
FT                   /protein_id="ABX32950.1"
FT                   /translation="MASLPFRPGCFAPPAELQARRSKNSRVRTEAQKGPAATMQAMDSA
FT                   QSHLLQIAQRVRAAAADATPLRIRGGGTKDFHGLALQGELLDTRALAGVVSYEPSELVV
FT                   TVRAGTPLAEVEALLAAQGQCLAFEPPHFDGDSRNATVGGMVASGLSGPARASVGAVRD
FT                   FVLGLEMINGQGELLRYGGQVMKNVAGYDVSRLMAGSWGALGLITEVSLKVLPVAPAEA
FT                   TLRFECTQQQALDWLNAWGGQPLPLNASCWLQEDGAAQGVLYLRLRGARAAVQAACERL
FT                   GGERVQRMDPAHAAADWQACREQQLPWFTARAPGHALWRLSVPQTAPALALPDGCTGPL
FT                   IEWHGALRWVQAPRALGHALRALAKAAGGSATLFRSEAADQPGAEPDFDAQAADATAAL
FT                   HARLKQAFDPAGIFNRGRLAAAW"
FT   gene            345335..346117
FT                   /locus_tag="Daci_0305"
FT   CDS_pept        345335..346117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0305"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   ajs:Ajs_0167 protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32951"
FT                   /db_xref="GOA:A9BQZ6"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQZ6"
FT                   /protein_id="ABX32951.1"
FT                   /translation="MRMRHHLHLLTDRHRTVASNRTLGLLLAFNAGAVNAGGFLLVHSY
FT                   TSHMTGFVSLLADNLVLGNTALVLSACGALLAFLCGAAATSLLVNWARHHRLRSSYALP
FT                   LLLEAALMLLFGVLGAAMLAWPTPFAVPLAVLLLSFIMGLQNATVTKMSSSQIRTTHMT
FT                   GVITDLGMELGRALYWNRHGSPPEHRVHANHVRLRLFAGLLSMFLLGGIAGALGFRHLG
FT                   FVFVVPLAVVLCLLSLPPLWADRARLPLLLGRRAAPRA"
FT   gene            346179..347429
FT                   /locus_tag="Daci_0306"
FT   CDS_pept        346179..347429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0306"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224 cysteine-rich
FT                   region domain protein; KEGG: ajs:Ajs_0168 protein of
FT                   unknown function DUF224, cysteine-rich region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32952"
FT                   /db_xref="GOA:A9BQZ7"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQZ7"
FT                   /protein_id="ABX32952.1"
FT                   /translation="MQTQLAPQYRATPEGQEAEAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQVLEGEKPTRATQQHLDRCLTCRNCESTCPSGVQYGHLVDIGRKIVEE
FT                   QVPRPFGERARRWALKEGLNSPLFAPALKLGQAVRGLLPEVLAEKVPQPQDAGAWPVRE
FT                   HARKVLLLAGCVQPAMMPRINFATARVLDAAGIQTVIAPKAGCCGAVKFHLNDQEGGKA
FT                   QMRANIDAWWPQVDSGAVEAIVMNASGCGVTVKEYGHLLKDDAQYADKAARISALTRDL
FT                   SELLPELLPELAERLQGRVRAPAAPMAYHPPCTLQHGQKLRGGVETHLARLGFELRVAR
FT                   TESHLCCGSAGTYSVLQPELSHQLRDRKIGALTEGFDARRPAAILSANMGCIVHLQNGT
FT                   DLPVRHWIEVLDEALLA"
FT   gene            347514..348380
FT                   /locus_tag="Daci_0307"
FT   CDS_pept        347514..348380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0307"
FT                   /product="ProQ activator of osmoprotectant transporter
FT                   ProP"
FT                   /note="PFAM: ProQ activator of osmoprotectant transporter
FT                   ProP; KEGG: ajs:Ajs_0169 ProQ activator of osmoprotectant
FT                   transporter ProP"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32953"
FT                   /db_xref="GOA:A9BQZ8"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQZ8"
FT                   /protein_id="ABX32953.1"
FT                   /translation="MMRGFVFSKPTCSAMTESVSEPQEQSAALPADAAAGTEPQAAASA
FT                   DGQGRKRSRRGGRGRNKGKATEPAADAASGTAASAEANASRPVRTQHPLLAQLAQWHPN
FT                   LFGEQPLPLKRGIFEDLLAAHPEAIDRDQLKLALSQHTRSSRYLTVVASGQARHDLQGQ
FT                   SVEAMAPEHVHHALIEVFRRRQHRSPEDLAPKLRNRIIAAYEASGLSRDDYAARVQGRD
FT                   EATNALVAEALAEADARTARDEALLRAFEASGQTSEAGFADMYGMNPRQVAQQLERARR
FT                   RLQTQAA"
FT   gene            348610..349188
FT                   /locus_tag="Daci_0308"
FT   CDS_pept        348610..349188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0308"
FT                   /product="AmiS/UreI transporter"
FT                   /note="PFAM: AmiS/UreI transporter; KEGG: har:HEAR1450
FT                   putative transporter protein AmiS"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32954"
FT                   /db_xref="GOA:A9BQZ9"
FT                   /db_xref="InterPro:IPR003211"
FT                   /db_xref="InterPro:IPR038523"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQZ9"
FT                   /protein_id="ABX32954.1"
FT                   /translation="MNTARKALQKQKAKSKRRLAMWLGLSLFYVGAVLCLNGLWMLGRI
FT                   ADREIWVINVFAGLVSLIIGLASAFGPEPDAASVKTGALTLLFAFTYLWVAINRFTGAD
FT                   GRGLGWFSLFVAITAVPVAIDTLLGARTAIDWWMAANWAAWAVLWAMFFVLLALGRNIG
FT                   RVTGALCIAQGVLTGWLPGYLLLAGQLTG"
FT   gene            complement(349216..350115)
FT                   /locus_tag="Daci_0309"
FT   CDS_pept        complement(349216..350115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0309"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ajs:Ajs_0174 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32955"
FT                   /db_xref="GOA:A9BR00"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR00"
FT                   /protein_id="ABX32955.1"
FT                   /translation="MHSPLPVLALLFNTLVWGLAWWPFRAMHEAGLHPLWATALMYALV
FT                   LAGLVALRPASLRQALQYPVLILLGACAGSNNIAFNWAVTIGDVVRVVLLFYLMPAWSV
FT                   LLAWKILGERPTPAALTRLLLAFGGVALVLVPEGTFSGGSPGLLRGLSLADGLALFGGF
FT                   TFALTNVLLRRLQAVPAQARMLAMFSGCMAMGLASAFAGSSVGLVPPMPAPQAGWMLIA
FT                   AGLAVLLMLGNWALQFGAARLPAGVTAVVMLAEVVFASASSVLIAGEVLTPRTLLGGAC
FT                   IIAAALLSALAHARRRGA"
FT   gene            complement(350314..351615)
FT                   /locus_tag="Daci_0310"
FT   CDS_pept        complement(350314..351615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0310"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ajs:Ajs_0175 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32956"
FT                   /db_xref="GOA:A9BR01"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR01"
FT                   /protein_id="ABX32956.1"
FT                   /translation="MKRGFYTIMSAQFFSSLADNALFVTAVELLRTNGAPEWQRAALVP
FT                   MFALFYVILAPFVGAFADALPKGRVMFISNAIKIVGCLMMLFGNHPLIAYAVVGLGAAA
FT                   YSPAKYGILTELLPASQLVKANGWIEGLTITSIILGVLVGGQLLSPGISAHLLDFDLPL
FT                   LDTGVDTAAEAAIAVLVGVYALAAWFNLRIPLTDTILRPLRQDPSKSLLANTLALLPDF
FT                   WTCSQRLWGDKLGQISLSTTTLFWGVSGNLRYIVLAWGAAALGYGTSQASALVGVVAIG
FT                   TAAGAILASMRMRLDNATRVIPLGITMGLLVIAMIFIKSVWVAIPFLILLGGLGGFLVV
FT                   PMNALLQHRGHNLMGAGRSIAVQNFNEQACILALGAFYALSTKFGLSAFGAITVFGLVV
FT                   AGIMWLIGRWHVSNVRNYPEEVERLLVIARKDCH"
FT   gene            351750..352853
FT                   /locus_tag="Daci_0311"
FT   CDS_pept        351750..352853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0311"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: ajs:Ajs_0176 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32957"
FT                   /db_xref="GOA:A9BR02"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BR02"
FT                   /protein_id="ABX32957.1"
FT                   /translation="MPRPILATIHSAALRHNLERVRQAVPDAKLWAVVKANAYGHGIEN
FT                   VFEALRGADGFAMLDLAEAERVRQLGWRGPILLLEGVFEPRDLELCSRLSIWHAVHCDA
FT                   QIDWLAAHKTQNGHRVFLKMNSGMNRLGFTPERYRAAWARLNALPQVEEISFMTHFSDA
FT                   DAGAGQPGISAQLQRFHDATRDLPGERSVGNSAATLRQGDDALVRCDWVRPGIVLYGSS
FT                   PDYPQHTAAHWDLQPTQTLSSRIIGVQQLTEGQSVGYGSRFTAEGPLRLGTVACGYADG
FT                   YPRHCGTGTPVLVNGVRTRTLGCVSMDMLAVDLTPVPDAGMGSEVTLWGRASNGAVLPI
FT                   DEVAEAAGTLGYELMCAVAPRVNKTID"
FT   gene            complement(352854..353294)
FT                   /locus_tag="Daci_0312"
FT   CDS_pept        complement(352854..353294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0312"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: sit:TM1040_1546
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32958"
FT                   /db_xref="GOA:A9BR03"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR03"
FT                   /protein_id="ABX32958.1"
FT                   /translation="MNASLPADIFEAMHELLHLFRSRMREDMESMEPGLTPNEVRVLMY
FT                   VGRHPGRTQRDLVDHSHMDKAQLARMLAQLQEQGWLDREPDARDRRVRCLSLSPQGQAL
FT                   FDRLRQSRQALAARLLKDWEPAAQQQLMALLERARDSVEAAP"
FT   gene            353391..354203
FT                   /locus_tag="Daci_0313"
FT   CDS_pept        353391..354203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0313"
FT                   /product="FAD-binding 9 siderophore-interacting domain
FT                   protein"
FT                   /note="PFAM: Siderophore-interacting protein; FAD-binding 9
FT                   siderophore-interacting domain protein; KEGG: reh:H16_B1184
FT                   siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32959"
FT                   /db_xref="GOA:A9BR04"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR04"
FT                   /protein_id="ABX32959.1"
FT                   /translation="MNLPNPATSAVTPAPVVQRVRHSFRARHVQLLSREQPSPGFVRLT
FT                   LGGPDLEDFVSAGFDDHVKLILPQAGRELPALPVLLDGRPTFVEDERPTLRDYTPLRYD
FT                   AARQNLIMDFALHDAGPATEWALTAPLGQWVGLAGPRGSLVISANLPWHWLFGDETAMP
FT                   AIERRLAELPAGSRAVVRVQLRNPADRRQWSSTARLDCDWVESLADAVQALELPQDDGY
FT                   IWAAGEHSAMAELRRLLLAKGASPKRMRVASYWKQGTADHHEDLNDPS"
FT   gene            complement(354272..354348)
FT                   /locus_tag="Daci_R0001"
FT                   /note="tRNA-Met4"
FT   tRNA            complement(354272..354348)
FT                   /locus_tag="Daci_R0001"
FT                   /product="tRNA-Met"
FT   gene            354447..355877
FT                   /locus_tag="Daci_0314"
FT   CDS_pept        354447..355877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0314"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: aav:Aave_0262 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32960"
FT                   /db_xref="GOA:A9BR05"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR05"
FT                   /protein_id="ABX32960.1"
FT                   /translation="MRARAAATARYSAHPMAKDKTTFICNACGGTSPRWLGKCPACGAW
FT                   NSLIEAVAEPASAGKNRLSQPQGYAGLANVQAVMPLSAIEAQDVARTPSGIEELDRVLG
FT                   GGIVEGGVVLIGGDPGIGKSTLLLQAMDALHRVGLPTLYVTGEESGAQVALRSRRLGLE
FT                   ASQVNVLAEIQLEKILATMEATQPAVVVIDSIQTVYSDQLSSAPGSVAQVRECAAHLTR
FT                   AAKTTGITVILVGHVTKEGALAGPRVLEHMVDTVLYFEGDTHSNFRLVRAIKNRFGAVN
FT                   EIGVFAMTEKGLKGVTNPSAIFLSQHSEPVPGSCVLVTLEGTRPMLVEIQALVDQGGPA
FT                   PRRLSVGLDRDRLAMLLAVLSRHAGVACADQDVFVNAVGGVRISEPAADLAVMLSITSS
FT                   LRGRALPKGFLAFGEVGLAGEVRPAPRGQERLKEAAKLGFTMAVVPKANAPKKAIAGLT
FT                   VHAVERVDEAMNIVRGMG"
FT   gene            355957..356394
FT                   /locus_tag="Daci_0315"
FT   CDS_pept        355957..356394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_0263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32961"
FT                   /db_xref="GOA:A9BR06"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR06"
FT                   /protein_id="ABX32961.1"
FT                   /translation="MNLRNILIPLGLLVLLVAAHQSYGWMGVVAVGGGIMMWLLLHFTR
FT                   LMSIMRKAADRPMGYVGSAVMLNVKLKPKVSLMHVVAMTRSLGERLSEEGQQPEIYRWT
FT                   DGTQSHVTCEFKSGRLMKWTLVRPTPEPEPASAAPEAAPAP"
FT   gene            356439..357377
FT                   /locus_tag="Daci_0316"
FT   CDS_pept        356439..357377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0316"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: ajs:Ajs_0182
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32962"
FT                   /db_xref="GOA:A9BR07"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR07"
FT                   /protein_id="ABX32962.1"
FT                   /translation="MSPVVPSMADRDGKIWMDGQLVDWRDAKIHVLTHTLHYGCGAFEG
FT                   VRAYKSEQGTAIFRLEDHTKRLFNSAKILRMQIPFTQEVVNQAQVEVVRANQLESCYLR
FT                   PLTWIGDRKLGVSPKGNTIHLMVAAWAWGAYLGEEGMQRGIRVKISSFTRHHVNITMSQ
FT                   AKAVSNYTNSILANTEALDDGYDEAILLDASGFVSEGSGENIFVIKDGVVYTPDLSAGA
FT                   LNGITRNTVMHICKDLGLEVVQKRITRDELYIADEVFFTGTAAEVTPIREVDRIEIGAG
FT                   SRGPLTEKIQQAFFDIVNGRNPKYAHWLTRV"
FT   gene            357413..357622
FT                   /locus_tag="Daci_0317"
FT   CDS_pept        357413..357622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32963"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR08"
FT                   /protein_id="ABX32963.1"
FT                   /translation="MTTNATVELAAKDLNAQGGVFCPSPKADMKLWNSHPKVYLDVAHT
FT                   GEAKCPYCGTLYRLKAGEVFAGGH"
FT   gene            complement(357654..358598)
FT                   /locus_tag="Daci_0318"
FT   CDS_pept        complement(357654..358598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32964"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR09"
FT                   /protein_id="ABX32964.1"
FT                   /translation="MKKIPAVLFRLLHRWAAPSKIGADYTMPAPLQLPPSPPAADGLAA
FT                   EIPKTIWTYWNQSGLDPFVQQCVDSWRRQCPDHQVIVVTPENLGQYVACGDLPAAFAEL
FT                   HPTKQSDWLRLYLVAHHGGYWFDATTLLTAPLDWMSASPGAGAAELAGFYLEGFTRDRR
FT                   YPVIESWSFCAPAGSRFVSEWQKEFHQALIVDGPEAYLQRLQSRHDAAEVLQGIPDPNY
FT                   LLIHVTAQQVMRRLPDARLTLFKAEDTAFFYHSALRWKWYLLYPQLCLAKAPQVAAPIV
FT                   KLRGGERRHFTDMLALHGGAAPGSIWSRALSAR"
FT   gene            358652..359920
FT                   /locus_tag="Daci_0319"
FT   CDS_pept        358652..359920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0319"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: aav:Aave_0267
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32965"
FT                   /db_xref="GOA:A9BR10"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR10"
FT                   /protein_id="ABX32965.1"
FT                   /translation="MRFDKSKLPGLLTTLAAILVPGLALWLRSGYSYGAGLMVLGALCF
FT                   LPRWVRYRQSNGTWLLVALFLGMAVMWYFLSVLDGGTGQFDRPVKFILGAVSLLFAMCY
FT                   PPTARIFLWGIPLGSAGAGFMALWQVCVLGMERATGYTNAIQWGNMALLLGCFSCIYAV
FT                   SFWHQRSLLWRLLVLAAAALGALASLLSGSRGGWLALLPMFFMLMVLVRMYRPQYFGRL
FT                   LLGCAAIVVALATVMAFIPRVSERVDEVYLDVSTYLYAGNSNTSLGTRLEQYRLAVQMI
FT                   GEKPLLGWGMQGYVDEMHRRVAAGSYGQSIREYNFIHNDFLDIWVKLGVPGVLLQAALF
FT                   ISLLWLFWPSRRRMALWPADSTPWREALLLRILGSLMPAMYLAFGMSQQFFVHNSGIVF
FT                   FVFLVVALWTSLHGLERASGAVR"
FT   gene            359917..361038
FT                   /locus_tag="Daci_0320"
FT   CDS_pept        359917..361038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0320"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ajs:Ajs_0185 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32966"
FT                   /db_xref="GOA:A9BR11"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR11"
FT                   /protein_id="ABX32966.1"
FT                   /translation="MTERATTARPRVLHFVTGGFSGATQVAVDLVSAHRASGRFDARLV
FT                   LRRKRNTSDERVQKLRDGGIDVDVVAGWSHAATVWQLRRICLDFRPDIVVAHGFSDHLW
FT                   GRFAALWAGVPCLVHVEHNSRERYTRWRLAQALWLTERTAAIVGCSEGVRQSLQDRGFP
FT                   AAKLLAISNGIRPEPYLQEPPPLLQRRPDIVMAARFARQKDHATLLRALVVLRQRGLTP
FT                   TLTLAGGGKARAQQAAQRLSAELGLQDQVQFIGMCNDVPGLLRAHRVCVLSTHYEGMPL
FT                   SLLEGMAAGCVVVGSRVVGVQEVVRPGDNGLLAAHADPESLADALQQALQDDEAALRMA
FT                   ATARQEALSHYSLQRMTGQYEDLFARLLQGERP"
FT   gene            361035..362063
FT                   /locus_tag="Daci_0321"
FT   CDS_pept        361035..362063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0321"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ajs:Ajs_0186 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32967"
FT                   /db_xref="GOA:A9BR12"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR12"
FT                   /protein_id="ABX32967.1"
FT                   /translation="MTWLSILVPVYNVLPYLEECLQSVMDQADAGVQVLVLDDCSTDGS
FT                   WALMQQLDQRWPGRLQLMQHERNAGLSAARNTMIEAATGDYLWFLDSDDKLLPGAIAGL
FT                   SAIVKQHAPDAVLCDFSVWREAPRLKHRLRGEAHRHSFQGPTLQRSQDRGALLAGLLRT
FT                   GQLHAWSKISRRSLWDAGLRFPAGRYFEDMMTMPQMALRCSSFYYHPQPWVAYRQRANS
FT                   ILASMTPAKAADQSAALWPLAQAVQALQDDALRNDGRLHFAWAHQAARNLIGALRFLDR
FT                   QRDMPPAQRQVLAQQFLADFGRISPLSLPALRQAYVRRGWVLRAWKLRRWEQWARQQGA
FT                   HA"
FT   gene            362060..363013
FT                   /locus_tag="Daci_0322"
FT   CDS_pept        362060..363013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0322"
FT                   /product="mannosyltransferase OCH1-related enzyme"
FT                   /note="KEGG: aav:Aave_0270 mannosyltransferase OCH1-related
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32968"
FT                   /db_xref="GOA:A9BR13"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR13"
FT                   /protein_id="ABX32968.1"
FT                   /translation="MSGLKLKTRGELWLAAGMRRFYATFARRLEQGPAPDFRSHDIGPA
FT                   APVPVSTPIPRIIWAYWNGDSVPLLIQRCFDNWARLNPGYSLRILNDAQLPQYVPQLPG
FT                   NLQQLPVAKRSDWLRLELLHRHGGIWLDASTILTEPLDWLLEQQQRSGADLVAYYLERY
FT                   TRDPQVPVVENWLMAAPPGSAFIAALHKEYVEQVLPQTGEAYIAQLQQAGEYEQLRQGI
FT                   DMPAYLSMHLAMQRVLRAGGSYRLRLAKAEDGPFFLHVQGNWGRTPLKIRLMFSRTEKA
FT                   PVPLIKLRAPDRKKLDLYLERGLYVPGSIADRYLRG"
FT   gene            complement(363036..363455)
FT                   /locus_tag="Daci_0323"
FT   CDS_pept        complement(363036..363455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN3249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32969"
FT                   /db_xref="InterPro:IPR016918"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR14"
FT                   /protein_id="ABX32969.1"
FT                   /translation="MQDNKPIDRDIDIGIAERSIHQVHELIHTVFTQPAGAQAALQALM
FT                   PQFSPEFSMVTTTGRLVGLDDVEQMFRRAAGQRPGLEICVCDMQPVWRDTAGLAMRYLE
FT                   THRLDGVETSRRSVVILKRAGQGVLWHYLHETALG"
FT   gene            complement(363427..364815)
FT                   /locus_tag="Daci_0324"
FT   CDS_pept        complement(363427..364815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0324"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pen:PSEEN3248 transporter, MFS family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32970"
FT                   /db_xref="GOA:A9BR15"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR15"
FT                   /protein_id="ABX32970.1"
FT                   /translation="MTYRYRLATVFLMGFFVDCINIFMPAVALPTIAAEFHVGISAGAW
FT                   VANAYMLGLTLAIPLAPWLADRWGARGLMAGSMLAFALAAWACGEAGSFGQLVGWRFIQ
FT                   GMAGGLVIPVGQALAFNRFQGPERARVSTLVMAVALIAPALSPWLGGLIVDHGSWRWVF
FT                   HSNIALALAAAGLAWLWVRDAPATARQRPDLKGLVLVSAALAAWLLGMSLYGAGQGSGQ
FT                   GLALAWLGMAAGLAFTVLYALHARKTAHPIVELQLLKSPRLRMSVAVYHAIPGVFTGVN
FT                   LLNIFYLQDMLHLSAQATGRFMMVYAGGALVSMLVGGRLYNRAGARPLFIASMVLHSLG
FT                   IAALAAVAAPADPWLLAAAYGLMGLGGGLGANTAQTTALLDFDGRQTQQASVIWNLNRQ
FT                   MAFSVGAAFFLMVFNMLATRLDAGRAYHITFLIASLAGLVPLLQLRSLHTLKDHHARQQ
FT                   AHRP"
FT   gene            364905..365816
FT                   /locus_tag="Daci_0325"
FT   CDS_pept        364905..365816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0325"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN3247 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32971"
FT                   /db_xref="GOA:A9BR16"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR16"
FT                   /protein_id="ABX32971.1"
FT                   /translation="MTPTSTAMHTLLHRAQTFLAVVDFGSYTRAADFLGISKAMASLHV
FT                   KSLEEALSVALLVRNTRSIALTETGREFYDEFKGIVRDVGSAFDNAMHSGNRIAGRLRI
FT                   STTSEYGEKYILPLIPAFLERYPGISVAYDVNSSLSDLVAEKLDLVVRLGHLADSSFKS
FT                   RRLAGYDIVLVASAAFLRSHPVRQPEDLADLPWIANSNLAHPTAWTLRTAGGQGVDVVG
FT                   RAAHQSNSSTAIRALARSSLGVAVLPAWFVEDDLAGGVLQRVLPDHALPPQPISVVFPD
FT                   SSHLPRKTRVFIDFLCEHLGRD"
FT   gene            366191..366628
FT                   /locus_tag="Daci_0326"
FT   CDS_pept        366191..366628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32972"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR17"
FT                   /protein_id="ABX32972.1"
FT                   /translation="MTSRKNTAGAAVQAQPLPKRSQAARPSDWPSAWQAMHVCLVVIEG
FT                   RLVTLAEVCGKKPDRKARQFDVECAVELALAHIRRMRADPPDSHQAFEQQWHLASCAIE
FT                   LADGAYRFPRSRYGRLLKRTRWHFDLLRDLVERVEWQHRRG"
FT   gene            complement(366644..367870)
FT                   /locus_tag="Daci_0327"
FT   CDS_pept        complement(366644..367870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0327"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ajs:Ajs_0193 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32973"
FT                   /db_xref="GOA:A9BR18"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR18"
FT                   /protein_id="ABX32973.1"
FT                   /translation="MKLLSLFSQRLYLRIWLAVVGGVAVLTLTVAWAWQIAAEQNAQNV
FT                   QSASSPPSRDVAMRDGQGNVIAQGRARRLPGSPEEGLRFEIEGTDGQTYMLHMAPRPPR
FT                   GDRPPHDGAAAFWLRPPFGFLWLLGLVGVAVAVGVFPIIRRLLKRLENLQRGVKRFGEG
FT                   DLSVRVPEHGSDEVADLAHQFNAAAARIETLVTSHKSLLANASHELRSPLTRIRMGLEF
FT                   MGDDPASARARAEIQRNISELDQLVDEILLASRLETYEGDVGTIEPVDLIGLAAEECAR
FT                   VDADLDLQSTDALEVPGISKLLRRAVRNLLENARRYSQGAITLELARQDAMAEIRVCDH
FT                   GPGVAPAHRERIFEKFFRLPGASERSGGVGLGLALVRSIAQRHGGSVHCEGRADGQPGA
FT                   CFVLRLPLA"
FT   gene            complement(367878..368636)
FT                   /locus_tag="Daci_0328"
FT   CDS_pept        complement(367878..368636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0328"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: ajs:Ajs_0194 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32974"
FT                   /db_xref="GOA:A9BR19"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR19"
FT                   /protein_id="ABX32974.1"
FT                   /translation="MNTLPSMSTHHLLMIEDDTRLAQMVGDYLGNNGLQVTHMGDARSG
FT                   LEQLQPADGVPGADLPDLVILDLMLPDMDGLEVCRRIRALPGPAAQVPVLMLTAKGDPM
FT                   DRIIGLEIGADDYLPKPFEPRELLARIRAILRRRGGGEGTANAQVTTALRFGSLEIDRD
FT                   ARSVTVAGQPCELTSYQFDLLVTLAERAGRVLTRDQIMEAVRGRELEAFDRSIDVHMGR
FT                   IRAAIEADPKAPKRILTVRGVGYVFAKQQD"
FT   gene            complement(368741..370177)
FT                   /locus_tag="Daci_0329"
FT   CDS_pept        complement(368741..370177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0329"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   aav:Aave_0276 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32975"
FT                   /db_xref="GOA:A9BR20"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR20"
FT                   /protein_id="ABX32975.1"
FT                   /translation="MVARASPRHHGPDNGRSLPQPNMTEPSTTTSSAPSTPTEAPRRSW
FT                   AQTLRVYAEPASLRMLALGFSAGLPLLLVLGTLSFWLREAGVDRTTIGYLSWVGLAYAF
FT                   KWVWSPLVDRMPLPLLTRWLGRRRGWLLFAQMLIVAGLCGMAFNDPRVSLTPLVWCALA
FT                   VAFGSATQDIALDAYRIESADTDRQAALAATYQTGYRLAMIWAGAGVLWLAARAEVAGT
FT                   AGYQSGAWQVAYLAMAASMAVGMLTVLLSPEPVPRPLAPARNAAEWLRGALVEPFADFL
FT                   GRYRWQALLVLGLIAIYRISDVVMGIMANPFYVDMGFTKDEVAAVTKVYGVIMTLAGAF
FT                   LGGALAMRWGVMRVLMLGAALSAATNLLFAWLATRGHDVNALVWVVSADNLAGGIASAA
FT                   FIAYLSGLTNVQYSATQYALFSSMMLLAPKWLAGFSGAFVDAHGYVSFFQATALLGLPV
FT                   LVLIALASRVHAVRPAQRGS"
FT   gene            370198..370926
FT                   /locus_tag="Daci_0330"
FT   CDS_pept        370198..370926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0330"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: ajs:Ajs_0200 cupin 2, conserved barrel
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32976"
FT                   /db_xref="GOA:A9BR21"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR21"
FT                   /protein_id="ABX32976.1"
FT                   /translation="MAYTLSSLHSDAAAQDGAADATDTAFAPHSSVRSYSGEHQAHAHG
FT                   HAQILYALQGRMELEVGGRSAFVDAVSGMLIPAGVDHGYLAAPRSRVFVIDAPSGPGLD
FT                   RMRRFSVPPALRGRESEGPATEQLAQVLQAPGLLARRGLDLQGLAAQVQAALHEDWPTA
FT                   RLAALCHMSAQRFHARFVELAGQPPQAWLRGLRLDAAERGLARGLPLEATALRCGYASA
FT                   SALAYALRRDRGVTARQLRG"
FT   gene            370999..371970
FT                   /locus_tag="Daci_0331"
FT   CDS_pept        370999..371970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0331"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ajs:Ajs_0201 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32977"
FT                   /db_xref="GOA:A9BR22"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR22"
FT                   /protein_id="ABX32977.1"
FT                   /translation="MARNSSASSSAVGIAFVSVAAVLWGTTGTAQSLGAGGLSPFWVGA
FT                   AQLAVSSLFLGALLAVSHWRLRGRAGQGVAPVQPLLPNPVHLGLRPVWFVLASMGIGGY
FT                   SVFFYEGVTLTGVAVGTAVAIGSGPIWAGLMQALVLRAPLSALWWAGTLVSVAGGAAMV
FT                   MARGGATLSWSGLALCLLAGLSYAGYALINKRLVTHMSPRVVNFYVFTGAACMAVPIAL
FT                   VQSGLPQWSLAAVLVVVYLGVVVSGLAHMLFSIGLRSISGPTGVTLSLIEPVAAFVLAV
FT                   WVVGERQPLQSWLGLLAVLAGLMLVIGAEMRSQRAVMAAQMA"
FT   gene            372016..372933
FT                   /locus_tag="Daci_0332"
FT   CDS_pept        372016..372933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0332"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: aav:Aave_0280
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32978"
FT                   /db_xref="GOA:A9BR23"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR23"
FT                   /protein_id="ABX32978.1"
FT                   /translation="MFQACMAAILGGMQQPSHLSSEPCAPSAWGCACAPWRARRGFLLA
FT                   GSAAAMGLATAPVAAQVQVGGASGLRKLVPAETLEGAATDQYQQLLAKARAQGALAGDS
FT                   NPQLQRLRAIARRLIPYTAQWNPRANAWRWEVNLIGSKEINAFCMPGGKIAFYTGIIDQ
FT                   LQLTDDEIAMIMGHEMAHALREHSREQLAKNQATSIGISLGAQLLGLGDLGNAAARLGG
FT                   QLLSLKFSRGDESEADLVGLELAARAGYNPQASVSLWRKMGQATGDRGGLEFLSTHPAG
FT                   PERIRELERNIPRVEGLYEAARRG"
FT   gene            complement(372944..374401)
FT                   /locus_tag="Daci_0333"
FT   CDS_pept        complement(372944..374401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0333"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: pla:Plav_1859
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32979"
FT                   /db_xref="GOA:A9BR24"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR24"
FT                   /protein_id="ABX32979.1"
FT                   /translation="MSTQEHLQFYIDGQWVPPAVPRTLDVINPSTEEVAARISMGSAAD
FT                   VDAAVAAARRAFDGFSQTTRDERLALLDKVLAVYMRRIDEVAQTISLEMGAPLWLSRAA
FT                   QATVGAGHLKQTLQVLRDFEFESVRGTTGIVHEPVGVVGMITPWNWPINQIMCKVAPAL
FT                   AAGCTMVLKPSEIAPLNAILVAEILHEAGVPAGVFNLVNGDGPSVGEAMSVHPGIDMMT
FT                   FTGSTRAGIAVAKASADTVKRVTQELGGKSANIVLDDADIEKAVAQGVNACFTNSGQSC
FT                   NAPTRMFVPRAMHARAVAAAKAAAEGVKVGDALADTGAMHMGPVVSEAQFRKIQGLIEA
FT                   GIAEGATLVAGGTGRPEGLARGYFVRPTVFADVRNDMTIAREEIFGPVLVILPYDTEEE
FT                   AIAQANDTPYGLSGYVQSGSLERARRVASRLRTGMVHLNGAGPDFGAPFGGYKQSGTGR
FT                   EWGEHGFKEYLEVKAVMGYQPKQKAAA"
FT   gene            complement(374517..375155)
FT                   /locus_tag="Daci_0334"
FT   CDS_pept        complement(374517..375155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0334"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   aav:Aave_0282 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32980"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR25"
FT                   /protein_id="ABX32980.1"
FT                   /translation="MLQYHTIPVTAFQQNCSLVWCDQTMEAAVIDPGGDLEQIGWEIER
FT                   LGLALKAIWLTHAHIDHAGGTRELADAQQLPIIGPHPGDQFWIDALPQQGAMFGFPHSD
FT                   PFTPTRWLHDGDTVSIGQETLQVRHCPGHTPGHVVFHAPQIDRAFVGDVLFAGSIGRTD
FT                   FPQGNHQQLIDSIVQRLWPMGDQTVFIPGHGPESSFGRERKSNPYVGGT"
FT   gene            complement(375241..375471)
FT                   /locus_tag="Daci_0335"
FT   CDS_pept        complement(375241..375471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32981"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR26"
FT                   /protein_id="ABX32981.1"
FT                   /translation="MQRLFGNHSRGGHHGGGAYRAAAVAAVCPGCRASIATSSRFCPQC
FT                   GGAVLPQACRRCNASHPAGARFCGQCGQPTT"
FT   gene            375801..376916
FT                   /locus_tag="Daci_0336"
FT   CDS_pept        375801..376916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0336"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: alanine dehydrogenase/PNT domain protein;
FT                   KEGG: ajs:Ajs_3954 NAD(P)(+) transhydrogenase
FT                   (AB-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32982"
FT                   /db_xref="GOA:A9BR27"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR27"
FT                   /protein_id="ABX32982.1"
FT                   /translation="MLIGVPAETMAGETRVAATPETVKKLRAQGHVLRVQAGAGVAASV
FT                   PDALYEAAGAEIVDVAGALGADLVLKVRIPSEDELPGIRKGATLVGMLDPFQPAGLQRL
FT                   ADAGVTAYALEAAPRTTRAQSMDVLSSQANIAGYKAVMIAANQYQRFFPMLMTAAGTVK
FT                   AARVVVLGVGVAGLQAIATAKRLGAVIEASDVRPSVREQVESLGGKFIDVPYETAEEKE
FT                   AAEGVGGYARPMPQSWLDRQKAEVAKRVAQADVVITTALIPGRPAPVLVTAEMVQAMKP
FT                   GAVIVDLAAERGGNCPLTQAGMTVVTHGVTIVGLTNLPAMVAADASALYARNVLDFLKL
FT                   IINKDGALHVDMEDDIVAACLMAHEGQLRRK"
FT   gene            376918..377262
FT                   /locus_tag="Daci_0337"
FT   CDS_pept        376918..377262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0337"
FT                   /product="NAD(P) transhydrogenase, subunit alpha part 2"
FT                   /note="KEGG: ajs:Ajs_3952 NAD(P) transhydrogenase, subunit
FT                   alpha part 2"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32983"
FT                   /db_xref="GOA:A9BR28"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR28"
FT                   /protein_id="ABX32983.1"
FT                   /translation="MEAVSPTIIHLIIFVLAIYVGYHVVWTVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTETGLGKTMGVLAVALAAVNVFGGFLVTRRMLEMFRKKERKSAPAKD
FT                   GKDAKAEGQS"
FT   gene            377259..378683
FT                   /locus_tag="Daci_0338"
FT   CDS_pept        377259..378683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0338"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   mpt:Mpe_A3571 NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32984"
FT                   /db_xref="GOA:A9BR29"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR29"
FT                   /protein_id="ABX32984.1"
FT                   /translation="MSMNLVTLLYLVASVCFIQALKGLSHPTTSIRGNLFGMAGMVIAV
FT                   LTTAALIVQLAGGNALGLGWVLLGLLVGGTAGAVMAQRVEMTKMPELVAFMHSMIGLAA
FT                   VFIAVAAVAEPWAFAITAKGGAIPGGNRVELALGAFIGAVTFTGSVIAFGKLSGKYKFR
FT                   LFQGAPVQFKGQHALNAVLGLAAAFFVFGFWHSQSWMDIVLVIALGLLLGVLLIIPIGG
FT                   ADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFFSV
FT                   ILGGFGGEATSAAAGSQQQRNVKSGSADDAAFVLGNAETVVIVPGYGLAVARAQHAVKE
FT                   LADKLTERGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINSEFGQADVAII
FT                   LGANDVVNPAAHVKGSPIYGMPILEAYKAKTVIVNKRSMAAGYAGLDNELFYMDKTMMV
FT                   FGDAKKVVEDMGKALE"
FT   gene            complement(378736..379539)
FT                   /locus_tag="Daci_0339"
FT   CDS_pept        complement(378736..379539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0339"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: aav:Aave_0288 exodeoxyribonuclease III Xth;
FT                   TIGRFAM: exodeoxyribonuclease III; exodeoxyribonuclease III
FT                   Xth; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32985"
FT                   /db_xref="GOA:A9BR30"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR30"
FT                   /protein_id="ABX32985.1"
FT                   /translation="MFKLTSLNLNGIRSASTKGVEAWIEATAPDCICVQEIKAQAADMT
FT                   GRFELLAGLRGHFHYAEKKGYSGVGVYSRHEPSDVVVGFGSHEFDAEGRYVEARFDTPA
FT                   RKLSIISAYFPSGSSGELRQTAKFRFLAEMHEHLMRMKGEREFILCGDINIAHQQIDLK
FT                   NWRSNQKNSGFTPEEREWMTKLLHKTDPTGGLVDVYRLLQPDTTDACYTWWSNRGQAYA
FT                   NNVGWRLDYHLATPAIAALARTEHIYKDVKFSDHAPVTIGYDMKV"
FT   gene            379556..380251
FT                   /locus_tag="Daci_0340"
FT   CDS_pept        379556..380251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0340"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: aav:Aave_0289 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32986"
FT                   /db_xref="GOA:A9BR31"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR31"
FT                   /protein_id="ABX32986.1"
FT                   /translation="MSNLQADDTGRLAQEFVQFAVDAGVLRFGEFKTKAGRMSPYFFNA
FT                   GLFDDGGKMGRLAEFYAKAIAASGIEFDMIFGPAYKGIPLAATVAVELARMGLNKPFAY
FT                   NRKEAKDHGEGGTLVGAPLKGRVLIVDDVMSAGTAARESIAIIRAAGATPHAVAIALDR
FT                   QEMATENGQDVPHSAVQYVRNQLGMQVCTIAKLADLLLYLEIQGGSEGSGHHERVLAYR
FT                   QRYGVNDKE"
FT   gene            380259..380927
FT                   /locus_tag="Daci_0341"
FT   CDS_pept        380259..380927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32987"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR32"
FT                   /protein_id="ABX32987.1"
FT                   /translation="MNKALHARFLWCALAGATVGPACALDAGVPAGIYACTDAKGRRLT
FT                   ADRPIAECVDRDQRVLGSSGVELRRVGPTLTDNERAELDAQRRREQAEQRRVREERSRE
FT                   RALIARYPNQATHDAERAEALSQTDQVANLARQRIQELQAQRVKIDGEMEFYRKDPSKA
FT                   PASLRRQLDENRSSQEEQQRFIQQQEQEKSRINQRFDAELVPLRALWSAAAAAAAPTGR
FT                   "
FT   gene            381139..383745
FT                   /locus_tag="Daci_0342"
FT   CDS_pept        381139..383745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0342"
FT                   /product="membrane-bound PQQ-dependent dehydrogenase,
FT                   glucose/quinate/shikimate family"
FT                   /note="TIGRFAM: membrane-bound PQQ-dependent dehydrogenase,
FT                   glucose/quinate/shikimate family; PFAM: Pyrrolo-quinoline
FT                   quinone; KEGG: aav:Aave_0411 pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32988"
FT                   /db_xref="GOA:A9BR33"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR33"
FT                   /protein_id="ABX32988.1"
FT                   /translation="MTAWRWLTVLWLWAAGAWLAWGGAQLLWAGGSGYYVVAGVLLLAV
FT                   GLGVARRSAAALWLFALWLLGTALWAVWEIGLDWWPLAGRLGVPWLMGLLLVLPWSVRA
FT                   LRHEPDMGQNRGLAPAHAALALVVLGTAILAGLSFGRQRDAHETQGQFAGAAAAASDLP
FT                   ADGQVTAVQNMSMVASDAGGLRSPPVLQGDATDAVPEGEWHAYGRTGAGQRYSPLRQIG
FT                   PHNVRLLQLAWEFRTGDVRGKPGDPEETTFEVTPLKIGERLFLCTPHQSVIALDATTGK
FT                   QLWRRDLPMPKGLALQHLTCRGLSYQSAQAAAQFDAAAGQTHSAVALAARKSGAQAMPS
FT                   PTAASTASASAAPGDDGRCTAKLFMATADGKVVALNPADGQTCSNVAGGQGQIDLWQGM
FT                   PERKPGSYYSTSPVVVARDRIIVGGTVLDNHSTREPSGVIRAFDIRSGALLWAWDPGRP
FT                   GNSTPLPPGQTYVPSSPNSWSISSVDETLGLVFVPMGNAPPDQWGGRRSAEAEQYSSSV
FT                   VALDIATGAVRWVFQTVHHDLWDYDVPSQPSLIDLEIGGHSVPALVQPTKQGELFVLDR
FT                   RTGQPLLPVTEVAAPQGAARGDRTAPTQPHSQLSFNPPALTERDMWGASPFEQLWCRLA
FT                   FRRLRYEGRFTPPSEQGSLIYPGNFGVFNWGGVAVDPRRQVVFATPTRLAFVSTLVPRA
FT                   DDTSLLVQDGGPPKDGLPALNENFGAPFAVRLKPFVSPLGIPCQAPPWGFVAGADLRTG
FT                   QIVWQRRNGTPRDLSPLPLGFRMGVPGIGGPVMTAGGVAFYSGALDNYVRAYDVDSGRQ
FT                   LWQDRLPAGGQATPMTYLGTDQRQYLVVVAGGHGSTGTKAGDSVRAYVLPKEVAAP"
FT   gene            complement(383776..384264)
FT                   /locus_tag="Daci_0343"
FT   CDS_pept        complement(383776..384264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32989"
FT                   /db_xref="GOA:A9BR34"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR34"
FT                   /protein_id="ABX32989.1"
FT                   /translation="MPCLEAAARATAPPSGSRPERAGGAKHGAATLAAAGTVPARSFLL
FT                   MSSLSPHTCLQLSVAASALLVLASIGWVWHGTRALPADSRDGRSARCMAALFALGALAW
FT                   LAYGLYTGYAVLWKADALMLFAQQGALLRLPFLIGGLAWVAALLVTRVLRMLGRAGSA"
FT   gene            384284..384499
FT                   /locus_tag="Daci_0344"
FT   CDS_pept        384284..384499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32990"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR35"
FT                   /protein_id="ABX32990.1"
FT                   /translation="MALQQGVELLGAFRRGRGVVVFAGHLVRGEGACAELLDDVAQLVE
FT                   IGAGGWGHGNSLGSWTPAAPQACGPV"
FT   gene            complement(384565..385203)
FT                   /locus_tag="Daci_0345"
FT   CDS_pept        complement(384565..385203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0345"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: psb:Psyr_1566
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32991"
FT                   /db_xref="GOA:A9BR36"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR36"
FT                   /protein_id="ABX32991.1"
FT                   /translation="MARHRASPEALRYRCRFPFCLPPIRMTRNTTTPIHPQFLGRMSPR
FT                   AFKPEALSQAQIEQLADAARWAPSASNKQPWHFAYALRGDANWQAFSTIPNEFNRRWCL
FT                   EAGALIVLMSDRQASPGKHSFDAGCAWGYLALEAHAMGLATHAMGGFSADAAREVLRLP
FT                   EHLEPEVVIAVGWRGDAATLPDDLREREVPSPRKPLAEVLSAGPVATGG"
FT   gene            complement(385178..386140)
FT                   /locus_tag="Daci_0346"
FT   CDS_pept        complement(385178..386140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32992"
FT                   /db_xref="GOA:A9BR37"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR37"
FT                   /protein_id="ABX32992.1"
FT                   /translation="MITNMLRRIEDLLVQVVRVVLLVFSLLVLVGMALWTWESFRPGKA
FT                   EAPQAVAQELNWKDARPDLQFVVDETSRDLGAGGGEPAMEKRLADPALRPAFQKADALV
FT                   RAYVNKDPARRERTERDNQARGLAPLHPLLQGDALPSEADVQRRIQERGQREGDAGAVD
FT                   AAADAAAAAAASTGEEDGWMVEPVDTAAAIHERAQAAELEHGKGAYAAYVQGLPAALEQ
FT                   VFGNAALEPRLQAQTAQQILSTVLLNYTLSLDNAARALRGEDSHGSSSWKERFGAVETA
FT                   FWSMLMSFLVLVVMVLVFIRMERHLRVISQQHGQAPRQP"
FT   gene            386499..387728
FT                   /locus_tag="Daci_0347"
FT   CDS_pept        386499..387728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0347"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: amino acid-binding ACT domain protein;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: aav:Aave_3649 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32993"
FT                   /db_xref="GOA:A9BR38"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR38"
FT                   /protein_id="ABX32993.1"
FT                   /translation="MTKTSLDKSKIKFLLLEGIHPSALEVLRNAGYTNVETVTGALEGE
FT                   ELKRKIADVHFVGIRSRTQLTADVFAAAQKLVAVGCFCIGTNQVDLDAARERGVVVFNA
FT                   PYSNTRSVAELVLAEAILLLRGVPAKNASAHRGGWLKSAENSYEIRGKTLGIVGYGSIG
FT                   TQLSVMAESVGMQVLFHDVSTKLPLGNARQAASLADLLAGSDIVTLHVPELPSTQWMIG
FT                   AKEIAAMKPGAILINASRGTVVEIEPLAEALKAGKLLGAAIDVFPTEPRSNKDEFVSPL
FT                   RGLDNVILTPHVGGSTMEAQANIGLEVAEKLVKYSDNGTTTSAVNFPEVALPAHPGQNR
FT                   ILHVHHNQPGVLSAINQVFAENGINIAGQYLRTDEKVGYVVIDLAAQSSGLAVEKLTQV
FT                   PGTIRCRVLF"
FT   gene            complement(387793..389055)
FT                   /locus_tag="Daci_0348"
FT   CDS_pept        complement(387793..389055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0348"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; HPP family
FT                   protein?; KEGG: rsh:Rsph17029_2488 CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32994"
FT                   /db_xref="GOA:A9BR39"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR39"
FT                   /protein_id="ABX32994.1"
FT                   /translation="MLPARAASLPKMTRFCSPPPGPRRQRQKDNKAMGWNRKAWGPVVP
FT                   RPAPADMWRVAMGSIVGMGLATALVWLAHAGTWDLPLRLFAPLGATAVLLFAVPTSPLA
FT                   QPWSCVVGNTVSALWALFVLQWCPPQLAPALAVGGAIGCMLLTRSLHPPGGAMALLTVL
FT                   NAKASLAAGWMLPFLPVGALTLGLVLAATALHRATGRRYPHHADTAPKAAPADAAHRHA
FT                   SRLGLSHADLEALLLRFGQENNLEADDLAELLAAAEETAIEHRLGGVRCAQLMTRDPVS
FT                   CSLDDDVHAVAARFRAHPAKSLPVLNADGGLAGTVSRAELYEWLWMSPVRPAESAAKPS
FT                   LLNWLGQRLPGKTRAAPRLSELPQLVHAPELSVDEDTPVGQLLDALARHSVPCIPVMRE
FT                   GRLTGLITRTDLMRLLLQPGR"
FT   gene            complement(389093..390316)
FT                   /locus_tag="Daci_0349"
FT   CDS_pept        complement(389093..390316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0349"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: rpb:RPB_2265
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32995"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR40"
FT                   /protein_id="ABX32995.1"
FT                   /translation="MTASTDRLHIPGLPWADSPETVGLGSARLARLSARLQRGVDTGEI
FT                   PGAVALVARRGKLAYLESFGLLDPEAGTAMRPDAIFRIASMSKPITSLAIMMLAEQGRL
FT                   SIIEPVEQYLPELAALRVGLERAPLARPITLQDLLRHTSGIPYGFAGTEHPVKKMYLDA
FT                   GLFSGKFTNAQFITRLAQLPLVAQPGETWEYGMSTDVLGRVVEVVSGQTLAAFVREHIT
FT                   GPLGMADTGFHAPDSEIARAARPQPEGPQKQMPPIPPVTRAMMFESGGGGMVSTMADYA
FT                   RLCLFWCNGGTLDGVRLVSRKTVELMTTNHLPASVRMGPDMAYFGAQLPSPEVGQGFGL
FT                   GFAVRTAPGLNPLPGSVGDFSWSGIYGTFFWVDPKEDLFAILMMQSMAQRIPYRWVMRE
FT                   GVYQSVVD"
FT   gene            390405..391415
FT                   /locus_tag="Daci_0350"
FT   CDS_pept        390405..391415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   aav:Aave_2466 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32996"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR41"
FT                   /protein_id="ABX32996.1"
FT                   /translation="MPPLNWPAGDNNTMKQIILAAAACAAAALAMPASAAYPDKPIRLI
FT                   VPFPPGQATDIFARALAEKLAQKLGQPLVVENKAGAGSNIGSEQVVRSPADGYTLLVAG
FT                   SAMAVNQTLYKKVNFDPRTDLLGITLIAKVPLVFLAHPGAGIQSMKDLVDKARAEPGRW
FT                   NYASAGIGGTQHLSAEMVKARAKIQIEHIPYKGSGPAQADFVGGQVPLMVDSVTAALPN
FT                   IQAGKAVPLGVTSSARSSQLPEVPAIAESGLPEFRGFEAVGWLGLMAPKGTPQEVIDRL
FT                   NREAVAILRSPEMRKFISDRGSEAAPTTPREMDAFVASEITQWGQAVRQSGASVD"
FT   gene            complement(391461..392906)
FT                   /locus_tag="Daci_0351"
FT   CDS_pept        complement(391461..392906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0351"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB region; GatB
FT                   central domain protein; KEGG: ajs:Ajs_0236
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32997"
FT                   /db_xref="GOA:A9BPM8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPM8"
FT                   /protein_id="ABX32997.1"
FT                   /translation="MTAKLIQGYEVVIGFETHAQLATQSKIFSRASTAFGAEPNTQACA
FT                   VDMALPGTLPVMNKKAVECAIRLGLALGSHIAPRSIFARKNYFYPDLPKGYQISQFEIP
FT                   VVQGGEVSFFLGDEKKTIRLVRAHLEEDAGKSLHEDFIGQSGIDLNRAGTPLLEIVTEP
FT                   DIRSTEEAVAYAKTLHQIVTWIGICDGNMQEGSFRCDANVSVRKPGQPLGTRREIKNLN
FT                   SFKNMQLAIDYEIRWQIEEIEDGRRIQQATVLFDPDTGETRSMRTKEDAADYRYFPDPD
FT                   LPPLVVAPEWVEQVRADMPELPRAMAARFVEQYALPEYDATTLTQSQAMAAYFEDTARA
FT                   CNAPKLASNWIMGEISRRLNTEEIGMEAAKVSSAQLAALIQRIGDGTISNNAAKQVFEA
FT                   LWSGEGSDVDAIIEAKGLKQMNDTGAMEKIIDEVIAANPANVEQYRAGKDKAFNALVGQ
FT                   VMKASKGKANPAQVNELLKAKLA"
FT   gene            complement(392913..394409)
FT                   /locus_tag="Daci_0352"
FT   CDS_pept        complement(392913..394409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0352"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: aav:Aave_0292
FT                   glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32998"
FT                   /db_xref="GOA:A9BPM9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPM9"
FT                   /protein_id="ABX32998.1"
FT                   /translation="MTQQTTDLHTLGVSALSALLRERKLGAVEAAQHFLARAQAHQNLG
FT                   AFVSIDEEATLAQARAADALIAQGKGGRLAGVPIAHKDIFVTRDFPTTASSKMLAGYRS
FT                   PFDATVVTRLAEAGAVTLGKLNCDEFAMGSANENSAIAPVGFDAPAPVRNPWNTDRVPG
FT                   GSSGGSAVAVAAGLAPAVTGTDTGGSIRQPASFCGITGIKPTYGRASRYGMIAFASSLD
FT                   QAGPMGKSAEDCALLLSEMCGPDLDRDSTSLDVPAEDFTARLNDGIEGLRIGIPAEFFG
FT                   EGLSADVRAAVDGALKEYEKLGARLVPISLPRTELSIPVYYILAPAEASSNLSRFDGVK
FT                   FGHRAKNYTDLVDMYKKTRAEGFGDEVKRRIMIGAYVLSEGYYDAYYLQAQKIRRMIAD
FT                   DFQAAFQQCDVIAGPAAPTVAWQLGGKSDPLANYLADIFTLPASLAGLPGMSVPAGFGE
FT                   AGMPVGLQLIGNYFKEGQLLNAAHRFQQATDFHLQAPKGI"
FT   gene            complement(394462..394761)
FT                   /locus_tag="Daci_0353"
FT   CDS_pept        complement(394462..394761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0353"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; KEGG: aav:Aave_0293 glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABX32999"
FT                   /db_xref="GOA:A9BPN0"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPN0"
FT                   /protein_id="ABX32999.1"
FT                   /translation="MALNAQDIARIANLARLELSSTESERMLGQLNDFFGIVEKMQAVD
FT                   TSGVSPLSHPVAAIQDIALRLREDIASEPDQRDANQRSAPAVERGLFLVPKVIE"
FT   gene            394974..396017
FT                   /locus_tag="Daci_0354"
FT   CDS_pept        394974..396017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0354"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: ajs:Ajs_0239 cell shape determining protein, MreB/Mrl
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33000"
FT                   /db_xref="GOA:A9BPN1"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPN1"
FT                   /protein_id="ABX33000.1"
FT                   /translation="MFGAFRRYFSTDLAIDLGTANTLIFARDKGIVLDEPSVVAIRHEG
FT                   GPHGKKVIQAVGREAKAMLGKVPGNIEAIRPMKDGVIADFVITEQMIKQFIKMVHPRSV
FT                   LTPSPRIIICVPCGSTQVERRAIKDAAEAAGATSVYLIEEPMAAGIGAGLPVSEASGSM
FT                   VVDIGGGTTEVGVISLGGMVYKGSVRVGGDKFDEAIISYIRRNYGMLIGEPTAESIKKN
FT                   IGSAFPGSEVKEMEVKGRNLSEGVPRSFTISSNEVLEALTDPLNQIVSAVKNALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEEPLTCVVRGCGMALETMDRQ
FT                   GSIFTSD"
FT   gene            396202..397272
FT                   /locus_tag="Daci_0355"
FT   CDS_pept        396202..397272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0355"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: aav:Aave_0295 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33001"
FT                   /db_xref="GOA:A9BPN2"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPN2"
FT                   /protein_id="ABX33001.1"
FT                   /translation="MNPNTLDHSAPSLFKRRPSRVSQLALYSALALFLMVADARFRITD
FT                   PVRVAVATVLYPVQWVMLKPVQAVHDASRYLGSLDDAQAREQAARKELVAMAQRASLAD
FT                   ELIQENDHLRELLQLRDRLTTPGTAAEVVYDSPDLYTRRVVIDRGQVDGIDQGSPVLDE
FT                   KGVVGQVTRVYPLRAEVTLLIDRDQAIPVFNPRTGARSVAYGDPSPLRTGGIELRFMPS
FT                   NADVQEGDLLTTSGVDGLYPPGLPVAKVVSVERRADSAFSRIYCEPVGRVQGVRHVVVL
FT                   KPLDRATHPEAEGAAEPLRAGKGKEKDKGKEKDKAKDGKGKEASKDGKAGKTDAPATPA
FT                   APAAPAAPASARKEPA"
FT   gene            397269..397787
FT                   /locus_tag="Daci_0356"
FT   CDS_pept        397269..397787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0356"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD; KEGG: vei:Veis_1608
FT                   putative rod shape-determining MreD transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33002"
FT                   /db_xref="GOA:A9BPN3"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPN3"
FT                   /protein_id="ABX33002.1"
FT                   /translation="MIMPRGQQLLLPVNPLFIVVSLLAALALNMLPLGRQAWQPDLLMV
FT                   LLAFWALNQPQRVGMGVAFLLGLCMDVDRSSLLGQHALAYALLVFAAGAMGRRLSWFST
FT                   PVQALHLLPLFAVVHGLQVLLRMLAGGIVPGPLVVVAPLIEALLWPLVSGLLLAPQRRP
FT                   PDSDENRPL"
FT   gene            397801..399846
FT                   /locus_tag="Daci_0357"
FT   CDS_pept        397801..399846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0357"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: ajs:Ajs_0242 peptidoglycan
FT                   glycosyltransferase; TIGRFAM: penicillin-binding protein 2;
FT                   PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33003"
FT                   /db_xref="GOA:A9BPN4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPN4"
FT                   /protein_id="ABX33003.1"
FT                   /translation="MEIRNTEAELQRFRLRTWVMSVVVLLAFGLVVARLLVLQVQRHEE
FT                   LAERAESNRTAVVPIVPNRGQILDRNGVVLATNYSAYTLEIMPSRAGNLEETIDGLAEI
FT                   VEITPRDRRKFKRLVDDSRSFDSLPIRTRLTDDEVARFAAQRYRFPGVDIKARLFRTYP
FT                   MQDTASHVIGYIGRINQREKEALEDSDDAANYRGTDVIGKLGVEQSYETDLHGQTGWEE
FT                   METSAGGHAVRKLGSRPATPGDSLVLSLDIKLQRMVEELYGDRRGALVAIDPRSGELLA
FT                   MVSRPTFDLNLFVDGIDQESWAALNESINRPLLNRALRGTYPPGSTYKPFMAIAALESG
FT                   KRRPDTTIMDNGSWTFGGHTFRSGHPNGPTNLRRSIIKSSNVYYYMLANDMGVDMIHDY
FT                   MKPLGFGQITGIDVRGEARGVLPSTEWKRNTYKRPEQKKWYAGETISLGIGQGYNNFTI
FT                   LQLANAMSTLAAKGVKHRPHLAVGRVDAVTQQFSAINKDPGTSMGYKPENVEAVRAAVA
FT                   AVTVEGTSRGIFGNAPYTSTGKTGTAQAVGVRQNEKYNASRLSEFQRDHSLYIAYAPAD
FT                   NPTIAVAVIVENAGFGAAAAAPLARRVFDYWLLGRYPSLEDMAAMRKGQAGVPIGAPRR
FT                   VSEITLDAETVNLPGLPRYEPPEASAPVASNRAAALPPPSAGELED"
FT   gene            complement(399915..400673)
FT                   /locus_tag="Daci_0358"
FT   CDS_pept        complement(399915..400673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0358"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ajs:Ajs_0244 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33004"
FT                   /db_xref="GOA:A9BPN5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPN5"
FT                   /protein_id="ABX33004.1"
FT                   /translation="MSADKLARGMPYIVAEKVTKSFGSHQVLKGVSTQFCTGEVTVIIG
FT                   ASGSGKSTLLRAINRLEPHDGGRITIDGVEVTDNEATLQKQRCEVGMVFQQFNLFGHMT
FT                   VLDNVTLAPRRIHKTPRAQANAKAMALLERVGMQAHAHKYPWQLSGGQQQRVAIARALA
FT                   MEPQVMLFDEPTSALDPEMVQEVLDVMRELARGGMTMIVVTHEMGFAREVADRVMFFDQ
FT                   GCIAHEAPPAEFFGNPASERIAAFIGRMGH"
FT   gene            complement(400670..401452)
FT                   /locus_tag="Daci_0359"
FT   CDS_pept        complement(400670..401452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0359"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ajs:Ajs_0245 polar
FT                   amino acid ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33005"
FT                   /db_xref="GOA:A9BPN6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPN6"
FT                   /protein_id="ABX33005.1"
FT                   /translation="MLTVLWPAHWSRSQRSNATLVTALLLMVLVVSLLGQLLSLLPEPI
FT                   GSNADTFAEGARTTLYLTLVSGAAGLVLGIAAALARTSRTAALRWAAGFYVWAIRGTPL
FT                   LVQILFIYFALPVLIPGLNLPDFAAACIALALNVGAYNAEAVRAGLQAVPRGQAEAARA
FT                   LGLPRICVFMDVVFPQAFKISLPPLVSNFVALLKDSSLAYAIGVVELTNVGNRIQSATF
FT                   QPVETLVTVGVTYLVLTTLVTQVTAAVEYRFDVEGRHK"
FT   gene            complement(401518..402288)
FT                   /locus_tag="Daci_0360"
FT   CDS_pept        complement(401518..402288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0360"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: aav:Aave_0301 extracellular solute-binding protein,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33006"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPN7"
FT                   /protein_id="ABX33006.1"
FT                   /translation="MKRFTVIAAAALALWTAAGVQARPFEAIQKEGTLRLATEGYYAPF
FT                   AHFEGKQLTGFEVELAQMMAAKMGVKYEWKTISFDALLTGLQQDRWDLVISSHGITPER
FT                   EKAVTFTQPHYCSGAIVMSLDPAIRSAKDLAGKTVSVQTGTTYMQYMEKNLPGIKRLVN
FT                   FPTNEAARNALLSKRVDAWVTERFIAKELQQKNPNAQLKQGELLLVERIAAAVAKDNKS
FT                   LADAWNKAFKEALADGSYAKLSQKYFHEDIRCPD"
FT   gene            complement(402540..403298)
FT                   /locus_tag="Daci_0361"
FT   CDS_pept        complement(402540..403298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0361"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   ajs:Ajs_0248 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33007"
FT                   /db_xref="GOA:A9BPN8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPN8"
FT                   /protein_id="ABX33007.1"
FT                   /translation="MEWIIVSLASMLAGFVDAIVGGGGLILLPALFATFPTAPPATLLG
FT                   TNKSASVWGTAMSTWQYGRKVQLPWRAMMPAACVGMAGSFAGAWAVTQISPDFLRRLLP
FT                   LVLLGVLVYTLARKDMGRHHTPHYSGRAETLIACAIGLLIGFYDGFFGPGTGSFFVFLF
FT                   VRLMGYDFLNASASAKLLNMATNLAALALFALKGHIWWHLAVPMAVANVLGAMLGTHMA
FT                   LRHGTGFVRGIFIGVVSLLILKTGYDAFIA"
FT   gene            complement(403596..404597)
FT                   /locus_tag="Daci_0362"
FT   CDS_pept        complement(403596..404597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0362"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   reh:H16_B0517 Zn-dependent alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33008"
FT                   /db_xref="GOA:A9BPN9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPN9"
FT                   /protein_id="ABX33008.1"
FT                   /translation="MQQWQLPALGHENLQLVQVPIPEPGRGQVLVRVHAASLNYRDLLI
FT                   LRDGMGMVPTLPLVPGSDMAGEVVALGPGVSEFAVGDAVISTFFAGWQDGVQPRTSLPL
FT                   GSPGPGMLSEYVVLGEDNLVAAPLRLDFAQASTLTCAGATAWFALAESAPTRPGDTVVI
FT                   MGTGGVALFAMQIAHAQGARVVVVSGSDDKLARAAQLGADHGIHRHRTPDWAAEVRALT
FT                   GGRGADHVLELAGGDNFGRSLSALAQGGRVSVIGNLQGDELRGSVYPLLLGRATVQGIG
FT                   VAHRRALQDLVRAVDWLKLQPVIDSEYALADLPAALEHLERGAFGKLVLRMR"
FT   gene            404724..405647
FT                   /locus_tag="Daci_0363"
FT   CDS_pept        404724..405647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0363"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reh:H16_B0516 transcriptional
FT                   regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33009"
FT                   /db_xref="GOA:A9BPP0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPP0"
FT                   /protein_id="ABX33009.1"
FT                   /translation="MEPIANDRLAGVSAFVASAEAGSFAQAAERLGLTRSAVGKAVARL
FT                   EERLGARLFVRTTRSLGLTEDGQMFYERCAQALEDLDAARHMLEAGRREVVGRLRISAP
FT                   VVFGRHHVAPLLLELAQLHPRLRIEASFTDRQLDFADDGIDLAIRSGELPDSDWLVARR
FT                   LGMQTMVLCASPAYLQAHGAPRSVADLAGHRCIAYMRSGRAAPWWLAGEDGSLAAPVLE
FT                   PALGFDDIETIATATLQGAGLAHMPLWRVRSALDSGALVRLLPDVPAARIPLHVLWPRT
FT                   RFLPYRLRVTIDALLAAIPPLLQEQS"
FT   gene            complement(405644..407500)
FT                   /locus_tag="Daci_0364"
FT   CDS_pept        complement(405644..407500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0364"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: aav:Aave_0305
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33010"
FT                   /db_xref="GOA:A9BPP1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPP1"
FT                   /protein_id="ABX33010.1"
FT                   /translation="MLQKKESSALSLSTVRMPSAQWAEAPTPAPKDAPARSGRPPISMS
FT                   NTTFDYIVIGAGTAGALLANRLSRDGRSRVLLIEAGAKDDYHWIHIPVGYLYCIGNPRT
FT                   DWLYQTEPDAGLNGRSLRYPRGKTLGGCSSINGMIYMRGQARDYDGWAELTGDDAWRWD
FT                   QVLPAFRQHESHWRLDAGGNADAGFRALHGGTGTGGSAEWRVERQRLRWDILDAFAEAA
FT                   QQAGIPATEDFNGGSNEGVGYFEVNQKGGLRWNTAKAFLRPTCYGRPNFELWTHAQVSQ
FT                   LLFEQLPAGGLRCSGAQVWTGSEMVNVQASQEVLLCAGAVNSPQILQLSGIGPGALLQN
FT                   HGIAVRHDLPGVGENLQDHLQIRSVYKIKGARTLNTMANSLWGKAGIGLEYLLRRSGPM
FT                   SMAPSQLGAFTRSSPQQEHPNIQYHVQPLSLDAFGEPLHGFPAFTASVCNLNPTSRGTV
FT                   RIHSGDFRQAPAIAPHYLSTPEDRQVAADSLRVTRRIVGQSALARFAPEEWKPGVQYQS
FT                   DEDLARLAGDIATTIFHPVGTTKMGRADDPMAVLDSRLRVRGVQGLRVIDAGAMPRITS
FT                   GNTNSPTLMMAEKAAGWILADRQGQGQETARESTEPAVALAA"
FT   gene            407693..408823
FT                   /locus_tag="Daci_0365"
FT   CDS_pept        407693..408823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0365"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   vei:Veis_0920 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33011"
FT                   /db_xref="GOA:A9BPP2"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPP2"
FT                   /protein_id="ABX33011.1"
FT                   /translation="MSALNNPPQCSLRRDNDGQWALLTGSWGAAELGRRAQWRKLRAQL
FT                   ADAKGDDLGWNLEGLDWLDHVGAQLLWNHWGRRLPARLAASDAQRAMLERVGRFSKEPA
FT                   PPPPRLNLLERIDSLGCLVINACGHFAQMTRLIGQLLIDLLRFARAPHRGPWRDISGHL
FT                   YSMGATALPITALVGFLIGVVLAYLMALQLRQFGAESFIVNILGISLIRELGPLLAAIL
FT                   VAGRTGSAITAQIGVMRVTEELDAMQVMGIPHGFRLVLPRALALAIAMPLVSLWTTLAA
FT                   LAGGMLAADLTMGVTGAYFAEALPAAVKIGNLWIAMGKSVVFGALIALIGCHWGLRVEP
FT                   NTQSLGKGTTASVVTAITMVIVVDAIFAILFKDVGI"
FT   gene            408823..409626
FT                   /locus_tag="Daci_0366"
FT   CDS_pept        408823..409626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0366"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aav:Aave_0307 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33012"
FT                   /db_xref="GOA:A9BPP3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPP3"
FT                   /protein_id="ABX33012.1"
FT                   /translation="MAMDTETSSTPAADEPIVRIAGLWSVFGEGENAFAVHQDLDLDVQ
FT                   RGEMLSIVGGSGTGKTVLLRQMLGLLEPTKGRVEVLGRPASEMGREGAASRVGMLFQHG
FT                   ALYSAFSVLDNVAFALREQGTLPDDLVRDAALVKLQMVGLKPEHASRMPADLSGGMIKR
FT                   VALARALIMDPPLLLLDEPTAGLDPTSSDEFCELLRELRAELGLTVIMVTHDLDTLFAL
FT                   SSRVAVLAEKKVLVSGPPREVAEFKHPFIEHFFQGERGRRAMSTV"
FT   gene            409826..410788
FT                   /locus_tag="Daci_0367"
FT   CDS_pept        409826..410788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0367"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: vei:Veis_0922 mammalian cell entry related domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33013"
FT                   /db_xref="GOA:A9BPP4"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPP4"
FT                   /protein_id="ABX33013.1"
FT                   /translation="MENKSHAMAAGIFVLVVAALLAGLAIWLTRDTRQYNEYELSTKDG
FT                   ISGLQAQAAVRYKGVAVGKVTQIGFDPQTNGNVLIRIAIGVNTPITPTTFAVLGYQGVT
FT                   GLAHVQLDDADQPQPQLPPGPSGLPRLPLRSSPLSMLADQGQVLLERADEISRRLSDML
FT                   DTDNQKRVSQALENIAAAAAGVQQLTQNLDRTLSTQVPQLAADAHNTLQSLEKASNGAS
FT                   AVASELQQTVRRVNAQDGPLEQIAQSTRALTRMADSLGRSTVPHANRAADDVSRAARQM
FT                   GTAASRFSDNPQAVIYGPGQARPGPGEPGFVAPSAATQP"
FT   gene            410803..411471
FT                   /locus_tag="Daci_0368"
FT   CDS_pept        410803..411471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0368"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: ajs:Ajs_0253 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33014"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPP5"
FT                   /protein_id="ABX33014.1"
FT                   /translation="MPLSRKTAVASAGLAAALILLAGCSALPQPPAQPARYDFGLAPLS
FT                   APAQSATSAAPQARTPLALADVEAPALSDGSTAMFYRLAYANGQELRPYQLARWSQPPA
FT                   LLLQQRLRSQLGLQRPVLASSESVAQPRLQGAVPTLLRVDIEEFSQVFYAPGSSAGVVR
FT                   LRATLVEQSGAVDRLLGQKLFEVRSPAASGDAAGGAKALATAADAAIAQIDEWLGQQGH
FT                   "
FT   gene            412129..412347
FT                   /locus_tag="Daci_0369"
FT   CDS_pept        412129..412347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0369"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: aav:Aave_0312 CsbD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33015"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPP6"
FT                   /protein_id="ABX33015.1"
FT                   /translation="MNEDRIKGNWKQFTGKIREQWGKLTDDDLDVIAGKREQFLGKLQE
FT                   RQGLARDAAEKQLTDWQKRNPDFRFED"
FT   gene            412492..413079
FT                   /locus_tag="Daci_0370"
FT   CDS_pept        412492..413079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33016"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPP7"
FT                   /protein_id="ABX33016.1"
FT                   /translation="MQTPQRFRHMLSAVALGLMASGAMAMTNAEHTAAKNQIEADYKAA
FT                   KEQCKPLKGNAKDVCEKQAKGQENVAKAELESRRNPSPKNSEKALIAKADADYDIAKEK
FT                   CDDLKGDAKDVCVKDAKAAHVHAVEAAKVNKAQAEPAANSAAKAANVAETRKDAAEETR
FT                   EADYKAAKARCDTMSGAAKDTCVADAKRKFGQ"
FT   gene            413326..413826
FT                   /locus_tag="Daci_0371"
FT   CDS_pept        413326..413826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0371"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   pna:Pnap_1243 hemerythrin-like metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33017"
FT                   /db_xref="GOA:A9BPP8"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPP8"
FT                   /protein_id="ABX33017.1"
FT                   /translation="MAVLEWSGALALELPAMDEVHQEFVLLLAEVEAADDAQLCARWDE
FT                   LIAHTQVHFDQEDRWMQSTRFTSTNCHSLQHKVVMQVMREGAAKAVAGDLAVIRSMAGE
FT                   LAAWFVHHAQTMDAALALHLRSAGFDPATGSLAHPEALPEQPITGCGGACDGSADRARA
FT                   VPA"
FT   gene            complement(413870..414517)
FT                   /locus_tag="Daci_0372"
FT   CDS_pept        complement(413870..414517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0372"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: aav:Aave_0319 multiple antibiotic resistance
FT                   (MarC)-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33018"
FT                   /db_xref="GOA:A9BPP9"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPP9"
FT                   /protein_id="ABX33018.1"
FT                   /translation="MDLKPLITLVAIINPLAIVPFFIHYTEGFSAQQRQQTIRTAALAS
FT                   FCVIAACAIIGLQVLDFFNISLQSFQVGGGLLLLISAMNMLNARPAEERPNAPTLVAGA
FT                   EKAAMGNSIAVVPLTIPLLTGPASMSTVVIYADQARTIWQHLALVGYGVVVALVVMVCF
FT                   SLADPIARVLGKTGINVMTRLMGLILAALAVEVMAGGLVKIFPILASPAIVP"
FT   gene            414707..415399
FT                   /locus_tag="Daci_0373"
FT   CDS_pept        414707..415399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0373"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: ajs:Ajs_0260
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33019"
FT                   /db_xref="GOA:A9BPQ0"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPQ0"
FT                   /protein_id="ABX33019.1"
FT                   /translation="MGSFVQLTSLDGTASPAWVARPDVPARGAVVVLQEIFGVNAHIRA
FT                   VADRLAARGYMAVAPSLFTRVEAGVDLGYGDADRAKGMALKSAAEALPQPGVLPEIEAA
FT                   IAHAATLVPGGKVGIVGFCWGGLWAWRAACNLPSLSAAACYYGGGMTTPLEMGREPLCP
FT                   VIAHFGRRDSHIPVDAVQAFAQAQKHVQVHLYDADHGFNCDQRSAYDEASALQARDRTL
FT                   AFFDQQLA"
FT   gene            complement(415400..415717)
FT                   /locus_tag="Daci_0374"
FT   CDS_pept        complement(415400..415717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33020"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPQ1"
FT                   /protein_id="ABX33020.1"
FT                   /translation="MPDLDAPSGAHASPPFFSSPQVPREETSLYYPISEYEVYRIKDCM
FT                   HQMGLVIDLCCMAGPDQQLSDLGGLMSFLTAQQRALRGTLQTVQARKATPGPACDPDPG
FT                   G"
FT   gene            complement(416080..416724)
FT                   /locus_tag="Daci_0375"
FT   CDS_pept        complement(416080..416724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33021"
FT                   /db_xref="GOA:A9BPQ2"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPQ2"
FT                   /protein_id="ABX33021.1"
FT                   /translation="MTASASRSPLSRRSLLAASAATGLALCESALAAPAAPGKSTEAAV
FT                   LTISGPGVRGNRGPLDPVADLLLKNHGLAFDSAWTTGAGALERLPTVEITPHIEYDGQP
FT                   HRLRGPLLATVLQAAGVDSAAAAARGQWITLQAIDGYRAQLPLAQALQWRMLLATHMDG
FT                   RRLGLGGLGPQWAMYDADRIADLAGKPLKERFAQAPWGLYHMGLHAQQPQG"
FT   gene            complement(416721..419333)
FT                   /locus_tag="Daci_0376"
FT   CDS_pept        complement(416721..419333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3087 outer membrane autotransporter
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33022"
FT                   /db_xref="GOA:A9BPQ3"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPQ3"
FT                   /protein_id="ABX33022.1"
FT                   /translation="MSIIHPSAAADVPPMPTPRPWGRTSLGLTVGLALALAGAAARAAT
FT                   LTVTTAGEIADTEPLSRAQCSPAAGDRNCDTLRDAINHAADGDIIVFGAALDGQTISLT
FT                   RFTNCLDTGQAAGATCLPLASWPGYVSQFGPSAFFISGKRITIDATANGLTPQGVSVQR
FT                   LGTAPGFRLFDIDAQGGLVLRGLTLAGGQATGGSSRFGGGALGAGGAIFNRGQLTIERS
FT                   TLTRNHAQGGQGGRLSLNSFAGAGVGEDGTLSPGGGPNAGGPNDGGLGGGSGSASGKNG
FT                   GFGGGGGGSGGGGFGGGGGRRGSGGGFGAGNGGGGPFDAGGGAGGMGGAIFNNAGTLTL
FT                   NQVTLAGNGAHGGLGNSSGGGAGLGGAVFNYNGVLTIRFSTLAGNTVQANGDDNPAAQG
FT                   GAIYSLGDSQAACSAGGNISCTRSGASLEMQASIAQDSVFEPATKQPAGRDVVLDLRNG
FT                   GTSDASGSNNLLGLAQALNNADISALAFTTGNPQLGPLASHGGPTQTMLNSTGSPALDG
FT                   VACTAAPGTDQRGVVRPQGARCDIGAVEANVFQAALTVLASGAGGVSAQASPPAATGAV
FT                   QDCGRPGGLCQAGYGYFEGAPTLVTLAATPDAGHAFAAWSGACSGSTPTCSVTIDAARS
FT                   VQASFTAFSVTASLPSGTYGTAYSQPLAPVPSGGVGPFSYSVSGLPAAFSQAAGTLSAP
FT                   ATQAAGSYSFTLTATDANGATTEPAAVTVVIGPAATSAHLSASPAAPGPGQSVTFSAQV
FT                   TLPAGASGTVDFLNGTQVLCASVAVTGGQASCSVPRLPPGTATVQARYVPGDGNTSGSD
FT                   SNTVTVTTAAAAPIPALGAGGLALLGLLTAAGAAVSRRMGTSRKIGAGTSPRTPRSSP"
FT   gene            419553..420290
FT                   /locus_tag="Daci_0377"
FT   CDS_pept        419553..420290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0377"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Bacterio-opsin activator HTH domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70 region 4 type 2;
FT                   KEGG: pna:Pnap_4084 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33023"
FT                   /db_xref="GOA:A9BPQ4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPQ4"
FT                   /protein_id="ABX33023.1"
FT                   /translation="MDTHTDPYSAAATGGATPIRVAVVEDDAACRHALVGVINAAKDMV
FT                   LCWAAASRAEALHQLGRADGAGAMDVMLVDLGLPDGSGLEVIAAVRTRHPGAAVMVSTI
FT                   FGDEQHVLAAIEAGAMGYLLKDLAADAVLEEVRSLHAGGSPINPMVARKLLLRQQRAGA
FT                   VAGLQPPAEPQAAAQALSARELEVLRLVARGHTLDEVARQLGVSRHTVRTFVRRIYGKL
FT                   QVSSRTQMMHVALQRGWLAEGRQ"
FT   gene            420310..422268
FT                   /locus_tag="Daci_0378"
FT   CDS_pept        420310..422268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0378"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: pna:Pnap_4085 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33024"
FT                   /db_xref="GOA:A9BPQ5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPQ5"
FT                   /protein_id="ABX33024.1"
FT                   /translation="MTQPLLQGRVLLVSAGLVALAMLLAGAFGLRGPAAGEAVQLRQAQ
FT                   LWRSDSPHWAPPAALASADDAVLDASTPWSDVDLPYGGDRAVSGSGDLAAAPPEVRWFR
FT                   AVVPPEALAPTPQGARLYIPRWQTVGTVAVYVDGALAWQTRGSRVWNSFNRPVWLDLGG
FT                   LAQPGRPLQVHVRMASQQGVGGALSSLWAGPAESLRLSWRLRSLLQADLVVYTAGSYLV
FT                   LGLFALALWTLQRRRGDVVFLLFFLMSLCQLLGSLQFMVDGEGLALSDGWFSWLTLAGL
FT                   MGATVAAFHFLCLMQRRRRPWLARVLQGYVGTVLLVAVPLWGPVHETILPLLRLLMVPP
FT                   EILVLCMAVAGAWRMRDGGSTMLAVWMLLSFPIGFHDLALQSYLISIESIYLTPYVYLG
FT                   LFTLFLLVAYRRYNGALAVAENANLHLAERLKAQEAELAQAHERLLAGEREQTLMHERQ
FT                   RLMREMHDGVGSSLMSALRVVEFNQAGTVNLVQLLQECIDDLKLSIDSLEPLDCDLLAL
FT                   LAGLRYRLGPRLEGAGLRLHWEVSDLPALPWLDAQAALHVLRILQEVLTNIIKHSGARE
FT                   ITVRTAQAPLQGRAGVQVLVEDDGHPFDRAQAPTEGRKGLANMRTRALALQARLDWAPL
FT                   AGGNRFTLWMPLERAGP"
FT   gene            complement(422265..423458)
FT                   /locus_tag="Daci_0379"
FT   CDS_pept        complement(422265..423458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0379"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: aav:Aave_0326 Mg2+ transporter protein, CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33025"
FT                   /db_xref="GOA:A9BPQ6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPQ6"
FT                   /protein_id="ABX33025.1"
FT                   /translation="MQPVTPPAGAAPAARNMRIFHLQPGGATELAALPDQAPAQGFVWI
FT                   SCTRATLQERLTEVQRTLQLLSGQQLVDLHVSDLLNAQLPSRYDYTSQYDLLVFRRLAS
FT                   GQARAAASTGVPAAPTAAPAAPVKRTGPPVLRNIDTSPVGFAMFDQVLLSVHPDDCTVR
FT                   DAYAARLLAAVPNDPREGRLNPTSGTRLPASPPDLMLRVVNLIVDGFLDLRRELSRQLD
FT                   HWQTELLRPRTRFANWSALLDARLALHELDEVCEDQRAAVQDWTDALETWAPPEDAASL
FT                   RELDLLKVRSRDVLEHIERVVHHVRRLEQSTETVVQMHFSVQSNRTNDIMRTLTALTAV
FT                   FLPLNLIAGIFGMNFEFIPLVHKQDGFWWAMGSMTTIAVGLTVFFWRKRYMARTAQD"
FT   gene            complement(423463..424530)
FT                   /locus_tag="Daci_0380"
FT   CDS_pept        complement(423463..424530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0380"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   aav:Aave_0327 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33026"
FT                   /db_xref="GOA:A9BPQ7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPQ7"
FT                   /protein_id="ABX33026.1"
FT                   /translation="MPASSPGLRGLRREWGTIFGMHLSSPTPFPHNRPRRLRRDAFTRN
FT                   LVRENVLTAHDFIYPVFVHEGTNQREAVPSMPGVDRLSLDLLLPVAEQCVQLEIPFLAL
FT                   FPAIETSLKTPDGKEALNPDGLIPRVVRALKKEFPQLGVMTDVALDPYTSHGQDGILDE
FT                   SGYIINDETVQVLVGQALNHAEAGVDMVAPSDMMDGRIGAIREALEAHGHIHTRIMAYS
FT                   AKYASAFYGPFRDAVGTRGALGKADKNVYQMDPANTDEALREVAQDLAEGADMVMVKPG
FT                   MPYLDVVRRVKDEFGVPTFAYQVSGEYAMLKAAAANGWLDHDQVMMESLLAFKRAGADG
FT                   ILTYFAIDAARKLRG"
FT   gene            424594..425022
FT                   /locus_tag="Daci_0381"
FT   CDS_pept        424594..425022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ajs:Ajs_0268 conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33027"
FT                   /db_xref="GOA:A9BPQ8"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPQ8"
FT                   /protein_id="ABX33027.1"
FT                   /translation="MLWVKAFHIVFVASWFAGLFYLPRIFVNVAMVTPGSVAERERLLL
FT                   MARKLLRFTTLLAVPALGLGLWLYLGYGIGKGPGNGWMHAKLAGVLLVIGYHHACARLL
FT                   RKLIDNRDQHSHRWFRFFNEVPVLLLMAIVILVVVKPF"
FT   gene            425054..426187
FT                   /locus_tag="Daci_0382"
FT   CDS_pept        425054..426187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0382"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: ajs:Ajs_0269 VanZ
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33028"
FT                   /db_xref="GOA:A9BPQ9"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPQ9"
FT                   /protein_id="ABX33028.1"
FT                   /translation="MVQKTSAWPLALVYAVLIVFASLFPFDGWRAQGIDPLVFLTAKIP
FT                   PPYWTWFDVNINIVGYAPLGFFLALALVRSGSQRAAVPLAALAGTLLSLSMEFLQIYLP
FT                   RRVPSNLDLVLNAGGTLLGALVALLLERLGALARWSAFRTHWLGEDGGGAMVLLALWPW
FT                   ALLFPAAVPFGLGQVLERLEQGLLDLLEGTPFLMWLPLRESALTPLSPVTEMLCVMLGL
FT                   WVPCLLAYCVMRHMGRRAILAGSAVVIGIGVSALSAALSWGPAHAWEWVDLPVRMGVWG
FT                   GLGLAMVAMPLPRRACAALLLLVLVLQLSILNQAPTSAYFSETLQAWEQGRFIRFYGLG
FT                   QWLGWLWPYATLVYVLLRLARRDAAPPPPPAPAVPQA"
FT   gene            426198..426572
FT                   /locus_tag="Daci_0383"
FT   CDS_pept        426198..426572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0383"
FT                   /product="ferredoxin-like protein"
FT                   /note="KEGG: ajs:Ajs_0270 ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33029"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPR0"
FT                   /protein_id="ABX33029.1"
FT                   /translation="MSEHPRPGADSGQQGAGNYYARHIFFCLNERPNGEDCCALHGAKA
FT                   GFDHCKKQVKQLGLAGKGQVRVNKAGCLDRCAGGPVAVVYPEGTWYTFVDESDIDEIVE
FT                   SHLKNGQPVERLLLPPDVGR"
FT   gene            426653..427288
FT                   /locus_tag="Daci_0384"
FT   CDS_pept        426653..427288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0384"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: ajs:Ajs_0271 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33030"
FT                   /db_xref="GOA:A9BPR1"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPR1"
FT                   /protein_id="ABX33030.1"
FT                   /translation="MNAQTERLTLTGLAGAVEALRDAPAADAPPRGVAIIAHPHPLFGG
FT                   TMDNKVVQTLARAFVQCGYTAVRFNFRGVGASAGEHDAGVGEAQDMLSVVRQVAPEGPI
FT                   ALAGFSFGAFVTSHVLAGLWNEGRVEKAVLVGTAASRFTVAPVPPEAHDRTLVVHGEAD
FT                   DTVPLSAVMDWARPQILPVTVVPGGGHFFHGQLPLLKSLVVRHLRSLP"
FT   gene            427381..428550
FT                   /locus_tag="Daci_0385"
FT   CDS_pept        427381..428550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0385"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: beta-lactamase; peptidase S11
FT                   D-alanyl-D-alanine carboxypeptidase 1; Penicillin-binding
FT                   protein 5 domain protein; KEGG: aav:Aave_0332 serine-type
FT                   D-Ala-D-Ala carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33031"
FT                   /db_xref="GOA:A9BPR2"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPR2"
FT                   /protein_id="ABX33031.1"
FT                   /translation="MKPLSSTLRVLALAAAMAPALALAQITPPQPPEIAARNYLLVDVT
FT                   ANQVLGAKDIDAPIEQASLTKLMTGYLVFDALRAKKITLEQRLPVSERAWKMPGSRMFI
FT                   DPKMQVPVDDLIKGMIVQSGNDATMALAEGVGGSAENFVRLMNEQAKALGMKNTSYKNP
FT                   EGLTEPGHLTTARDLSILAQRLMQDFPEYMHYYSTKKYFYPGTPASNGTNRNSLLFRDP
FT                   TVDGLKTGHTAAAGYCLVATAKRDLPNVGSRRLISIVLGAASENARANESQKLLNWGYA
FT                   AFDSVKLFDAEQAVATPEVWKGKANTVKIGRTTPIVVTVPAGSGGKLSTEVVRQDPLIA
FT                   PFTKGQAMGTLKVKMGADTVAEVPLVALEGVEQAGFFGRAWDAIRLWIK"
FT   gene            428708..429085
FT                   /locus_tag="Daci_0386"
FT   CDS_pept        428708..429085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0386"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: ajs:Ajs_0273 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33032"
FT                   /db_xref="GOA:A9BPR3"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPR3"
FT                   /protein_id="ABX33032.1"
FT                   /translation="MPTINQLVRQGRTVEVVKSKSPAMENCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDL
FT                   QGVKDRKQSRSKYGAKKPKAK"
FT   gene            429246..429719
FT                   /locus_tag="Daci_0387"
FT   CDS_pept        429246..429719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0387"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: aav:Aave_0334
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33033"
FT                   /db_xref="GOA:A9BPR4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPR4"
FT                   /protein_id="ABX33033.1"
FT                   /translation="MPRRREVPKREILPDPKFGNVELSKFMNVIMEGGKKAVAERIIYG
FT                   ALDLIQKKHPDKDPLEAFVVAINNVKPMVEVKSRRVGGANYQVPVEVRPVRRLALSMRW
FT                   LKEAARKRGEKSMAQRLANELLEATEGRGGAMKRRDEVHRMAEANKAFSHFRF"
FT   gene            429868..431976
FT                   /locus_tag="Daci_0388"
FT   CDS_pept        429868..431976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0388"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: ajs:Ajs_0275 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33034"
FT                   /db_xref="GOA:A9BPR5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPR5"
FT                   /protein_id="ABX33034.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVTHKLGEVHD
FT                   GAATTDWMEQEQERGITITSAAVTCFWKGMDLSYPEHRFNIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVVDQMKLRLK
FT                   ANPVPVVIPIGAEENFKGVVDLVKMKAIIWDEASQGMKFEYHEIPAELVETANKWRENL
FT                   VEAAAEASEELMNKYLEEGTLSEEEVKAGLRARTLATEIQPMLCGTAFKNKGVQRMLDA
FT                   VIDYLPAPVDIPDVTGTDPENEETKLSRKADDGEKFSALAFKLMTDPFVGQLTFVRVYS
FT                   GVLTKGDTVFNSVKGKKERIGRIVQMMANERVEVEEIRAGDIAACVGLKDVTTGETLCA
FT                   VEAPIVLERMVFPEPVIAQAVEPKSKADQEKMGIALSRLAAEDPSFRVRTDEESGQTII
FT                   AGMGELHLEIIVDRMKREFNVEANVGKPQVAYRETIRQKVTDVDGKFVRQSGGKGQYGH
FT                   VVLTLEPQEAGKGFEFVDEIKGGVVPREYIPAVEKGVIEALTSGVLAGYPVVDVKVRLT
FT                   FGSYHDVDSNEMAFKMAAIFGFKEGARKASPVILEPMMAVEVETPEDYAGTVMGDLSSR
FT                   RGMVQGMDDMAGGGKSIKAEVPLSEMFGYATSLRSQTQGRATYTMEFKHYAEAPRNVAE
FT                   AIVAARAK"
FT   gene            432152..433342
FT                   /locus_tag="Daci_0389"
FT   CDS_pept        432152..433342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0389"
FT                   /product="translation elongation factor Tu"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: ajs:Ajs_3904 translation elongation factor Tu;
FT                   TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33035"
FT                   /db_xref="GOA:A9BPR6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPR6"
FT                   /protein_id="ABX33035.1"
FT                   /translation="MAKEKFQRNKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAK
FT                   AYDQIDAAPEEKARGITINTAHVEYETAGRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLAKYDF
FT                   PGDDTPIIRGSAKLALEGDQSDKGEAAILRLAEALDSYIPTPERAVDGAFAMPVEDVFS
FT                   ISGRGTVVTGRIERGIIKVGEEIEIVGIRDTQKTIVTGVEMFRKLLDQGQAGDNVGLLL
FT                   RGTKREDVERGQVLCKPGSIKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPADKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIA"
FT   gene            433367..433678
FT                   /locus_tag="Daci_0390"
FT   CDS_pept        433367..433678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0390"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: ajs:Ajs_0277
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33036"
FT                   /db_xref="GOA:A9BPR7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPR7"
FT                   /protein_id="ABX33036.1"
FT                   /translation="MSKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTR
FT                   MKRFDILRSPHVNKTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ"
FT   gene            433889..434563
FT                   /locus_tag="Daci_0391"
FT   CDS_pept        433889..434563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0391"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: ajs:Ajs_0278
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33037"
FT                   /db_xref="GOA:A9BPR8"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPR8"
FT                   /protein_id="ABX33037.1"
FT                   /translation="MSLSNSLGLLGRKVGMMRLFTDDGDAVPVTVVDVSNNRVTQVKTQ
FT                   ENDGYVALQVTFGSRKASRVTKPEAGHLAKAGVEAGEVMGEFRVTEETAGKYAAGSVLP
FT                   VAELFSVGQKVDVQGTSIGKGFAGTIKRHNFRSQRASHGNSRSHNVPGSISMAQDPGRV
FT                   FPGKKMTGHMGDETITTQNLDVVRIDEARQLLLIKGAVPGSKGGFVTVRPAIKAKASKG
FT                   AN"
FT   gene            434563..435183
FT                   /locus_tag="Daci_0392"
FT   CDS_pept        434563..435183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0392"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: aav:Aave_0339
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33038"
FT                   /db_xref="GOA:A9BPR9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPR9"
FT                   /protein_id="ABX33038.1"
FT                   /translation="MQLELLNEQGQAASKFDAPETVFGREFNEDLVHQIVIAYRANARQ
FT                   GTRAQKDREQVRHTTAKPFKQKGTGRARAGMSSSPLWRGGGRIFPNLPEENFTQKINKK
FT                   MYRAGMVAILSQLAREGRLAVVDSLKLESPKTKVLADKFKAMNLESVMVIAEEVDENLY
FT                   LASRNLKNVFVVEPRYADPVSLVHYKKVLVTKGAIDKLKEMFE"
FT   gene            435180..435494
FT                   /locus_tag="Daci_0393"
FT   CDS_pept        435180..435494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0393"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: ajs:Ajs_0280
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33039"
FT                   /db_xref="GOA:A9BPS0"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPS0"
FT                   /protein_id="ABX33039.1"
FT                   /translation="MSTLKFDEGRLMQVLVAPIVSEKATMVAEKSNAVTFKVLQSATKH
FT                   EIKAAVELMFKVEVAGVSVVNIKGKTKRFGKTTGRRDHVRKAYVMLKPGQELNLSGEAA
FT                   "
FT   gene            435497..436321
FT                   /locus_tag="Daci_0394"
FT   CDS_pept        435497..436321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0394"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: aav:Aave_0341
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33040"
FT                   /db_xref="GOA:A9BPS1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPS1"
FT                   /protein_id="ABX33040.1"
FT                   /translation="MAVIKLKPTTPGQRGTVKVTRDHLHKGAGFAPLLEPQHQKSGRNN
FT                   NGHITTRHKGGGHKHHYRVVDFKRTKDGIPAKVERIEYDPNRTAHIALVCYADGERRYI
FT                   IAPRNLEVGATIVSGSEAPIRVGNTLPIRNIPVGSTIHCIELKIGAGAQIARSAGTSAT
FT                   LLAREGIYAQVRMRSGEVRKVHIECRATIGEVANEEHSLRRLGKAGVKRWMGIRPTVRG
FT                   VVMNPVDHPHGGGEGKTGEGRHAVDPWGNLTKGYRTRNNKRTQSMIVSRRKK"
FT   gene            436332..436607
FT                   /locus_tag="Daci_0395"
FT   CDS_pept        436332..436607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0395"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: vei:Veis_1268 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33041"
FT                   /db_xref="GOA:A9BPS2"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPS2"
FT                   /protein_id="ABX33041.1"
FT                   /translation="MTRSLKKGPFVDHHLLAKAEKAVATKDKKPVKTWSRRSMVLPEFI
FT                   GLTIAVHNGKQHVPVYVTDQMVGHKLGEFALTRTFKGHPADKKAKK"
FT   gene            436618..436950
FT                   /locus_tag="Daci_0396"
FT   CDS_pept        436618..436950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0396"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: aav:Aave_0343 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33042"
FT                   /db_xref="GOA:A9BPS3"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPS3"
FT                   /protein_id="ABX33042.1"
FT                   /translation="MSETRAVLRGVRLSVDKGRLVADLIRGKKVDQALNILTFTQKKAA
FT                   VIIKKVLESAIANAEHNDGADIDELKVKTIFVEQGTTLKRFTARAKGRGNRISKPTCHV
FT                   YVTVGN"
FT   gene            436967..437839
FT                   /locus_tag="Daci_0397"
FT   CDS_pept        436967..437839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0397"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: aav:Aave_0344 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33043"
FT                   /db_xref="GOA:A9BPS4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPS4"
FT                   /protein_id="ABX33043.1"
FT                   /translation="MGQKIHPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREFLKA
FT                   KLKNAAVSRILIERPAKNARITIFSARPGVVIGKKGEDIENLKKELATRLGVPVAVNIE
FT                   EVRKPEIDAKLIADSICQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIA
FT                   RCEWYREGRVPLHTLRADIDYGFSEAKTTYGVIGVKVWVYKGDTLGRNDLPAAETPRPE
FT                   EERRPRGPRRDGRGDGRRDGAGRGARRPAGANAAPADGSDKPAGAGADSVKRVRKTDAP
FT                   ATAADGKGE"
FT   gene            437842..438258
FT                   /locus_tag="Daci_0398"
FT   CDS_pept        437842..438258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0398"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16; KEGG: aav:Aave_0345
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33044"
FT                   /db_xref="GOA:A9BPS5"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPS5"
FT                   /protein_id="ABX33044.1"
FT                   /translation="MLQPARRKYRKEQKGRNTGIATRGNSVAFGDFGLKSTDRGRLTAR
FT                   QIEAARRAISRHVKRGGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKVLY
FT                   EIVGVPEELAREAFRLAAAKLPLRTTFVSRQIGA"
FT   gene            438269..438466
FT                   /locus_tag="Daci_0399"
FT   CDS_pept        438269..438466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0399"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: aav:Aave_0346
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33045"
FT                   /db_xref="GOA:A9BPS6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPS6"
FT                   /protein_id="ABX33045.1"
FT                   /translation="MTKAAELRQKDVAGLEAEVKSLQKAHFGLRMQKATQQLGNTNTLR
FT                   TTRRDIARAKTILAEKQAAK"
FT   gene            438480..438749
FT                   /locus_tag="Daci_0400"
FT   CDS_pept        438480..438749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0400"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: ajs:Ajs_0287
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33046"
FT                   /db_xref="GOA:A9BPS7"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPS7"
FT                   /protein_id="ABX33046.1"
FT                   /translation="MTEAKKSLKRTLIGKVVSDKRAKTVTVMVERRVKHPIYDKIMIKS
FT                   SKYHAHDEQGEYKLGDVVEITESRPLSKTKNWVATRLVQKAALV"
FT   gene            438796..439374
FT                   /locus_tag="Daci_0401"
FT   CDS_pept        438796..439374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0401"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ajs:Ajs_0288 redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33047"
FT                   /db_xref="GOA:A9BPS8"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPS8"
FT                   /protein_id="ABX33047.1"
FT                   /translation="MWVVFSFGDHHFGGPRFCTTKEIEMIKVGDALPAATLMEYVEVEG
FT                   NGCSIGPNPVKLPEAAAGKTIAVFAVPGAFTPTCSAKHVPGFVEQAEAFKAAGVDEIWC
FT                   LSVNDAFVMGAWARDQKTDGKVRMLADGDAAFAKATGLTLDLNGKGLGLRSNRYSMLVK
FT                   DGKVATLNVEGPGKFEVSDAATLLGQAKA"
FT   gene            complement(439486..440076)
FT                   /locus_tag="Daci_0402"
FT   CDS_pept        complement(439486..440076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0402"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   aav:Aave_0349 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33048"
FT                   /db_xref="GOA:A9BPS9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPS9"
FT                   /protein_id="ABX33048.1"
FT                   /translation="MVGAAAGGCFLTAWPDVASLPLHCVFRRFSQVPVDKPAVALLAPN
FT                   PLEDMDEVRQIFQEYAASLDVDLQFQDFEAEIADLPGDYASPRGHILLAKVDGAVAGCC
FT                   ALRPLDNCDYANAAEMKRLFVRKAFRGFGLGRQLAEAMLDVARQAGYDHVLLDTLDDME
FT                   SARALYTDLGFQEIPPYYHNPIAGAHYLKADIF"
FT   gene            complement(440043..440801)
FT                   /locus_tag="Daci_0403"
FT   CDS_pept        complement(440043..440801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0403"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: ajs:Ajs_0290 cytochrome
FT                   b561"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33049"
FT                   /db_xref="GOA:A9BPT0"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPT0"
FT                   /protein_id="ABX33049.1"
FT                   /translation="MPHPHPHPHPHPHPHPSFHAMAQESTAQGAAKHKVRIWDLPTRLF
FT                   HWLLAATVVGLVVTAKLGGNAMNWHLLLGHAMLALLLFRLLWGLVGGRWSRFASFIHAP
FT                   ATVLRHVRGQGTESDSAGHSPLGALSVFAMLAVLIAQVGSGLLSDDEIAFSGPLSRFVS
FT                   GDTVAQATAYHAHWGQYLLYALVALHLLAILFYAWRGRGLVRAMVTGDKHLPEPLPSSR
FT                   DTAASRLLALVLALVAGAAAWWVQQLGGAF"
FT   gene            440966..441376
FT                   /locus_tag="Daci_0404"
FT   CDS_pept        440966..441376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0404"
FT                   /product="cytochrome c prime"
FT                   /note="PFAM: cytochrome c prime; KEGG: ajs:Ajs_0291
FT                   cytochrome c, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33050"
FT                   /db_xref="GOA:A9BPT1"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="InterPro:IPR015984"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPT1"
FT                   /protein_id="ABX33050.1"
FT                   /translation="MATTALPASAQFAKSEDAIKYRQGALAVLGQHFGRLGAMANGKIP
FT                   FDAKAAQENAEVVAFMAKLPWAGFGAGTEGGKAKPEIWKEQAKFQDLSEKMQAETVKLA
FT                   AAAKSGNLDQLKAAFGPAAASCKACHDSFRSR"
FT   gene            complement(441449..442060)
FT                   /locus_tag="Daci_0405"
FT   CDS_pept        complement(441449..442060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0405"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   aav:Aave_0350 redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33051"
FT                   /db_xref="GOA:A9BPT2"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPT2"
FT                   /protein_id="ABX33051.1"
FT                   /translation="MARPVRAPNFCPCRASKGGARHACRPSGATLGTIVAMASKHWIAG
FT                   VVIAAAAGMGAWVYSGAGQTAAPQSTFVLLDGSKQTTADLKGKVTLVNFWATSCTTCVA
FT                   EMPEIVATHQKFQSQGFETLAVAMSYDPPSYVVNFADSRKLPFKVALDNTGAVARAWGD
FT                   VQLTPTTYIVNKRGDIVKRYVGAPDFAELHRLIEKLLAEA"
FT   gene            442076..442693
FT                   /locus_tag="Daci_0406"
FT   CDS_pept        442076..442693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33052"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPT3"
FT                   /protein_id="ABX33052.1"
FT                   /translation="MTLMESFSKAKGRALALRLGAALLVLAPLAACSPRLDWRQVAVEG
FT                   TPLRVLLPCDPQSATRPVELGQGMGTVQMSMMGCDADASTYAVSHFLVSEPSRAAEMLS
FT                   YWQAAVLGQMNPGAPGQAPAGAKQLRSKEDGPFLPAGALNLPQSLRTTFEGVGPQGWKL
FT                   TAHGVWFARMEPAGARLYHAVIYSDKPRTDEANNFFASLQLQ"
FT   gene            442741..443280
FT                   /locus_tag="Daci_0407"
FT   CDS_pept        442741..443280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0407"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: ajs:Ajs_0295 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33053"
FT                   /db_xref="GOA:A9BPT4"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPT4"
FT                   /protein_id="ABX33053.1"
FT                   /translation="MERSAGAPVALHAPAHAIIDSEPCDFMTTRILLFTHAPLAHALRE
FT                   CALHVFADSAEDVLALDVPAQEPPEATLMRAEQLLEDHGGLVALPTLVLTDLFGATPCN
FT                   VAQRLVAQLPAGRLVAGVNLPMLLRSIGYRHEALEAVAERALAGGSHGVMQVGVNTPQN
FT                   QSPRPSNDQDPYNHQQ"
FT   gene            443249..443518
FT                   /locus_tag="Daci_0408"
FT   CDS_pept        443249..443518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0408"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: aav:Aave_0353
FT                   phosphotransferase system, phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33054"
FT                   /db_xref="GOA:A9BPT5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPT5"
FT                   /protein_id="ABX33054.1"
FT                   /translation="MIKTPITISNKLGLHARASAKLTKLAGSFPCEVWMSKGERRINAK
FT                   SIMGVMMLAAGMGSEVLLETEGPQEQEAMDALTALINDKFGEGQ"
FT   gene            443636..445411
FT                   /locus_tag="Daci_0409"
FT   CDS_pept        443636..445411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0409"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein; KEGG: aav:Aave_0354
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33055"
FT                   /db_xref="GOA:A9BPT6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPT6"
FT                   /protein_id="ABX33055.1"
FT                   /translation="MTFAIHGLAVSRGIAIGRAVVVASSRMEVVHYFIRPDQVDAEIDR
FT                   ARSARNAVIDELRRLQDEMPQDAPGELDALLDVHLLLLQDEALAAAIKHWISDRLYNAE
FT                   WALTTQLEVVSRQFDEMEDEYLRERKADLEQVVERILRYMKGMASPVPAPAALPRADAT
FT                   GEGAPQQPLLLDEVTDVPLVLVAQDLSPVDMLQFKSRLFAGFITAVGGRTSHTAIVARS
FT                   MDIPAVVGARAASQLIRQDDWIIIDGNAGVVIVDPSPIILAEYGFRQRQNELERERLSR
FT                   LRHTPALTLDGERIELLANIEQPGDGPAAVHAGAVGVGLFRTEFLFMGRGGNLPGEEEQ
FT                   YRAYREAVDGMQGMPVTIRTLDVGADKPLDKAQPKDYYLNPALGLRAIRWSLADPAMFR
FT                   TQLRAILRAAAHGQIHLLFPMLAHQSEIEQTLAQVRLAQSELDARGVAHGPVKLGAMIE
FT                   VPAAALIVRTFLRYFDFLSIGTNDLIQYTLAIDRADETVAHLYDPLHPAVLKLVADVIA
FT                   EGRAQGKSVCVCGETAGDVGMTRLLLGLGLRSFSMHPAQILVVKQEILRADTRKLTAWA
FT                   QEVLRSDSPAALLGP"
FT   gene            complement(445806..446786)
FT                   /locus_tag="Daci_0410"
FT   CDS_pept        complement(445806..446786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0410"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: aav:Aave_0362 lipoic acid synthetase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33056"
FT                   /db_xref="GOA:A9BPT7"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPT7"
FT                   /protein_id="ABX33056.1"
FT                   /translation="MTTNTVVREAQSQAEYNPLAKQKAAAKLSRIPIKVEHGEALKKPD
FT                   WIRVKAGSPTTRFYEIKDILRANKLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRC
FT                   PFCDVGHGRPDPLDTNEPLNLAKTIAELRLKYVVITSVDRDDLRDGGSGHFVECIKNIR
FT                   ELSPLTQIEILVPDFRGRDDRALEILKAAPPDVMNHNLETAPRLYKEARPGSDYQFSLN
FT                   LLKKFKALHPKVPTKSGIMVGLGETDEEILQVMRDMRAHDIDMLTIGQYLAPSNSHLPV
FT                   RRYVHPDTFKMFEEEAYKMGFTHAAVGAMVRSSYHADQQAHAAGV"
FT   gene            complement(446797..447522)
FT                   /locus_tag="Daci_0411"
FT   CDS_pept        complement(446797..447522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0411"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: aav:Aave_0363
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33057"
FT                   /db_xref="GOA:A9BPT8"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPT8"
FT                   /protein_id="ABX33057.1"
FT                   /translation="MSAPAAELAQTLDLRLLGRTDYEATVQAMQAFTSGRDAGTRDELW
FT                   ICEHAPHFTQGLAGKSDHLLNPGDIPVVATNRGGQVTYHGPGQVVAYPLLDLQRLGYFV
FT                   KEYVFRIEDAVIRTLEHFGITGHRVEGAPGIYVRLDDPRSHAMLAQRPQLRVPGSPAPQ
FT                   PDFSGLGKIAALGIKVSRHCTYHGVALNAAMDLEPYERINPCGYAGLQTVDLSTIGVQT
FT                   TWDEAARVLGRQLQRRLAP"
FT   gene            complement(447519..447836)
FT                   /locus_tag="Daci_0412"
FT   CDS_pept        complement(447519..447836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0412"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   aav:Aave_0364 protein of unknown function DUF493"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33058"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPT9"
FT                   /protein_id="ABX33058.1"
FT                   /translation="MTDAPTPSSAPAAAPGADPRKDSLIEYPSQFPIKVMGIKAEHLVH
FT                   EITQIAERFDPAFDPSTIELRPSSSGKYLGVTVTVTATSREQLDDLYQAFTSHPLVKVV
FT                   L"
FT   gene            448122..448604
FT                   /locus_tag="Daci_0413"
FT   CDS_pept        448122..448604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0413"
FT                   /product="putative ATP synthase protein I"
FT                   /note="KEGG: ajs:Ajs_0301 putative ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33059"
FT                   /db_xref="GOA:A9BPU0"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPU0"
FT                   /protein_id="ABX33059.1"
FT                   /translation="MKNYAADTDADRELEGEDSDFKPLTSEEAQEWRTRNPQMSVWRFV
FT                   VVQAVVGVLVALVAWLVTGRAEVGWSAAYGALSVVLPAALFARAVVRKRPGGAAAAMVG
FT                   IFGWELVKLVLCIAMLAAAPKLVPGLSWLALLAGLVIVMKTYWVALIVRANVRKTD"
FT   gene            448626..449489
FT                   /locus_tag="Daci_0414"
FT   CDS_pept        448626..449489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0414"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   ajs:Ajs_0302 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33060"
FT                   /db_xref="GOA:A9BPU1"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPU1"
FT                   /protein_id="ABX33060.1"
FT                   /translation="MAADAHAPTASEYIVHHLQHLQNIKQKSIIDFSVINLDSIVVSAT
FT                   LGVLSLFVLWLAARKATSGVPGRFQAAVELLVEMVDNQAKANIHNAQSRKFIAPLALTV
FT                   FVWIFMMNAMDMLPVDLLPVLWQGVQGDSHAYLRVVPTADLSTTLGLSSAVLILCFFYS
FT                   IKIKGMGGWAHELVTAPFGTSKNPVFALILGVINLAMQIIEYVAKTVSHGMRLFGNMYA
FT                   GELVFCLIALMGGAAAMSLSGVLLPLGHIIAGSIWAIFHILIITLQAFIFMMLTLIYLG
FT                   QAHEAH"
FT   gene            449541..449789
FT                   /locus_tag="Daci_0415"
FT   CDS_pept        449541..449789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0415"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   ajs:Ajs_0303 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33061"
FT                   /db_xref="GOA:A9BPU2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPU2"
FT                   /protein_id="ABX33061.1"
FT                   /translation="MENILGLVALACGLIVGLGAIGASIGIALMGGKFLESSARQPELI
FT                   NELQTKMFILAGLIDAAFLIGVAIALLFAFANPFVLA"
FT   gene            449825..450295
FT                   /locus_tag="Daci_0416"
FT   CDS_pept        449825..450295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0416"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   aav:Aave_0368 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33062"
FT                   /db_xref="GOA:A9BPU3"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPU3"
FT                   /protein_id="ABX33062.1"
FT                   /translation="MSINATLFVQAIVFLILVLFTMKFVWPPIAKALDERALKIADGLA
FT                   AADKAKTDLAAANKRVEQELAQTRNETASRLADAERRAQAIIEEAKARASEEGNKIVAA
FT                   ARAEAEQQTVQAREALREQVAALAVKGAEQILRKEVDAGVHADLLNRLKTEL"
FT   gene            450308..450847
FT                   /locus_tag="Daci_0417"
FT   CDS_pept        450308..450847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0417"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: aav:Aave_0369 ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33063"
FT                   /db_xref="GOA:A9BPU4"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPU4"
FT                   /protein_id="ABX33063.1"
FT                   /translation="MAELATIARPYADALFKASTQQGADLSGTVAWAEELAAIAANPQL
FT                   RQLADDPKVTDEQLFDVISGVAGSALPDAARNFLRVIIENGRLQALPEVAAQFRSLVNR
FT                   AGGSSDAVVQSAFPIDAAALAALGTSLEKRFGRKLNLSVQQDQSLIGGIRVVVGDEVLD
FT                   TSVKARLEQMKAALIA"
FT   gene            450896..452449
FT                   /locus_tag="Daci_0418"
FT   CDS_pept        450896..452449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0418"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: ajs:Ajs_0306 ATP synthase F1, alpha subunit;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; ATP synthase F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33064"
FT                   /db_xref="GOA:A9BPU5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPU5"
FT                   /protein_id="ABX33064.1"
FT                   /translation="MQLNPAEISELIKSRIEGLAGSSDIRNEGTVVSVTDGIVRVHGLS
FT                   DVMQGEMLEFPAGKDGQPSFGLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPV
FT                   GPELIGRVVNALGQPIDGKGPINAKMTDVIEKVAPGVIARQSVDQPLQTGIKSIDSMVP
FT                   VGRGQRELIIGDRQTGKTAVAIDAIINQKGQGVTCIYVAIGQKASSIKNVVRALEQAGA
FT                   MEYTIVVAATASESAAMQYVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLL
FT                   LRRPPGREAFPGDVFYLHSRLLERAARVNADYVEAFTKGEVKGKTGSLTALPIIETQAG
FT                   DVSAFVPTNVISITDGQIFLETSLFNAGIRPAINAGISVSRVGGAAQTKLVKGQSGGIR
FT                   TDLAQYRELAAFAQFASDLDEATRKQLDRGARVTELLKQAQYSPLSTALMGASLFAVNK
FT                   GYMDDIQVKQVLAFESGLHQFLKTSHGALIDKLNASKAMDKDSEAELNAAIAAFKKSFA
FT                   "
FT   gene            452468..453340
FT                   /locus_tag="Daci_0419"
FT   CDS_pept        452468..453340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0419"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: ajs:Ajs_0307 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33065"
FT                   /db_xref="GOA:A9BPU6"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPU6"
FT                   /protein_id="ABX33065.1"
FT                   /translation="MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQERMLAARPY
FT                   SEKIRNIAVHLGQANPEYVHPFMQVNGDAKTAGVIVVTTDKGLCGGMNTNVLRAVTAKL
FT                   RELQDQGVSAEAVAIGNKGLGFLNRVGAKVVSHATGLGDTPHLEKLIGPVKVLLDAYAA
FT                   GKLSAVYLSYTKFINTMKQESVVEQLLPLSSESMQAEKTSGHSWDYIYEPDAQSVIDEL
FT                   LVRYAESLVYQAVAENMASEQSARMVAMKAATDNAGNVISELKLVYNKTRQAAITTELS
FT                   EIVAGAAAV"
FT   gene            453375..454784
FT                   /locus_tag="Daci_0420"
FT   CDS_pept        453375..454784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0420"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: ajs:Ajs_0308 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33066"
FT                   /db_xref="GOA:A9BPU7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPU7"
FT                   /protein_id="ABX33066.1"
FT                   /translation="MAQVQGKIVQCIGAVVDVEFPRNAMPKVFDALKLDGSALTLEVQQ
FT                   LLGDGVVRTIALGSSDGLRRGLMVSNTGNPITVPVGKATLGRIMDVLGNPIDERGPVDQ
FT                   ALTAPIHRKAPAYDELSPSQELLETGIKVIDLISPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   INNIAKGHGGLSVFAGVGERTREGNDFYHEMSDAGVVNQESLNDSKVAMVYGQMNEPPG
FT                   NRLRVALTGLTMAEAFRDEGKDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAE
FT                   EMGRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRDIASLGIYP
FT                   AVDPLDSTSRQLDPQVVGEEHYKVAREVQGTLQRYKELRDIIAILGMDELAPEDKLTVA
FT                   RARKIQRFLSQPFHVAEVFTGAPGKYVSLAETIRGFKMICAGECDHLPEQAFYMVGTID
FT                   EAFEKAKKLAA"
FT   gene            454945..455361
FT                   /locus_tag="Daci_0421"
FT   CDS_pept        454945..455361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0421"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: ajs:Ajs_0309 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33067"
FT                   /db_xref="GOA:A9BPU8"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPU8"
FT                   /protein_id="ABX33067.1"
FT                   /translation="MNTIHVDVVSAEESIFSGEARFVALPGESGELGIFPRHTPLITRI
FT                   KPGSVRIEMADGSEEFVFVAGGILEVQPNCVTVLSDTAIRGADLDAEKAEKAKLEAEEA
FT                   LKNAKSEVDLARAQSELAVMAAQIAALRKFRQKR"
FT   gene            complement(455427..455687)
FT                   /locus_tag="Daci_0422"
FT   CDS_pept        complement(455427..455687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33068"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPU9"
FT                   /protein_id="ABX33068.1"
FT                   /translation="MKNTLARLGLLAAVLTLSACASPILDDSQEYDYVLSCKLREDDPK
FT                   RCEQQIRALCPVPAKAVTHKSRTVDPKDNAVTYVYQARCGD"
FT   gene            complement(455796..456338)
FT                   /locus_tag="Daci_0423"
FT   CDS_pept        complement(455796..456338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0423"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   aav:Aave_0379 protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33069"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPV0"
FT                   /protein_id="ABX33069.1"
FT                   /translation="MAAAITGFVQRLLRLLRHHWAEGQLRRALPPESLAELERLITMSE
FT                   QRHTGQIRICVEPGLPPSYLWRDATPRERAITLFGKLRVWDTEHNNGALIYLLLADHAI
FT                   EIVADRALARTLPAEQWQTLISDMGAAFQGGHYAMGMTAALERVSLLLETNFPRDPLQP
FT                   VHDGSDNLPDAVVIQHH"
FT   gene            complement(456340..457212)
FT                   /locus_tag="Daci_0424"
FT   CDS_pept        complement(456340..457212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0424"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   ajs:Ajs_0315 protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33070"
FT                   /db_xref="GOA:A9BPV1"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPV1"
FT                   /protein_id="ABX33070.1"
FT                   /translation="MLCALVLTMLLLPGSTLAQAPQPVPALSARLIDQTGTLSADEARA
FT                   IEDRLRGIEQKSGSQVVVLMVATTAPEDIAAYTWRVASDWKIGRRDVGDGLLVVIAKND
FT                   RRMRMEVARALEGAIPDLAAARIIDQQMAPRFRQGDYAGGITAALDQVAARIAGEQLPA
FT                   PSSSPQSSKSPDRGFDMEDLMLFFFFGVAVVGPILRSVLGRPLASVLAGAGAGIAAYVV
FT                   TASLLVAAGAGVVALLFTLLGSGRSGRGGGGGWGGGGGFGGGGGRSGGGGFSSGRGGSF
FT                   GGGGASGSW"
FT   gene            complement(457246..457833)
FT                   /locus_tag="Daci_0425"
FT   CDS_pept        complement(457246..457833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0425"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: aav:Aave_0381 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33071"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPV2"
FT                   /protein_id="ABX33071.1"
FT                   /translation="MKRLLATLATVLALTGCGYNDFQRLDEQTKSAWSEVLNQYQRRAD
FT                   LVPNIVASVKGEANFEQETLTKVVEARAKATSIQATPELVNNPEAFNKFQQAQGELSSA
FT                   LSRLMVVAERYPQLQANQGFRDLRVTLEGTENRITVARNQYIQAVQSYNVLARSFPTNL
FT                   TAKVFSYEPKPSFSVQNEAEISRPPTVDFGNK"
FT   gene            457982..458968
FT                   /locus_tag="Daci_0426"
FT   CDS_pept        457982..458968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0426"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="KEGG: aav:Aave_0383 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33072"
FT                   /db_xref="GOA:A9BPV3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPV3"
FT                   /protein_id="ABX33072.1"
FT                   /translation="MHEFTAARWLPGGHAQTIWPALFARRWPVGQAAPAWRWERWDTPD
FT                   GDFIDVAFGGAPTPPVDAPWLVLFHGLEGSANSHYAQAMAWVAAQRGWHMAVPHFRGCS
FT                   GEVNRGPRAYHSGDVQEVDWILRRLRARSSRPLHVVGVSLGGNALARWAGLQADKAAEV
FT                   VQALAAVSAPLDLAAGGMALGQGLNRWIYTRMFLRTLVPKARVKWAQFPGLFDRDAAVR
FT                   ARDLKEFDDAFTAPVHGFLDAHDYWRRAAAKPVLGSIAVPALLLNALDDPFVPACSLPG
FT                   PGEVGPRVTLWQPPHGGHVGFAQGHWPGHVLGMPQAVTQWLADSEQG"
FT   gene            458974..459525
FT                   /locus_tag="Daci_0427"
FT   CDS_pept        458974..459525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_0262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33073"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPV4"
FT                   /protein_id="ABX33073.1"
FT                   /translation="MDDIVKQAMAKWPHVPACSGWLGLDERGRWYLRDEEAQACGAFDS
FT                   GIPGAKGAEVRNEKLADFIARNYLAEPDGRWFFQNGPQRVYVELESTPWIWRLRWDGER
FT                   LQMHSHTGAELQAADIKEVLMDETGRLYLAMPSGLGLVHTQDMVDAAAALDAGMLPACE
FT                   EVPAQTLPQRYGFVRSPARA"
FT   gene            complement(459805..460050)
FT                   /locus_tag="Daci_0428"
FT   CDS_pept        complement(459805..460050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33074"
FT                   /db_xref="InterPro:IPR018733"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPV5"
FT                   /protein_id="ABX33074.1"
FT                   /translation="MSTARKLRLGPLPSSGSTKLTFTCPASLKADLDAYAALHAQTYGE
FT                   AVDATTLIPHMLETFMAGDRGFRKGSRGKAAPPKSG"
FT   gene            complement(460047..461321)
FT                   /locus_tag="Daci_0429"
FT   CDS_pept        complement(460047..461321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0429"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   rme:Rmet_1559 conjugation TrbI-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33075"
FT                   /db_xref="GOA:A9BPV6"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPV6"
FT                   /protein_id="ABX33075.1"
FT                   /translation="MSQDDTPDLTTPQAGKVAPEAVALRAQPCPVTRLNRRTLAVLVGG
FT                   LSVAVLGATIWSLQPHRRGTGEQTELYNVDRVSKSEGLDGLPSDYSKLRKVPELGPPLP
FT                   GDLGPAIVASQQPAVAAYAAPGHDPNDALRKEAEAAAASSVFFRSGGQGQGQAATVAQA
FT                   APGAPGAASALAAFDPLAAGPASTAAQPADPTATQNRQDQKEAFLKGGSTETRNSGNLA
FT                   LPASPYQVMAGTVIAGALVTGIKSDLPGDVIATVTEPVYDTATGKFLLIPQGSRILGRY
FT                   NSQVSYGQSRVQVVWNRVILPDTSSLTLDNLVGTDPAGYAGLEDDVDWHWNRVFAGAVL
FT                   TTLLGVGAELAAPENRQDGNRIVIAGRDSAQDSINQVGQEITRRNMNIQPTLTARPGLP
FT                   VRVIVARDLVLRPYQPMFYQLGGAR"
FT   gene            complement(461324..462313)
FT                   /locus_tag="Daci_0430"
FT   CDS_pept        complement(461324..462313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0430"
FT                   /product="P-type conjugative transfer protein TrbG"
FT                   /note="TIGRFAM: P-type conjugative transfer protein TrbG;
FT                   PFAM: Conjugal transfer protein TrbG/VirB9/CagX; KEGG:
FT                   pau:PA14_30860 TrbG-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33076"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPV7"
FT                   /protein_id="ABX33076.1"
FT                   /translation="MNPSFRTYVSVLALAALAGCATQGKPPPTISLDEPVQAQPLPEPP
FT                   APVEAVAVPEVLPMPAQLKPAPEGEEAKPAPEPVDEKVRVSRANTEARVAPTREGYVNA
FT                   IQVWPFTDGALYQVYAAVGRVTVIALQPGEELVTVAAGDTVRWIVGDTSSGSGDALRVN
FT                   VMVKPIRSGLKTNLVVTTSRRTYLLELTSTEKTWMASISWEYPKDKMLALQRQAQAASA
FT                   AAPVETGLSLEKIRFRYAISGSNPPWKPLRAFDDGEKVYIQFPAGIAQGELPPLFVIGA
FT                   QGDGQLVNYRFRSPYFIVDRLFGAAELRLGGDKGDVVRIERTDGTRGN"
FT   gene            complement(462310..463014)
FT                   /locus_tag="Daci_0431"
FT   CDS_pept        complement(462310..463014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0431"
FT                   /product="Conjugal transfer protein"
FT                   /note="PFAM: Conjugal transfer protein; KEGG: ajs:Ajs_2904
FT                   conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33077"
FT                   /db_xref="GOA:A9BPV8"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPV8"
FT                   /protein_id="ABX33077.1"
FT                   /translation="MRFKRPQVRYADTPQPATPYQSAAQVWDERIGSARVQAKNWRFMA
FT                   FGCLTLAVLMAGGLVWRSAQSIVTPYVIEVDNAGQVRAVGEAATPYRPSDAQIAYHLGR
FT                   FIGLVRSLSIDPIVVRQNWLDAYDYTTDKGAVVLNEYARVNDPFARIGKESVTVQITSV
FT                   TRASDASFNVRWTEQRFVNGAPAGTERWNAVISIVQQTPRTEQRLRKNPLGIYVNGLSW
FT                   SRELDSSEGAKP"
FT   gene            complement(463033..464406)
FT                   /locus_tag="Daci_0432"
FT   CDS_pept        complement(463033..464406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0432"
FT                   /product="P-type conjugative transfer protein TrbL"
FT                   /note="TIGRFAM: P-type conjugative transfer protein TrbL;
FT                   PFAM: TrbL/VirB6 plasmid conjugal transfer protein; KEGG:
FT                   pap:PSPA7_3700 conjugal transfer protein TrbL"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33078"
FT                   /db_xref="GOA:A9BPV9"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPV9"
FT                   /protein_id="ABX33078.1"
FT                   /translation="MNDVTIIDRFLDTFSRYIDSGFGLLHGEVAFLTATLIVIDMTIAG
FT                   LFWAMGHAVGQGEDVIAKLIRKVLYVGAFAYIIGNFNTLAGILFRSFAGLGLTASGSTL
FT                   SMENFLHPGRLAKVGIDAGAPILEQIGNMAGFPEVFVNITPIVVMFLAWLIVILCFFVL
FT                   AIQLFITLIEFKLTTLAGFVLVPFALWNKTAFLAEKVLGNVVSSGIKVLVLAVIVGIGS
FT                   GLFAEFQVHPAEPSIDHSVVVMLASLTLLALGIFGPGIATGLVSGGPQLGAGAMAGAAL
FT                   GAAGAAVAVGAAATGVGGAVAAGARMAPAAAKLAGSGARAAAGAASSARSAFQAGSASA
FT                   GGGLKGAAAGFGNVAKTGAQAAGQKVADGARSMKERAAAAFRQEGTTSAGGGTAAASGG
FT                   PASGGDTPSTAPQEQPAWAKRLHRRQQLTHAATTAAHTLRGGDGGSSSQGPSLRDSDS"
FT   gene            complement(464403..464702)
FT                   /locus_tag="Daci_0433"
FT   CDS_pept        complement(464403..464702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0433"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: ajs:Ajs_2906 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33079"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPW0"
FT                   /protein_id="ABX33079.1"
FT                   /translation="MKYAPVVFALAFLLSGCDQPLSVASLAADPSRLHTLRAQCRTGAH
FT                   DGAFCAQVAQADLRRFLSGQTGPSEYQTLADLPPIPPSFDEPADADAPGQEDSP"
FT   gene            complement(464715..465440)
FT                   /locus_tag="Daci_0434"
FT   CDS_pept        complement(464715..465440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0434"
FT                   /product="P-type conjugative transfer protein TrbJ"
FT                   /note="TIGRFAM: P-type conjugative transfer protein TrbJ;
FT                   KEGG: pau:PA14_30900 TrbJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33080"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="InterPro:IPR025415"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPW1"
FT                   /protein_id="ABX33080.1"
FT                   /translation="MKKRLVAAAIAAMLCTATAHAQWVVVDPTNLVQNTLTAIRTLEQI
FT                   NNQIQQLQNEAQMLMNQARNLASLPSSVVGQLRANLATTQRLIDQARGLAYDVTNLDRE
FT                   FQRLYPEQYAATVSGDQMYRDTQERWKNTLNGLQTTMRMQAQVSQNLGEDESVLADLVG
FT                   KSQSAEGALQAMQAMNQLLALQAKQSIQSQRLQITQDRAAALELARQAAATERGREMTR
FT                   RFLGSGTPYTPQAVDFYNH"
FT   gene            complement(465437..467890)
FT                   /locus_tag="Daci_0435"
FT   CDS_pept        complement(465437..467890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0435"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: pap:PSPA7_3703 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33081"
FT                   /db_xref="GOA:A9BPW2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPW2"
FT                   /protein_id="ABX33081.1"
FT                   /translation="MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGP
FT                   DLDSATQGELIATSARLNNALRRMGSGWALFIEAERRPAADYPHSEFPEPLSWVVEEER
FT                   RAAFEESGHHFESGYHLTLLYLPPEESRARAAKMLYENTPTNGVDWRERLQAFVAETDR
FT                   VFDLLDGVMPEIVWLDDSQTLTYLHTTISTRRYRVGVPEVPFHIDALLTDSPLVGGLAP
FT                   MLGDQHLRVVSVRGFPTSTWPGILDDLNRLGFAYRWSTRFLCLDKSEAEKELTRLRRQW
FT                   FAKRKNVIALLRETIFQQESPLVDTDASNKATDADAALQELGSDQVAFGYLTATVTVLD
FT                   ADPAVADEKLRMVERVIQGRGFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAH
FT                   MMPVSAVWAGPEKNDHLDGPPLIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLL
FT                   ATLAMQFRRYRGSRIFAFDMGRSMRATILGLGGEHYDLGTDGEIAFQPLARIDREGYRT
FT                   WAAEWVEGRLLHEGVAVGPDEKAAIWSALGSLAGAPVEQRTMTGLSVLLQSNALRQALA
FT                   PYVLGGAHGKLLDADHDRLGMADVQCFEMEELMHSKAAVMAVLHYLFARFDERFDGSPT
FT                   LLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCAS
FT                   RIFLPNPQATEPQIRTIYEGFGLNSRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGPAA
FT                   LAFAGASTPQDQRDIDRVLLDAGVPGFAGAWLRHRGLDWAADLLPSFPGLAPGSLADQP
FT                   LENLS"
FT   gene            complement(467906..468178)
FT                   /locus_tag="Daci_0436"
FT   CDS_pept        complement(467906..468178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0436"
FT                   /product="putative conjugal transfer TrbD transmembrane
FT                   protein"
FT                   /note="KEGG: rme:Rmet_1552 putative conjugal transfer TrbD
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33082"
FT                   /db_xref="GOA:A9BPW3"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPW3"
FT                   /protein_id="ABX33082.1"
FT                   /translation="MSAPDTFADGFEVPLHRSLTEPILLGGAPRTVAIANGTLAAAVGL
FT                   GLQLWIPGVVLWIVGHSLAVWGARVDPQFMQVFARHIKHRPLLDV"
FT   gene            complement(468175..468558)
FT                   /locus_tag="Daci_0437"
FT   CDS_pept        complement(468175..468558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0437"
FT                   /product="Conjugal transfer protein TrbC"
FT                   /note="PFAM: Conjugal transfer protein TrbC; KEGG:
FT                   rme:Rmet_1551 conjugal transfer protein TrbC"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33083"
FT                   /db_xref="GOA:A9BPW4"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPW4"
FT                   /protein_id="ABX33083.1"
FT                   /translation="MTQMTIPAFRFSANPALRLARLRCLARPAGQGLLLAALLLFLAGA
FT                   AQAAGSSMPWEGPLQSILESIQGPVARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFG
FT                   LSIAFAASSFFLSFFSFSGGAVV"
FT   gene            complement(468555..469616)
FT                   /locus_tag="Daci_0438"
FT   CDS_pept        complement(468555..469616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0438"
FT                   /product="P-type conjugative transfer ATPase TrbB"
FT                   /note="TIGRFAM: P-type conjugative transfer ATPase TrbB;
FT                   PFAM: type II secretion system protein E; KEGG:
FT                   rme:Rmet_1550 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33084"
FT                   /db_xref="GOA:A9BPW5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPW5"
FT                   /protein_id="ABX33084.1"
FT                   /translation="MSAAPSSLTTSLDRRIQMLRTAMGPLIAAALEDPDVVEVMLNPDR
FT                   TLWVDRLSSGRAPMGAELPETDGERIIRLVAAHVGAEVHRGQPLLSAELPETGERFEGI
FT                   LPPAAPGPAFALRKRAIGVIPLSRYIEDGMMTAEQAGFLVRAVRERQNVLIAGATSSGK
FT                   TTLANALLAEIAATGDRVLVLEDTIELQCAARDHVPLRTRAGVVSMTELVRSSMRLRPD
FT                   RVVVGEVRGAEALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVNPPRALIA
FT                   EAVNVVIHIAGRGRKRRIESIARVVGFDGVGYRLADWEADALDTPFPELSPNPDAVPAA
FT                   ATSSSLDSLGELP"
FT   gene            complement(469613..470077)
FT                   /locus_tag="Daci_0439"
FT   CDS_pept        complement(469613..470077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0439"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: pau:PA14_30950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33085"
FT                   /db_xref="GOA:A9BPW6"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPW6"
FT                   /protein_id="ABX33085.1"
FT                   /translation="MSHYRLNLFIQPEHAKRLDELAAKKGVSKSSIVAAALASWLSPDA
FT                   ADQREAAIAKRLDRLSRQADRMERDQNIAIETLALFIRYYLTVSTPVPEAHQDAARAQG
FT                   KARFEQFTEQLGRHLLRGRSLVRDVVEELHPDPMRMEDAAAAAQAQERAS"
FT   gene            complement(470074..472095)
FT                   /locus_tag="Daci_0440"
FT   CDS_pept        complement(470074..472095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0440"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; KEGG: rme:Rmet_1548 TraG
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33086"
FT                   /db_xref="GOA:A9BPW7"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPW7"
FT                   /protein_id="ABX33086.1"
FT                   /translation="MQGTNVLFGQIAVVFGIVIAGVWSATQWTAAALGYQLRLGSPWFD
FT                   LLGTPIYHPWKLFEWWFFFDAYAPRVFDTGGAIAGGSGLLAVVVAIGMSIWRSRQSRLV
FT                   TTYGSARWANADDIRKAGLTQPAGVFLGQHDRQYLRHEGPEHVLTFAPTRSGKGVGLVV
FT                   PTLLSWPASAVIHDIKGENWQITAGWRSRFSHCLLFNPTDAKSAAYNPLLEVRRGAHEV
FT                   RDVQNIADILVDPEGALEKRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPAS
FT                   PFELTLHRMMTTPHLVNEEGGGPHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDP
FT                   TVAEVTSRCDWRIADLIAAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGS
FT                   DGIQRRHKLLLMLDEFPALGRLDFFETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSI
FT                   LDNCHVRVTFATNDERTAKRISETLGTATELRAQRNYAGHRLAPWLGHLMVSRQETARP
FT                   LLTPGEVMQLPPDEAVVMVSSVAPIKAKKLRYYADANFKRRVLPPPALADGQYADAPPL
FT                   RPDDWSGLAIPSVPAALAAASADGLENLGSADDGGPRRQPELSETVAYDSELAAPTADL
FT                   ALLDDDDDLPLPLPRQLDPAMQRSARLASLDPNDGIEL"
FT   gene            complement(472313..472531)
FT                   /locus_tag="Daci_0441"
FT   CDS_pept        complement(472313..472531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33087"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPW8"
FT                   /protein_id="ABX33087.1"
FT                   /translation="MILLILVTALPACGPSQPSETVDALVANPERIKEIQRQCKEDRAK
FT                   VGDELCLRAAEAAKRRFFGDRPEQKSK"
FT   gene            complement(472554..473480)
FT                   /locus_tag="Daci_0442"
FT   CDS_pept        complement(472554..473480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0442"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: shn:Shewana3_1278 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33088"
FT                   /db_xref="GOA:A9BPW9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPW9"
FT                   /protein_id="ABX33088.1"
FT                   /translation="MELRHLRCFLAVAEELHFARAAERLHIDQSPLSRTIKELEEELGA
FT                   RLFVRTTRSTQLTRAGRLFLEHVQRVFTVLEQARDSVKSAANGFCGQLRIALSDGVTPS
FT                   RLPALLARSREEDPEVEIRLFEVPLDQQIKGLHSDLYDAGFSMAEDAGDGIIVTPAWED
FT                   ELMVAVPARHPVLAFKQIPLKEVLRHPLALGDPAVCEGHARQVDRFLRTCGQEPLIAQR
FT                   VATFDVMMTLVSAGLALGLAGEAHIASSREPGVVARRLAGKPTMLMTYLLRRDTEPSEM
FT                   LARFIERVDFIDSADELGIPEDLPRDR"
FT   gene            complement(473628..473867)
FT                   /locus_tag="Daci_0443"
FT   CDS_pept        complement(473628..473867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_2717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33089"
FT                   /db_xref="GOA:A9BPX0"
FT                   /db_xref="InterPro:IPR021604"
FT                   /db_xref="InterPro:IPR038644"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPX0"
FT                   /protein_id="ABX33089.1"
FT                   /translation="MPAFAGHAAAQAAKEMVPLADGGTLYVFKDGKMAQESRFGRAVYQ
FT                   SIGASVATKDGRNIAITSNEVARLSSLLEQEHGG"
FT   gene            complement(474041..474967)
FT                   /locus_tag="Daci_0444"
FT   CDS_pept        complement(474041..474967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0444"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   rso:RSp0659 probable copper resistance D transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33090"
FT                   /db_xref="GOA:A9BPX1"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPX1"
FT                   /protein_id="ABX33090.1"
FT                   /translation="MAGDWLTIVLRLALYLDLAAAFGVAMFGLYALGNDERSSTISRRY
FT                   RVLIGASAAIGIVLSMWGMTVMAKAMSGAQSYAELSTHVFDMLITGTHMGIAWCIRILA
FT                   LVTCVLIAVLRMNSTLRFAAMAASSGVALATLAWAGHGAMDDGVRGYIHLASDITHLWA
FT                   AGAWVGALIAFLVLAANKPNTGQGSVEILSRTSNGFARIGTVIVAALVVTGALNYLLIA
FT                   GPSLDPLFSTLYGRLLVGKLLLFGGMLALAAANRFRLSPSLEAALRTGNHAHAVVKLRQ
FT                   SLFTEATLAVLVLASVAWLGILSPNGT"
FT   gene            complement(474972..475358)
FT                   /locus_tag="Daci_0445"
FT   CDS_pept        complement(474972..475358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0445"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   rme:Rmet_6114 copper resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33091"
FT                   /db_xref="GOA:A9BPX2"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPX2"
FT                   /protein_id="ABX33091.1"
FT                   /translation="MTRSHFIAKLVAPIAAGLFATAAFAHPSLVSSTPADKSQVSAPAT
FT                   IELKFSETLVPQFSAASLVMTGMPGMASHGPMKINASVAGAGDGKTMVITPAQALQPGD
FT                   YRVEWRAVSSDTHPITGNVTFKVK"
FT   gene            complement(475500..477980)
FT                   /locus_tag="Daci_0446"
FT   CDS_pept        complement(475500..477980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0446"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: neu:NE1216 haloacid dehalogenase/epoxide
FT                   hydrolase family:E1-E2 ATPase; TIGRFAM: ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC;
FT                   copper-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; YHS domain protein; E1-E2
FT                   ATPase-associated domain protein; SMART: TRASH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33092"
FT                   /db_xref="GOA:A9BPX3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPX3"
FT                   /protein_id="ABX33092.1"
FT                   /translation="MNSPSKSSGHEHAGMAAGATTSGPHTHHHHASHAGSDDAGGSSSH
FT                   SQPDAATRDPVCGMAVTAASEHRSTHLGNTYLFCSTGCKAKFDTDPARYASGGAGIGTG
FT                   SGHAPHHHASTAVSPAPAASPTAPGTIYTCPMHPEIRQDHPGTCPKCGMTLEPLLPDLD
FT                   DDNPELRDFSRRFWWTLPLTLVVLALAMLGERLHLMDMATQSWVELVLSLPIVLWAGWP
FT                   FFSRGWLSVVNRSPNMWTLIGLGTGAAFIYSVVATVAPEVFPASFMSMGRVGVYFEAAA
FT                   VIISLTLLGQVLELKARSQTSAAIKSLLGLAPKTARRINADGSEEDVPLSHVHVGDLLR
FT                   IRPGEKVPVDGIVHEGSSSIDESMLTGEPLPVSKRAGDKVIGATLNTNGALVMRSERIG
FT                   SDTVLSQIVQMVAQAQRSKAPMQRMADVVAGYFVMAVVAIAVTTLFVWGFFGPQPTWVY
FT                   GLINAVAVLIIACPCALGLATPMSIMVATGRGATQGVLFRDAAAIENLRKVDTLVIDKT
FT                   GTLTEGRPAFDQVVAARGFTNDEVLRLAASLDQGSEHPLADAIVQAARAQGLQLVKPQS
FT                   FESGTGIGVRGKVEHRQLALGNTVLMEQSGVSVEPLVPQAETLRGEGASVMYLAVDGQL
FT                   AGLLAVSDPVKGSTPEALAALKAAGLRVIMATGDGQTTAKAVGARLGIDEVHGEVKPAD
FT                   KLMLIERLQKEGRIVAMAGDGINDAPALAKADVGIAMGTGTDVAMNSAQVTLVKGDLRG
FT                   IAVARTLSVSTVGNMKQNLMFAFLYNALGIPIAAGVLYPLTGWLLSPLIAALAMSLSSA
FT                   SVVGNALRLRASRL"
FT   gene            complement(478093..478365)
FT                   /locus_tag="Daci_0447"
FT   CDS_pept        complement(478093..478365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33093"
FT                   /db_xref="GOA:A9BPX4"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPX4"
FT                   /protein_id="ABX33093.1"
FT                   /translation="MQHQHTQTPSDRPRFWRSRYGVAFLIIAAVAAYFLLKEHTAHVAG
FT                   YLPFLLLAACPLMHLFMHRGHGHGGHDHAARQGEEGAAPAKEQKQ"
FT   gene            complement(478399..478884)
FT                   /locus_tag="Daci_0448"
FT   CDS_pept        complement(478399..478884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0448"
FT                   /product="protein of unknown function DUF411"
FT                   /note="PFAM: protein of unknown function DUF411; KEGG:
FT                   pna:Pnap_1259 protein of unknown function DUF411"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33094"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPX5"
FT                   /protein_id="ABX33094.1"
FT                   /translation="MNMHYDRSQGKVPRRQALIAGLLVMALAGPSLAQSRPIAKVWKDP
FT                   SCGCCKDWVSHLQGAGFDVQVLDTGNTAARTRLGIPQKYGSCHTAQIGGYAIEGHVPAS
FT                   DIQRLLREAPQAIGLAAPGMPVGSPGMDGPAYGGRKDAYDVLLIGKNGSSTVYQSHR"
FT   gene            complement(478922..479902)
FT                   /locus_tag="Daci_0449"
FT   CDS_pept        complement(478922..479902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0449"
FT                   /product="copper resistance B precursor"
FT                   /note="PFAM: copper resistance B precursor; KEGG:
FT                   ajs:Ajs_1234 copper resistance B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33095"
FT                   /db_xref="GOA:A9BPX6"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPX6"
FT                   /protein_id="ABX33095.1"
FT                   /translation="MSKALPTRALATTLLALVSVAAQAQAQNDHAAHGQADAQTAAPST
FT                   QTVAPAADPHAGHATSASGSTAAPAMDHGNMQMQGGSAPPDARDPHGYSNGLTLGSGDY
FT                   AVPGVPRLMLADEHRFFSLRGETLERRFTRKGDDSTAYNLQAWYGTTYNKAVVKAEGDI
FT                   AKGKLEKSRTELLWGHAVAPYWDTQLGVRVDNGKGPSRQWLAFGIQGLAPYWFELKATG
FT                   YVGSGGRTALRVEGSYELLLTQRLILEPRAELQFYGKDDPERGIGKGLAEASAGLRLRY
FT                   EFSRQFAPYIGVERAGSFGRTADYVRAEGGRAQQTRWVAGVRFWF"
FT   gene            complement(479928..481829)
FT                   /locus_tag="Daci_0450"
FT   CDS_pept        complement(479928..481829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0450"
FT                   /product="copper-resistance protein, CopA family"
FT                   /note="TIGRFAM: copper-resistance protein, CopA family;
FT                   PFAM: multicopper oxidase type 1; multicopper oxidase type
FT                   2; multicopper oxidase type 3; KEGG: ajs:Ajs_1235
FT                   copper-resistance protein, CopA family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33096"
FT                   /db_xref="GOA:A9BPX7"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="InterPro:IPR034284"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPX7"
FT                   /protein_id="ABX33096.1"
FT                   /translation="MPPRSPFVIAPPLGLSRRRFVQGLAAGGVLAGLSTPALRAFAQQG
FT                   SATRGAAPVLKGTEFDLVIAESPVNFTGKPGVATTINGSLPAPTLRWREGDTVTIRVTN
FT                   KLREATSIHWHGIILPYQMDGVPGISFNGIAPGETFTYRFKVQQSGSYWYHSHSGFQEL
FT                   TGMYGAIIIDPAGAETIRADRDHVLLFSDWTDEDPMRVFTKLKSQSGYYNYNQPTVFDF
FT                   FRDASRDGMAAAIDKRKMWNEMRMNPTDLADLSAATLTYLANGVTPAGNWTALFRPGER
FT                   VRLRMVNGAGNTFYDVRIPGLKLTVVHVDGVDMEPVTVDEFRFGPGETVDVIVQPRDDA
FT                   YTIFAQAMDRTGYARATLAVREGLQAPVPALDPVEWLTMNDMMGSMMGGMDHGGSGQAM
FT                   EMTGMTGMTGMTGMTGMGSGSMSGMDHGAMAGMNHGAMNHGGMAMDHSQHAAAAGGLAV
FT                   PSTTARHARTEYGASTDMRVDMARTNLDDPGIGLRNNGRRVLTLADLHTPSGPLDKRGP
FT                   GREVELHLTGNMERYAWSLDGLEFGKSTPVHFKHGERLRVILHNDTMMTHPMHLHGMWS
FT                   ELESPDGRFLARRHTLPVQPAQRISFLVTADALGRWAWHCHLMFHMDAGMFREVVVS"
FT   gene            482085..482777
FT                   /locus_tag="Daci_0451"
FT   CDS_pept        482085..482777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0451"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: ajs:Ajs_1236 two component heavy
FT                   metal response transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33097"
FT                   /db_xref="GOA:A9BPX8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPX8"
FT                   /protein_id="ABX33097.1"
FT                   /translation="MKLLVVEDENKTADYVRQGLMEAGFVVDLARNGLDGHHLAMSETY
FT                   DLVVLDVMLPDVDGWRIVRSLRDAGKQVPVLFLTARGSVDDRVKGLELGADDYLVKPFA
FT                   FSELLARVRTLLRRGSAPSQPDRIQVADLVLDLPRRRATRAGQRINLTSKEFALLELLA
FT                   RRQGEVLPRSLIASQVWDMNFDSDSNVIDVAIRRLRAKIDDAFNPKLIHTVRGMGYTLD
FT                   APDDDLAP"
FT   gene            482749..484182
FT                   /locus_tag="Daci_0452"
FT   CDS_pept        482749..484182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0452"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; KEGG: har:HEAR0537 sensory histidine kinase in
FT                   two-component regulatory system with CusR, regulation of
FT                   copper resistance, senses copper ions"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33098"
FT                   /db_xref="GOA:A9BPX9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPX9"
FT                   /protein_id="ABX33098.1"
FT                   /translation="MRLMMTSRHKPRRSRPASLALRVTALVGIATTLVFLAFNWVVVRS
FT                   LEHHFAQQDAHELDAVVTALAEPLRQIANDMDKDELRQHLANAVAGHHGMTYGVYDRPG
FT                   NTIYATPGPDLSKLASSKKLVNRITADDLTVWQENQRSYRGVALQLPADDSAAPGYRIV
FT                   AAMDIGFHLDFLAEFKRMLWWATCLVLCIALGVAWLAVQWGHLPIRKVNEEIRTIRSSK
FT                   LDVRLDPLDVPIELAELVVAFNDMLARIEEGFVRLSHFSADIAHELRTPVTNLITQSHV
FT                   ALGQPRSAEEYREILYSNLEEFDRMSRMIGDMLFLAQTENDPRNLRLGEIDLAELIRGL
FT                   FDYFEALAEDRNITLYAKGAAEPIRADREMLLRALNNLLSNAIRHTPYGSRITVALAQD
FT                   ERWTTISVENPGERISEADLPKLFDRFFRVDPARQRKNAGAGLGLAIVKSIAEAHGGHV
FT                   QATSSDTATKFDLTLPRIA"
FT   gene            complement(484259..486295)
FT                   /locus_tag="Daci_0453"
FT   CDS_pept        complement(484259..486295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33099"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPY0"
FT                   /protein_id="ABX33099.1"
FT                   /translation="MSTCFARPDTPELAGSPAMTNRRDDDFRIRPSAPKNRGQGFVSKV
FT                   LKQAGKASSGKSAVRRPGGSGKGAGIGQRPGSRLGRGHTAARFAGAKLTPMSRRVTIKT
FT                   LLVNQQRASPQSLAKHLRYIERDGAGRDGEPGQAYGPQTDAAGLDAFKERCADDRHHFR
FT                   FILLPEDGAELDDLRTYTRHLMGRMEADLGTRLEWVAVDHWNTDNPHTHLIVRGRDDTG
FT                   KDLIIAGDYIADGFRHRASELATEWLGPRTELEIQQTLQREVDQERWTSLDRTLKRELG
FT                   DDGLVHVERFNEPRLQRQRLLLIGRLQRLQRLGLADEMQPGTWAVHADAEKTLRALGER
FT                   GDIIRTMQRAMRGEPRELAVFEAGDDGRTILGRVAAKGLADELRDRGYLVIDGVDGKAH
FT                   YVALNTRDELANYPAGAVVEVKGSADVRAADKNIAALASDGLYRTDHHLAIAQGQAMPG
FT                   RDPQEVVAAHVRRLEALRRAGIVERVAEGLWKVPDDLPEQGRRYDAQRLGGVAVELKSH
FT                   LPIERQARVIGATWLDQQLIGGGSGLGDLGFGGEAKQAMQQRADFLAEQGLAERRGQRV
FT                   ILARNLLGTLRNRELAQAAKDIAGETGLEHRPVADGQRVAGIYRRSVMLASGRYAMLDD
FT                   GMGFSLVPWKPVIEQRLGQQLAATVRGGGVSWEIGRQKGMSII"
FT   gene            complement(486690..487277)
FT                   /locus_tag="Daci_0454"
FT   CDS_pept        complement(486690..487277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0454"
FT                   /product="putative conjugal transfer TRAF transmembrane
FT                   protein"
FT                   /note="KEGG: rme:Rmet_1258 putative conjugal transfer TRAF
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33100"
FT                   /db_xref="GOA:A9BR42"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR42"
FT                   /protein_id="ABX33100.1"
FT                   /translation="MTAVSTVGTAPRPRSRLRARIVLACLSACGLAALAWASFVHPLPR
FT                   IIYNPSDSVAVGWYRVEPLHQRTDSLHQPLSVGSIVLTTLPADTAALAAQRRYLPARVP
FT                   LLKRVGAVAPQTVCVFDALVWIDGVPVAAVLPADRLGRPLPSWRQCRQLRPGELFLLSV
FT                   TNPASFDSRYFGPVSASAVIGVAHPIWLESRP"
FT   gene            complement(487274..487831)
FT                   /locus_tag="Daci_0455"
FT   CDS_pept        complement(487274..487831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33101"
FT                   /db_xref="InterPro:IPR021263"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR43"
FT                   /protein_id="ABX33101.1"
FT                   /translation="MTASASSAPAPVAFAATAAPSPPLLAHATGPTSTPLTRVSLAFLE
FT                   HRFKLYLRFGEPARTLRLDRWRSLAVFMPNAMFCRIRWQSTDYGTVRWQLMVMQACTPL
FT                   DAAQRIPGVQPGARLLLHTEGENQVRAVLERIDAIEALGIAPSAASPAYWRTLANRLAA
FT                   RLPLPEYTAERHAGWLIGRALP"
FT   gene            complement(487828..488103)
FT                   /locus_tag="Daci_0456"
FT   CDS_pept        complement(487828..488103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_0688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33102"
FT                   /db_xref="GOA:A9BR44"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR44"
FT                   /protein_id="ABX33102.1"
FT                   /translation="MSSPASKRTTKRVGIGARPPANPHAEAWIRQGDADALGKGDLYTA
FT                   RLTLDITPAMRARIKVSAFTQGVTVAELLRGLLEREFPEQRRENTP"
FT   gene            complement(488100..488738)
FT                   /locus_tag="Daci_0457"
FT   CDS_pept        complement(488100..488738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0457"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   rme:Rmet_3023 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33103"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR45"
FT                   /protein_id="ABX33103.1"
FT                   /translation="MIVALLNQKGGVGKTTLATHIAGELAMRGQHVVLLDADPQGSALD
FT                   WTQRRSQQGLPRLFSAVGLARETLHQEAPELARRADHVVIDGPPRIAALARSSLLAAER
FT                   VLIPVQPSPYDLWASAEMVALIREAQVFRPALRAAFVINRRVSTTVIGREARGALAEQP
FT                   LPALRAEVHQRIVFADSVAAGRLARETAPDSVAAREITALVDELLRWPT"
FT   gene            complement(488992..489849)
FT                   /locus_tag="Daci_0458"
FT   CDS_pept        complement(488992..489849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0458"
FT                   /product="conserved hypothetical replication initiator and
FT                   transcription repressor protein"
FT                   /note="KEGG: ajs:Ajs_2933 conserved hypothetical
FT                   replication initiator and transcription repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33104"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR46"
FT                   /protein_id="ABX33104.1"
FT                   /translation="MSSPALPSRQRLVPEREQLDLFRALPGDMAPRDSQDLMAFPFFSL
FT                   AKSRRVAPIDFRASGITIRVEGTQEHGIATIWDADVLIWAASQIVEARDAGLRPSRLMQ
FT                   ATPYEIQRFIGRGTSLRDYQRLKAALDRLQSTTVATSIRETTGRRLHRFSWINEWKELA
FT                   DTKGTPLGLELILPDWFYAGVMDAALVLTIDPAYFRLTGGIERWLYRLVRKHGGRQPGG
FT                   WQFDFRHLYRKSGSATRFSDFAYDLRALVARQSLPGYVLGIERMPDNSAELLTFRPVPF
FT                   AARG"
FT   gene            complement(490250..491023)
FT                   /locus_tag="Daci_0459"
FT   CDS_pept        complement(490250..491023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_2651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33105"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR47"
FT                   /protein_id="ABX33105.1"
FT                   /translation="MVSPHHFPHWYPTAAYLYVLRLDALALACEYLRRHPDYRLDWLHR
FT                   HRRPQAAQHAAHRWGLRLLEDPALDARDAHPAWLPGHAGVVQLYPDADPPQNATAFAFW
FT                   RIPGHKQLIHDGKRLVLIARSPGHCLRFALAPGLEDGMAVAYAHHGGAAAPARGHAPGA
FT                   ALANARPRPSHSALLELHTLQALDATLAGASLRDVAEGLFGVDAAAGWYSDGGLRSKVR
FT                   RLTRRGDALMRGGYRRLAQLAPLEKGRFEGHAKRP"
FT   gene            complement(491367..491714)
FT                   /locus_tag="Daci_0460"
FT   CDS_pept        complement(491367..491714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0460"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: rme:Rmet_1482 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33106"
FT                   /db_xref="InterPro:IPR021341"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR48"
FT                   /protein_id="ABX33106.1"
FT                   /translation="MNRLITEDERRQLLAHGQNRAAGGSIDPLPVVRLFTPDAHLTWLL
FT                   AALDPADGDTAFGLIDLGLGMPELGTVKLSDLESIVGPRKQPVMRDRYFQAARPLSEYL
FT                   RLAQENGSILD"
FT   gene            491931..492224
FT                   /locus_tag="Daci_0461"
FT   CDS_pept        491931..492224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0461"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   rme:Rmet_1481 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33107"
FT                   /db_xref="GOA:A9BR49"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR49"
FT                   /protein_id="ABX33107.1"
FT                   /translation="MQKRTVQRGRPAGSTTHDAELAHAFGAAVRALRMERGIAQESLAH
FT                   QAGIERSHMGKIERGEHMPTLAIIFKIAGALECSTAVLMSEAESQLAAAAPP"
FT   gene            complement(492589..493620)
FT                   /locus_tag="Daci_0462"
FT   CDS_pept        complement(492589..493620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0462"
FT                   /product="protein of unknown function DUF736"
FT                   /note="PFAM: protein of unknown function DUF736; KEGG:
FT                   pau:PA14_31180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33108"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR50"
FT                   /protein_id="ABX33108.1"
FT                   /translation="MLRAELRPFGFNPSRLRACACLLRIGARLIPAARCLTPVEYRRTG
FT                   NAGSAKPAPPPRWAGNWRIRWSLLRQVVRMRAVPDADGSCPSRYEGRFTGIPPGIAMEL
FT                   PCHASRLAPQGVTGAFSPVIGVLTWPASGSEPVQRSCGDAESALSPFEAVRPKASLSCC
FT                   ESWRWHGCASGFMAATVRRKQFPPALRAFLAGQILFASRFSTALRPQAVQPARLPPVGS
FT                   QQGRDGREPCSIVRRFIMATIGTFTADKDGFTGTLRTLTLNVKAKLVPNDKGDNEHAPD
FT                   FRVQAAGFDIGAAWKKVSKAERPYVSVTLDDPSFPATVYARLIEEEDGTHTLIWSRSKP
FT                   QAA"
FT   gene            complement(493694..494086)
FT                   /locus_tag="Daci_0463"
FT   CDS_pept        complement(493694..494086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0463"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   bbr:BB1021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33109"
FT                   /db_xref="GOA:A9BR51"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR51"
FT                   /protein_id="ABX33109.1"
FT                   /translation="MSIGVTLKAWARRIKRDGVTLWFAGKHPGTPWYAKALGLFVVAYA
FT                   LSPIDLIPDFIPVLGYVDDVILLPVLIWLTVKLLPSDVLAQCRIQADEWMLAEGAKPRS
FT                   RFGAVMIVALWLVMGVALWFWLMPHL"
FT   gene            complement(494083..495036)
FT                   /locus_tag="Daci_0464"
FT   CDS_pept        complement(494083..495036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0464"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   pde:Pden_3353 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33110"
FT                   /db_xref="GOA:A9BR52"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR52"
FT                   /protein_id="ABX33110.1"
FT                   /translation="MTMTYTPSASGHDHFFLGSDHQRNERKVWLVIALTASMMLVEIVA
FT                   GSIYGSMALVADGWHMSTHAGAMLITALAYRFARQHVGNPRFTFGTGKLGDLAGFASAI
FT                   VLALIALLIAWESLVRLTQPIHIDFNQAIAVAVVGLGVNLVCAWLLKDDHAHHGHNHGH
FT                   HHHDHDHHVPGKSRDNNLRAAYIHVLADALTSVFAIVALLLGRSYGWLWADPVMGVVGA
FT                   LVIARWSWGLIRDSGSVLLDAAVEGEEVRQEIREAVEPTGSEVTDLHVWQVGPGHFAAI
FT                   VSLVAREPQEPAHYKALLAHIHELSHVTIEVQRGAA"
FT   gene            complement(495083..495355)
FT                   /locus_tag="Daci_0465"
FT   CDS_pept        complement(495083..495355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0465"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   pde:Pden_3352 protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33111"
FT                   /db_xref="GOA:A9BR53"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR53"
FT                   /protein_id="ABX33111.1"
FT                   /translation="MSHTSRQKDKLVARVRRIKGQLEGIERALESDAACVEVLRQIASV
FT                   RGAVNGLTAEVMEDHLREHVLEVETDKERRQGGEEMVEVIRAYMK"
FT   gene            complement(495616..495825)
FT                   /locus_tag="Daci_0466"
FT   CDS_pept        complement(495616..495825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_3032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33112"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR54"
FT                   /protein_id="ABX33112.1"
FT                   /translation="MTRTTTSRPRMAAIYAPGTVRARRWRGDGDVCGYLPPSGWTTRAD
FT                   LADIHPITGRALPRAVWWLIKTKE"
FT   gene            complement(495889..497952)
FT                   /locus_tag="Daci_0467"
FT   CDS_pept        complement(495889..497952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0467"
FT                   /product="ParB domain protein nuclease"
FT                   /note="PFAM: ParB domain protein nuclease; KEGG:
FT                   rme:Rmet_3033 ParB-like nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33113"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR55"
FT                   /protein_id="ABX33113.1"
FT                   /translation="MNAVTTTEARAVHTAASSAANVLQAADPSKHMILVPLSRLVLRPT
FT                   GRNVRKTPRMSIPELAASIQGVGLLQNLIVIPAADGEHYEVVAGGRRLAALKLLAKKHR
FT                   IAKDWEVPCLQVADGTARTASLTENVQREAMHPADQFEAFAALVAEGRPIEDIAADFSV
FT                   TPLVVQRRLKLANVSPRLMADYRADAVTLDQLMALSITDDHAAQEAAFYDAPQWQRNPS
FT                   NLRERLTEREIGASHPLVRFVGLDTYEQAGGGIRRDLFAEGDAGVYLNDAALLETLVRQ
FT                   KLASIADTIRTEGWAWVDATPGVTHADLHAFQRAPRERRAPGKRDAQRIEKLQAKMQEV
FT                   AEAIDAAMDADDEDKAEALQEEGERLGEQLQALEDGLLDYAASVKAAAGAIVTIDRNGE
FT                   AVIHRGLLREAEAKALRTLEKLRQGFSGAEIEGDDDGEDADEAPKAAAMSDRLAQRLSA
FT                   HRTAALQTEVARHPQVALAALVHGMVQTILQGSHYGHDLPLGVRLTVQDRLEGMAPDWP
FT                   ESPAAVALHEAQQAWGEKLPEDSAELFAALLAMEQGELVKLLAVCVASTVDVVTPRATV
FT                   QQPGAELAQAVGLDMAAWWQPTAEGYFRHVPKAVILRAVGEYAPEHVTRLAKLKKADIA
FT                   SEAERLADGTGWMPAIFKAIGSQGAAQEEGPEQDAPEDAEVMADEPAEALAA"
FT   gene            complement(498017..498841)
FT                   /locus_tag="Daci_0468"
FT   CDS_pept        complement(498017..498841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0468"
FT                   /product="protein of unknown function DUF932"
FT                   /note="PFAM: protein of unknown function DUF932; KEGG:
FT                   ajs:Ajs_2944 protein of unknown function DUF932"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33114"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR56"
FT                   /protein_id="ABX33114.1"
FT                   /translation="MLATRFASHSPALRSGYPLSDDQIRRVAPSIFADAPHESRSERYA
FT                   YIPTAAVLTELRKEGFQPFMVTQTRVRDEGKREHTKHMLRLRHASQINGAEANEIVLLN
FT                   SHDGTSSYQMLAGMFRFVCSNGLVCGDTVADVRVPHKGNVAGHVIEGAYEVLSGFERVK
FT                   ESRDLMRGITLDDGESEVFARAALALKYDDPDKPAPVTESQILMPRRFDDRRPDLWSVF
FT                   NRTQENLTKGGLSGRSTNGRRQQTRPVQGIDSDIRLNRALWLLADGMRQLKA"
FT   gene            complement(499552..499830)
FT                   /locus_tag="Daci_0469"
FT   CDS_pept        complement(499552..499830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pau:PA14_31220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33115"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR57"
FT                   /protein_id="ABX33115.1"
FT                   /translation="MSSHHDYIIEITAQHDALKPFAPENGQPLRFKIGDAVIYTNEYGA
FT                   QFRRRVTGFYQPTGLSGLYARGARYLLDSSSPWMPVAESSLRPDDSA"
FT   gene            complement(499896..500246)
FT                   /locus_tag="Daci_0470"
FT   CDS_pept        complement(499896..500246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_3038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33116"
FT                   /db_xref="InterPro:IPR021341"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR58"
FT                   /protein_id="ABX33116.1"
FT                   /translation="MNYAFITDEQRALLLANGRASLENPDFDPAPVVKLFTPDAGATWL
FT                   LTEIDPDDHDHVFGLCDLGLGMPEIGWVSLGELAAVRGRLGLPIERDLSFRAEKRLSAY
FT                   ARDARLAGRIAV"
FT   gene            complement(500712..501149)
FT                   /locus_tag="Daci_0471"
FT   CDS_pept        complement(500712..501149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33117"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR59"
FT                   /protein_id="ABX33117.1"
FT                   /translation="MKLVSTATLIAALSFSAITFAQSGDMGGMKMEGKGMQNCMDMKGM
FT                   KGMDMKDMDAKKCQDMMKGMDAKGTAKSAAHEADAVVKEFDAVQGKVTLAHGPVKSLGW
FT                   PAMTMAFGVKDKALYDKLAVGAKVHVGFKKEGDGYVVTSVK"
FT   gene            complement(501257..501673)
FT                   /locus_tag="Daci_0472"
FT   CDS_pept        complement(501257..501673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33118"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR60"
FT                   /protein_id="ABX33118.1"
FT                   /translation="MLETHGCDGLCALRSAGGWIDPMRPSRTFESSQPEETIMKTSYLP
FT                   LIAALTLGVSLPALAGPDFQAIEKARAARQAAGAAQAVTTRVDSASGQRVKCLPAPLVL
FT                   PLDHGPRAQTTPGENRMRKARYEAQVKACANPES"
FT   gene            complement(501982..505152)
FT                   /locus_tag="Daci_0473"
FT   CDS_pept        complement(501982..505152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0473"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: pol:Bpro_3491 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33119"
FT                   /db_xref="GOA:A9BR61"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR61"
FT                   /protein_id="ABX33119.1"
FT                   /translation="MIAKLIRWSIANRFLVLLATVALSAWGIYAVQRTPLDALPDLSDV
FT                   QVIIRTTYPGQAPRIVENQVTYPLTTTMLSVPGAKAVRGYSFFGDSFVYVLFEDGTDPY
FT                   WARSRVLEYLNQVQSRLPAQAKASLGPDATGVGWIYEYALIDRSGKMDISQLRALQDWF
FT                   LKYELKTVPDVAEVASVGGMVRQYQIVLDPDKLAAYGIPHTKVVEAIQRANQETGGSVL
FT                   ELGEAEYMVRASGYLGSLEDFRKVPLMTTAAGVSVRLGDVARVQIGPEMRRGIGELNGE
FT                   GEAVGGVIVMRSGKNALQTIAAVKGKLQGLASSLPRGVEIVPVYDRSGLIERAVENLTH
FT                   KLIEEFIVVAVVCFLFLFHLRSALVAIISLPLGILAAFIVMHYQGVNANIMSLGGIAIA
FT                   IGAMVDAAVVMIENAHKHLEHWGHEHPGETLEGTARWHVIGESAAEVGPALFFSLLIIT
FT                   LSFVPVFTLEAQEGRLFSPLAFTKTYAMAAAAGLSVTLIPVLMGYLVRGRIPDEKNNPL
FT                   NRLLIAVYRPLLDRVLRAPKLTLVVALVVLATSLWPLRHIGGEFMPRLDEGDLLYMPSA
FT                   LPGLSAGKAAELLQQTDRLIKTVPEVASVYGKAGRAESATDPAPLEMFETTIQFKPRDQ
FT                   WRAGMTTDKLVEELDRIVKVPGLSNIWVPPIRNRIDMLATGIKSPVGVKVAGTDLATID
FT                   RLTGEIERTLKDVPGVSSALAERLTGGRYVDVNIRRDDAARYGLNIADVQSVVSSAVGG
FT                   ENIGETVEGLQRFPINLRYPREMRDSLEKLRVLPVLTGSGQRLVLSDVADIRVADGPPM
FT                   LRSENARLSGWVYVDIRDRDLRSAVQDMQQAVEKQVKLPPGYSISWSGQFEFLERATAK
FT                   LKVVVPFTLLIIFVLLYLTFGAFGEALLIMAALPFALVGGIWLLYLLGYNLSIAGAVGF
FT                   IALAGVSAEFGVIMLLYLKNAWQERADQGKTSEADLLDAIREGAVLRVRPKAMTVAVIL
FT                   AGLLPIMWGTGTGSEVMQRIAAPMVGGMVTAPLLSMFVIPAAYLLMRRSRERKASPWMF
FT                   WRRHRAAA"
FT   gene            complement(505149..506786)
FT                   /locus_tag="Daci_0474"
FT   CDS_pept        complement(505149..506786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0474"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   pol:Bpro_3492 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33120"
FT                   /db_xref="GOA:A9BR62"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR62"
FT                   /protein_id="ABX33120.1"
FT                   /translation="MKTKNLVMALVAAGVLGAAGYGLYTLGMRHGADMPATPSNPSGMA
FT                   SPQAATPAVAAPANESGEDATRRHIAAGLKAGDVDPANGKKILYYNDPMVPANKFDKPG
FT                   KSPFMDMMMSPVYADGDADQGKVTVSSRIQQNLGVRTAEVTEGTLSPQLSAVGSIAFNE
FT                   RDQAIVQARATGYVERLHVRATLDPVAKGQPLVSLYVPDWIAAQEEFLSVRRMKGTDLG
FT                   GLVDGARQRMRQVGMDDAQIALVERSGQTQPRITLSAPLGGVAVEVLAREGMTVAPGAT
FT                   LFRINSLSTVWANAEVPESQAALLRPGAKVQARSPAAPGSSFDGKVQAILPEVNPSTRT
FT                   LKARMELANPGGRLVPGMFVTMNFVDMRPDKTLLVPTEAVIQTGKRTVVIVAEDNGRFR
FT                   PAEVDAGIESGGQTEIKHGLSAGQRVVVSSQFLIDSEASLKGVEARLNSAPSAVAAASP
FT                   PVPMAASAPRHSGEAKVVGIGKDALTLSHGAIPTLKWGPMTMDFKLPPDGSAPKVQVGD
FT                   RVSFEFFMGADDLPQLTRVTPMAAGGKP"
FT   gene            complement(506807..508120)
FT                   /locus_tag="Daci_0475"
FT   CDS_pept        complement(506807..508120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0475"
FT                   /product="putative outer membrane cation efflux protein"
FT                   /note="KEGG: mpt:Mpe_A1625 putative outer membrane cation
FT                   efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33121"
FT                   /db_xref="GOA:A9BR63"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR63"
FT                   /protein_id="ABX33121.1"
FT                   /translation="MFIDSFSFRTPGGAVPWRRLAAGIVAAFAMGAGAAHAADGLTLDQ
FT                   ALRLAQTRSRALVAQDATASAARDMAVAAGQRPDPTLKLGINNLPVNGADRFSPTRDFM
FT                   TMRSIGVMQEFTREDKLKARAGRYEREAEVAEAGRSLALANLQRDTALAWLDRLFQERV
FT                   RDMLVTQRDEARLQIDAADAAYRGGRGTQADVFAARSAVAQIDDRIEQAERQVATARTQ
FT                   LARWIGSVASDPLGSVPALDMVRLSPQDLEAQLAHHPEIAVMQKQEEVAQAEADIAQAN
FT                   KKTDVSVELMYSQRGPAYSNMVSLNVSIPLQWDQKNRQDRELAAKLASVEQKRAEREEA
FT                   TRAHVAEALAMLQEWRSDRERLARYDSSLLPLATERTRASIAAYRGNAGTLTAVLEARR
FT                   AEIDTRVERLRLEMGAARLWAQLNYLVPAGHDTAAPRP"
FT   gene            complement(508255..508728)
FT                   /locus_tag="Daci_0476"
FT   CDS_pept        complement(508255..508728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33122"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR64"
FT                   /protein_id="ABX33122.1"
FT                   /translation="MTMTRMFRRFVCRLMLGVLVFGQLAIAAYACPALSGMPQSLPTMA
FT                   LNASAAAMPGDEAGAAMAVSPDMVATSDMAAMASCDQIDDNAANLCVEHCRFGQQSADH
FT                   ASAPTVPAALLTTLYTLPVQPEPLGHGWPSADVIFRRVAASPPHAILHCCFRI"
FT   gene            complement(508725..509246)
FT                   /locus_tag="Daci_0477"
FT   CDS_pept        complement(508725..509246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0477"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: azo:azo1354 putative
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33123"
FT                   /db_xref="GOA:A9BR65"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR65"
FT                   /protein_id="ABX33123.1"
FT                   /translation="MPTHAFTIRKLADAAGVGVEAVRYYQRGGLLAAPDRVDGGFRQYS
FT                   EDDVRRLRFIKRAQALGYSLEDIAELMSLSTKRDRLRVREITRERIAEIRERVADLQSM
FT                   ASALENLADCCAKAPEGSACSIIAALTGEQDLDPAIADPSLVAQASVAGRRRSVRPGAE
FT                   AYHRTDGVAA"
FT   gene            complement(509410..509850)
FT                   /locus_tag="Daci_0478"
FT   CDS_pept        complement(509410..509850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0478"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: vei:Veis_2831 putative
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33124"
FT                   /db_xref="GOA:A9BR66"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR66"
FT                   /protein_id="ABX33124.1"
FT                   /translation="MHVLTTCECSAMKIGELSHATGVDTDTIRFYERTGVLPPPARQTN
FT                   GYRVYGTEHIDGLSFVRHCRALDIPLADVRRLLNFTSRPDEDCADINRLVDEQIARVRA
FT                   RLTSLKALERQLTTLRARCSAGHQAKECGILGELVSAAQREA"
FT   gene            510137..512956
FT                   /locus_tag="Daci_0479"
FT   CDS_pept        510137..512956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0479"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: pla:Plav_3390 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33125"
FT                   /db_xref="GOA:A9BR67"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR67"
FT                   /protein_id="ABX33125.1"
FT                   /translation="MDCPSEEAQIRKRLAQVDGVRDMAFDLTRRRLEVTREPAGQNAIL
FT                   RALHDIGMRAVVEPAPQQVIYFIKEMDCPSEERQLRSMLEPLAGVQAVDFDLKAHTLTV
FT                   THSLTDTAPIARTIEGLGMKPVEKTAGSMPIAVEALIPSTAASQTPAPATGNGTRFLIP
FT                   NMDCPTEEATIRKRLGAVDGIERLDFDLMGRRLDVQHRLPDPAPILKALNDVGMKASIE
FT                   HADDTGPQGQAVYLIEKMDCPTEEGLLRKALEGMPGVKALDFNLMGRTLTVSHELVDLA
FT                   PVTSAIERLGMAPVLQSASDPAPSAPREFGTGISRGQWIRMAVSGVLALGAEAMVFAGA
FT                   PEASWPIILACLAAIGLGGVETLKKGWIALKTRSLNMNLLMTVAVIGAALIGQWPEAAV
FT                   VIWLFGIAEMIEALSLDRARNAIRKLMDLAPENALVRQPDGQWREVKADTVPLGSVVRV
FT                   RPGERIALDGEVVAGQSSVNQAPITGESMPVEKTAGATVFAGTINERGTLEFRVTSRKG
FT                   ETTLDRIARSVQEAQGQRAPTQRFVDKFAGIYTPAVFALALAVAVIPPLAFGQPWFEWV
FT                   YKALVMLVIACPCALVISTPVTVVSGLAAAARRGILVKGGLYLEQGRHLKSVALDKTGT
FT                   LTHGRPALTDVISLRGLPKEEVLRIAASIDALSEHPVATAIVAGYNQPHAQVDKFEAIP
FT                   GRGVKGNVDGDVYYVGNHRLIKELGLSTLEVETQLDALEYQAKTVVLLATDQQVLALLA
FT                   VADTVRDTSRQAIAELKSLGIEPVMLTGDNAKTAQAVAAQVGITSAKGELLPQDKLQAI
FT                   EELLSRGPVGMVGDGVNDAPALAKSSIGFAMGAAGTDTAIETADVALMQDNLRKLPEFI
FT                   RLSQRVAGILTANIVFALGTKAVFMALAFTGHASLWLAILADMGASLAVVFNGMRLLRS
FT                   SEDIKPHGH"
FT   gene            512973..513452
FT                   /locus_tag="Daci_0480"
FT   CDS_pept        512973..513452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0480"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: pla:Plav_3391
FT                   lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33126"
FT                   /db_xref="GOA:A9BR68"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR68"
FT                   /protein_id="ABX33126.1"
FT                   /translation="MYLLAVTVLAADVATKAAIVAWIPLYGSHEITPWFNIGHWLNPGA
FT                   AFSFLAQAGGWQRGFFIVIGVAASAFLTWLIAREKTATPEAVGYAAILGGALGNVLDRV
FT                   RHGAVVDWLDFHWGDWHWPAFNAADVGITLGAGLLLIAAFRGRGRNGADSHSPAR"
FT   gene            513540..514343
FT                   /locus_tag="Daci_0481"
FT   CDS_pept        513540..514343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0481"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: cvi:CV_1327 undecaprenyl-diphosphatase;
FT                   TIGRFAM: undecaprenol kinase; PFAM: Bacitracin resistance
FT                   protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33127"
FT                   /db_xref="GOA:A9BR69"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR69"
FT                   /protein_id="ABX33127.1"
FT                   /translation="MHAELVLKTLMMGVVEGITEFLPVSSTGHLILAGNALSFLAKEKR
FT                   DVFEVFIQFGAMLAVIWEYRARLASVVVSAHADQGSRRFLVNLAIAFMPAAVLGLLIGS
FT                   HVQRLLFSPGPVAVALVVGGIAILWAERRPVQVKAERAEQISRIDALKIGFVQCLALWP
FT                   GTSRSGATIIGGLWFGASRQAATEFSFFLGIPILGAASVYNLFKHWGALSSDDIGVFAM
FT                   GFIASFAFALLAIRLLMRYLTGHGFGVFAWYRIALGTLILVAVAT"
FT   gene            514575..516524
FT                   /locus_tag="Daci_0482"
FT   CDS_pept        514575..516524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0482"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: cytochrome c class I; iron permease FTR1;
FT                   KEGG: ajs:Ajs_1240 iron permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33128"
FT                   /db_xref="GOA:A9BR70"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR70"
FT                   /protein_id="ABX33128.1"
FT                   /translation="MKMLSLCARRFLAIAALFALWSASPAWAAAPAASDQAKQTWQLLD
FT                   YLAVDYGGAVSNGQIQSASEYEEMKEFAATAAQQLAALPSTAALPELQRQAKALGDLIA
FT                   AKADAKAVADSAHSLAAALVKAYPFPLSPTQPPDLARAKVLFEANCAACHGATGAGDGP
FT                   LGAKLEPPPIAFTDRDRARSRSVLALYQVISQGVTSTSMPSFATLSDEDRWALAFFAGT
FT                   LSHDDAMRARGEQSWGRDASAKAVFPDLAAAATLTEAALSERMPPDAARDLTAYVRRHP
FT                   EVTAAASGSGGLALARTRLQESLAAARAGDRASATRLGLSAYLDGFEPLEPALRARNQT
FT                   LLTEVENAMLAYRGALAGGKLEQADATAQKLDYLFAQVDAELGADKADPLTTFIASLTI
FT                   LLREGVEALLIVVGMLAFLKKAERRDVLGYVHGGWMAALACGGLTWAVATYFVSISGAS
FT                   REVTEGVSSLFAAVVLLSVGLWMHQKSTAGKWQAYLKEKLSAAMTRRSAWALFALSFIA
FT                   VYREVFETVLFYSALAGDGNNGALLGGLVGGVAVLAVLAWFMLRTSARMPIGKFFSLSS
FT                   ILVAVLAVVLAGKGVAGLQEAGRLSASPIHWPRIEVLGIYPSAETAIAQAVVLAVALAG
FT                   FAMNAVKARNPRPA"
FT   gene            complement(516588..518276)
FT                   /locus_tag="Daci_0483"
FT   CDS_pept        complement(516588..518276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0483"
FT                   /product="mercuric reductase"
FT                   /note="TIGRFAM: mercuric reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region;
FT                   FAD dependent oxidoreductase; Heavy metal
FT                   transport/detoxification protein; KEGG: ajs:Ajs_1298
FT                   mercuric reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33129"
FT                   /db_xref="GOA:A9BR71"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR021179"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR71"
FT                   /protein_id="ABX33129.1"
FT                   /translation="MAEAIALHIDGMTCASCAEHVREALEKVPGVRSASVSYPRRRAEV
FT                   EADADMNHGPLVAAMAALGYRARVSDTPNKAAGLLGKALGWLGSEPSHGGGERALHVAV
FT                   IGSGGAAMAAALKAVERGARVTLIERSTIGGTCVNVGCVPSKIMIRAAHIAHLRRESPF
FT                   DAGLPPTPPSILRERLLAQQQGRVDALRHAKYEGILQSTPAITVLHGEARFMNENCLTV
FT                   QLAEGGERTVAFDRCLIATGASPALPPIPGLKGTPYWTSTEALASDAIPSRLAVIGSSV
FT                   VAVELAQAFARLGSQVTILARSTLLFREDPAVAEAVTAAFRAEGIEVLEHVQASRVAHA
FT                   EEEFILTTDRGELRADKLLIATGRAPNTRTLNLEAAGIEVNPQGAILVSHTMRTSAPHI
FT                   YAAGDCTDQPQFVYVAAAAGTRAAINMTGGDATLDLTAMPAVVFTDPQVATVGYSEAQA
FT                   RHDGVETDSRTLTLDNVPRALANFDTRGFIKLVAEAGTGRLIGVQAVAPEAGELIQTAA
FT                   LAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFSKDVKQLSCCAG"
FT   gene            complement(518288..518566)
FT                   /locus_tag="Daci_0484"
FT   CDS_pept        complement(518288..518566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0484"
FT                   /product="mercuric transport protein periplasmic component"
FT                   /note="TIGRFAM: mercuric transport protein periplasmic
FT                   component; PFAM: Heavy metal transport/detoxification
FT                   protein; KEGG: ajs:Ajs_1299 mercuric transport protein
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33130"
FT                   /db_xref="GOA:A9BR72"
FT                   /db_xref="InterPro:IPR001802"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR011795"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR72"
FT                   /protein_id="ABX33130.1"
FT                   /translation="MKKLATAIALAVTLGAPAWAATKTVTLSVPDMTCASCPITVKMAL
FT                   FKVAGVQKTEVSYEKREAVVTFDDAKTNAGALAKATANAGYPATVKQ"
FT   gene            complement(518579..518929)
FT                   /locus_tag="Daci_0485"
FT   CDS_pept        complement(518579..518929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0485"
FT                   /product="Mercuric transport protein MerT"
FT                   /note="PFAM: Mercuric transport protein MerT; KEGG:
FT                   ajs:Ajs_1300 mercuric transport protein MerT"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33131"
FT                   /db_xref="GOA:A9BR73"
FT                   /db_xref="InterPro:IPR003457"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR73"
FT                   /protein_id="ABX33131.1"
FT                   /translation="MSEPKSGRGALAAGGLAAILASACCLGPLILVLLGFSGAWIANLA
FT                   VLEPYRPIFIGAALMALFFAWRSIFRPVHACKPDEVCAVPRVRTAYKIIFWIVVALVLI
FT                   ALAFPYVLPLFY"
FT   gene            519001..519408
FT                   /locus_tag="Daci_0486"
FT   CDS_pept        519001..519408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0486"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Hg(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: ajs:Ajs_1301 putative
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33132"
FT                   /db_xref="GOA:A9BR74"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011794"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR74"
FT                   /protein_id="ABX33132.1"
FT                   /translation="MESASDNLTIGAFAKAATVNVETIRFYQLKGLLPQPERAYGRIRR
FT                   YGPADVARVKFVKSAQRLGFSLDEIGQLLKLEDGTHCNEAAELASLRLADVRARLVDLT
FT                   RIEAALSKLVGECDAHHGNVSCPLIAALHCC"
FT   gene            519566..519913
FT                   /locus_tag="Daci_0487"
FT   CDS_pept        519566..519913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0487"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: mpt:Mpe_A2347
FT                   TC repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33133"
FT                   /db_xref="GOA:A9BR75"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR75"
FT                   /protein_id="ABX33133.1"
FT                   /translation="MLYYRNMKETQAVSALGALAHTQRLRVFRALVVAGPEGLTPSALA
FT                   DQLDVARNSLSFHLKELAHAGLVTIEQQGRNLIYRADFTQMNGLLGYLTEHCCQGSTCE
FT                   VSDSSSACTSC"
FT   gene            519926..520396
FT                   /locus_tag="Daci_0488"
FT   CDS_pept        519926..520396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0488"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mpt:Mpe_A2346 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33134"
FT                   /db_xref="GOA:A9BR76"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR76"
FT                   /protein_id="ABX33134.1"
FT                   /translation="MKRFHVHLHVDDLNRSIGFYSQLFAAQPARVEGDYAKWMLEDPPV
FT                   NFAISTRGNKPGIDHLGIQTDDAEELAVLKARAEAADMALLDEGTTTCCYARSEKHWIT
FT                   DPQGVAWEHFHTLGSIPVFNEAAPATGSAAACCAPARGKPVGVAVKPASSCC"
FT   gene            520409..520906
FT                   /locus_tag="Daci_0489"
FT   CDS_pept        520409..520906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0489"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: mpt:Mpe_A2345 arsenate reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33135"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR77"
FT                   /protein_id="ABX33135.1"
FT                   /translation="MTTNKTYNALFICTGNSARSILAEGILNELGQGRFRAYSAGSHPK
FT                   GEVHPLALATLERLHMPIVGYRSKNWDEFAAPGAPELDFIFTVCDNAAGEVCPVWPGRP
FT                   MSAHWGVPDPAAVEGTDEQKRKAFTDAALTLRRRIELFLSLPLQRLDAMSLQHELRSIG
FT                   TK"
FT   gene            520917..522002
FT                   /locus_tag="Daci_0490"
FT   CDS_pept        520917..522002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0490"
FT                   /product="arsenical-resistance protein"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: har:HEAR1962 arsenite efflux
FT                   pump ACR3"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33136"
FT                   /db_xref="GOA:A9BR78"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR78"
FT                   /protein_id="ABX33136.1"
FT                   /translation="MSVGTQTAGRVPATSTMSVFERYLSVWVLLCIVAGIALGQFAPNV
FT                   FQAIGRMEIAQVNLPVGLLIWIMIVPMLLKVDFGALGQVKQHWRGIGVTLFVNWAVKPF
FT                   SMALLAWIFVRQVFAQWLPADQLDSYVAGLILLAAAPCTAMVFVWSRLTGGDPVFTLSQ
FT                   VALNDTIMVFAFAPIVGLLLGLSSITVPWATLLVSVGLYIVIPVILAQLWRRALLNKGQ
FT                   AAFDRALERIGPLSIAALLLTLVLLFAFQGEAIIRQPLVIAMLAVPILIQVFFNSGLAY
FT                   WLSRKAGEQHSIACPSALIGASNFFELAVAAAISLFGFQSGAALATVVGVLIEVPVMLL
FT                   VVRIVNQSKGWYECGPNPARR"
FT   gene            522017..522439
FT                   /locus_tag="Daci_0491"
FT   CDS_pept        522017..522439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0491"
FT                   /product="arsenate reductase"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related; KEGG: har:HEAR1960 arsenate
FT                   reductase (glutaredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33137"
FT                   /db_xref="GOA:A9BR79"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR79"
FT                   /protein_id="ABX33137.1"
FT                   /translation="MSSITIYHNPVCGTSRNVLALIRNSGEEPTVIEYLKTPPDRETLQ
FT                   RLITDMGVPVRAVLREKGTPYAELGLDDPKWSDAQLIDCMLQHPILINRPIVVTPLGTR
FT                   LCRPSEAVLDILPQSQRGAFNKEDGEAVVDAEGRRV"
FT   gene            522432..523154
FT                   /locus_tag="Daci_0492"
FT   CDS_pept        522432..523154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0492"
FT                   /product="arsenical resistance protein ArsH"
FT                   /note="TIGRFAM: arsenical resistance protein ArsH; PFAM:
FT                   NADPH-dependent FMN reductase; KEGG: ajs:Ajs_1284
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33138"
FT                   /db_xref="GOA:A9BR80"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR80"
FT                   /protein_id="ABX33138.1"
FT                   /translation="MSESRIDLPNIDTALFQLPDTQRLLTPERATHAPRFLLLYGSLRE
FT                   RSFSRLAAEEAARILRALGGETRMFNPSGLPLVDDAPADHPKVKELHELAQWAEGMVWS
FT                   SPERHGAMTGLMKTQIDWIPLSAGAVRPTQGKTLAVMQVSGGSQSFNAVNQMRVLGRWM
FT                   RMLTIPNQSSVAKAYQEFDEAGRMKPSAYYDRIADVMEELMKFTLLTRDAAPYLVDRYS
FT                   ERKESAEALSRRVQQTAI"
FT   gene            523250..523681
FT                   /locus_tag="Daci_0493"
FT   CDS_pept        523250..523681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33139"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR81"
FT                   /protein_id="ABX33139.1"
FT                   /translation="MGISSSKVYKQADEAAAFAHIRELAEKEPVDDETASELWLEAEAI
FT                   VDTYIEAAESRSIEDLPSRQELGESCFWLLFQTKVLREDEHYRLIVELLSPQLGLSLFD
FT                   LLPRVRKLREAALDALEAMVKKPSMDRPTAPQACEDDLF"
FT   gene            complement(523720..523911)
FT                   /locus_tag="Daci_0494"
FT   CDS_pept        complement(523720..523911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_2957 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33140"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR82"
FT                   /protein_id="ABX33140.1"
FT                   /translation="MKSRPHDEAMAELYRSDPALALEVINGVLEDGDQAELPTVLRQMA
FT                   RTFGADARSSAADEFSYR"
FT   gene            complement(523911..524435)
FT                   /locus_tag="Daci_0495"
FT   CDS_pept        complement(523911..524435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0495"
FT                   /product="prophage CP4-57 regulatory"
FT                   /note="KEGG: rme:Rmet_1467 prophage CP4-57 regulatory"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33141"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR83"
FT                   /protein_id="ABX33141.1"
FT                   /translation="MEYTFTLKYQLTDDDRDSQTLVERLGEAGCDDALVGIGQPGRLAL
FT                   EFTREAVDADEAVRSALADVRRAAPSARLIEVAPDLVGLTDVADIVGVSRQNMRKLMLA
FT                   HPGSFPAPVHEGSASIWHLADVLGWMQAKGGYALAREVLDVARAALQVNVAKEGRRLPR
FT                   LAFEELEALVG"
FT   gene            complement(524440..524718)
FT                   /locus_tag="Daci_0496"
FT   CDS_pept        complement(524440..524718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33142"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR84"
FT                   /protein_id="ABX33142.1"
FT                   /translation="MARSSHPKKEVEDALRHAEGQGWRVEVGGSHAWGRMYCPYNDEEC
FT                   RCGEFCITSVWSTPKNPGNHARALRRAVDNCTMDRQQREADDDGTQE"
FT   gene            complement(524894..526132)
FT                   /locus_tag="Daci_0497"
FT   CDS_pept        complement(524894..526132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0497"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: rme:Rmet_3045
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33143"
FT                   /db_xref="GOA:A9BR85"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR85"
FT                   /protein_id="ABX33143.1"
FT                   /translation="MWPLETGSFRGVIVAKIKLTKSAVDAAQPQAQAVELRDTLVPGFL
FT                   CKITPAGRKVFMLQYRTNAGERRKPALGLYGELTVEQARSLAQEWLAQVRRGGDPAADK
FT                   AAARKAPTVTELCVKFMEDHSKQRNKPSTRRGYQGVIDRCIVPFLGRIKVQDVKRPDVA
FT                   GAMKKMAHKPAEANRAFSVMRKMFNLAEVWGYRPDGTNPCRHVPVYPDGKATHLISDED
FT                   MGKLFRHLDGIEAEGLENYVIPLAIRLQFEFAGRRSEIISLEWAWVDLDNRRVVWPDSK
FT                   TGGMSKPLSEEAYRLLSTAPRRDGCPYVLPSPNDPAKHLTEGEYYGAWCRILKAAGATH
FT                   VGTHGIRHRSATDIANSGIPVKVGMALTAHKTVAMFMRYVHTEDDPVRQAAELVANRRK
FT                   TITGAQRTEQASA"
FT   gene            complement(526318..526860)
FT                   /locus_tag="Daci_0498"
FT   CDS_pept        complement(526318..526860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0498"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: aav:Aave_0385
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33144"
FT                   /db_xref="GOA:A9BR86"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR86"
FT                   /protein_id="ABX33144.1"
FT                   /translation="MSATHTEEAHTGPIKNPKQLLMAVFFSFVVPVFVIIGLVQYVSSA
FT                   DKAGAGASQTEMAKAQRLQKIGLVEIRDANRPLRSGEEVFKGQCAACHATGAAGAPKFA
FT                   DAAAWGPRLAQGLEGLVHSALKGKGAMAPQGGGDFNDTEIARGVVYMANAAGGKFEEPK
FT                   APAAEGAAAEGAAAPAN"
FT   gene            complement(527079..528536)
FT                   /locus_tag="Daci_0499"
FT   CDS_pept        complement(527079..528536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0499"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: aav:Aave_0387 transcriptional regulator, fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33145"
FT                   /db_xref="GOA:A9BR87"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR87"
FT                   /protein_id="ABX33145.1"
FT                   /translation="MINRSTPVAIATAVLLAGCSLIPTYERPAAPVAAQYTRANATAAA
FT                   EGGTAAAQLPWQDFFQDARLQQLVRTALDNNRDLRVAALNIERAQAQYRITRADQFPTV
FT                   GAGVNASRAPNTTGSGAKYVNSYQVGLAVTSWELDFFGRIGSLKEAALAQYLATEEARR
FT                   AAQTSLVAAVASGWYTLLADEQLLKISRDTLRTREESIKLTKLRFDTGVASELDYRQAV
FT                   SLTEAARATLAQQQRQRALDENALVLLLGQALPADVLASLGSSQGLRDTADLPAVPAGL
FT                   PSDLLTQRPDIRQAEQQLISANANIGAARAAFFPRITLTGQFGTASNELSGLFKSGSWG
FT                   FTLAPSALLPIFDAGRNSANLAAAKVEREVAIAQYEKSIQSAFREVSDALDSQGTLRDQ
FT                   IMAQRAQLEAEQARLKLSDLRYSNGVASYLDLLDAQRTLFALEQSTVSVRLAQLLNQIE
FT                   LYKALGGGWTDRTATAAAATPATAPAQ"
FT   gene            complement(528529..531684)
FT                   /locus_tag="Daci_0500"
FT   CDS_pept        complement(528529..531684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0500"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   pol:Bpro_2036 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33146"
FT                   /db_xref="GOA:A9BR88"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR88"
FT                   /protein_id="ABX33146.1"
FT                   /translation="MAKFFIDRPIFAWVVALFIIVLGGIALTKLPIAQYPKVAPPAIVI
FT                   NTAYPGASAKVLEDSVLSVIEREMNGSPGLVYMESVAQADGTGSITISFEAGTNVDLAQ
FT                   VDVQNRLSRATPRLPASVTQQGVRVDKASSNFLLFIMLSSEDAKAYDTVALGDYASRNI
FT                   VPEIQRVAGVGQAQLFGTEKAMRIWFDPAKLQGYKLSAEDVTAAIRSQNAQVASGAIGD
FT                   LPNITGQKIAATVTVMGQLSSIGQFENIVLRANPDGSTVRLKDVATVEIGGQAYATSAR
FT                   LNGKDAVGIGVQLTPSGNALATAKAVHARMEELQKFFPKGVKYSIPYDSSKFVSISIEK
FT                   VAHTLLEAIVLVFLVMFLFLQNWRYTLIPTIVVPIALLGTFAVMQAVGFSINVLAMFGM
FT                   VLVIGIVVDDAIVVVENVERIMSEEGLQPREAAIKAMGQISGAIVGITLVLIAVFIPLA
FT                   FFAGSTGNIYRQFSIVMVASISFSAFMALTLTPALCATLLKPVEAGHHHEKKGFFGWFN
FT                   RTFARSAKSYEGWVARLLKRSVLMIGVYLAVIAGAVVVFRGLPTSFLPTEDQGYFIVNV
FT                   QLPPGAAKERTLEVMKQVEEAVLPQPEVANMVSVLGFSFSGQGQNAALAFVPLKDWSER
FT                   KGANSTVDAMTGRIMGMTSGIRDAFVFAVNPPPIPELGNAVGFSFRLQDRAGHGHDALI
FT                   NARNMMLGMAGQSKVLAGVRPDGLEDAPQLRIEIDRDKANALGVDFTSINAALSTALGS
FT                   SYVNDFPNQGRLQRVIVQADAPARMQPDDLLRLNARNAKGDPVPLSTFATTKWVKGAQQ
FT                   TVRYNGYPAVRIEGSAAPGFSSGDAMDEMEKLAAKLPEGFGFEWTGQSREEKLAGSQAI
FT                   FLYAFAILAVFLCLAALYESWSIPLSVILVVPLGLLGVVLATLLRNYSNDVYFQIGLVT
FT                   VIGLSAKNAILIVEFAKDLQAEGKGLIEAALEAAHLRFRPIIMTSLAFGLGVVPLVIAT
FT                   GASSASQRAIGTGVLGGMITGTVLAVLFVPTFFVVVRKLFKGKIKTHNPPSTPAGKEAL
FT                   SHD"
FT   gene            complement(531700..532992)
FT                   /locus_tag="Daci_0501"
FT   CDS_pept        complement(531700..532992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0501"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   pna:Pnap_2887 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33147"
FT                   /db_xref="GOA:A9BR89"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR89"
FT                   /protein_id="ABX33147.1"
FT                   /translation="MPSTRSNVSAAPSPYSSLRLTTVALAVTAAMAMAACGKKPEEKAA
FT                   AQQQMPAVPVGVVVATPADVGLVTELPGRVDARRVAQIRARSAGIVQERLFREGSDVKA
FT                   GQVLYRIDPAPYQATLQSAKATQARAEANQAQALAQLERYRPLVAANAISKQDFVNAEA
FT                   AYKQAQADVAAGKASVRTAEINLGYTNVTAPISGRIGQSLVTEGALVGQGEATPLAVVQ
FT                   QINPVYVNFTQSSSEAFRLRRAMEQGKLKKADGAEAASVEVRLDDGTAYELKGKLLFTD
FT                   LTVDSSTGQVTLRAEVPNPKGLLLPGMYVRVRMEQAQASNAIAVPQQAVTRTETGDTVS
FT                   VVSDDGKITKRQVKVTTAQNNQWLVSEGLQAGEKVMVDGFQKLQMLPPGTPVKPVPWQP
FT                   EAAGAQKPAGAAAPAPQAAADAKPADQADKK"
FT   gene            533152..533817
FT                   /locus_tag="Daci_0502"
FT   CDS_pept        533152..533817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0502"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracycline
FT                   transcriptional repressor MAATS-type domain protein; KEGG:
FT                   aav:Aave_0390 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33148"
FT                   /db_xref="GOA:A9BR90"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR90"
FT                   /protein_id="ABX33148.1"
FT                   /translation="MAGLNDGRKYILARRTKEDAFATRNSLLDAAEQVFYEQGVARASL
FT                   NEIAQRAGATRGAVYWHFKDKLDLFYAMLDRVTLPLEQAVYSDCEDDSECDALEYVRRL
FT                   MAVVFGRIADDDSTRRVFEILLLKVEYVGELMPVQERNRAALDSFSAQLELALRAAAES
FT                   HAVTMSMPAPQASIALCAMFDGLLQSWLLGRAFDLKQVGAQAVDVCLRGLGFTVPQAQ"
FT   gene            533898..533973
FT                   /locus_tag="Daci_R0002"
FT                   /note="tRNA-Arg1"
FT   tRNA            533898..533973
FT                   /locus_tag="Daci_R0002"
FT                   /product="tRNA-Arg"
FT   gene            534064..534149
FT                   /locus_tag="Daci_R0003"
FT                   /note="tRNA-Tyr1"
FT   tRNA            534064..534149
FT                   /locus_tag="Daci_R0003"
FT                   /product="tRNA-Tyr"
FT   gene            534205..534278
FT                   /locus_tag="Daci_R0004"
FT                   /note="tRNA-Gly1"
FT   tRNA            534205..534278
FT                   /locus_tag="Daci_R0004"
FT                   /product="tRNA-Gly"
FT   gene            534322..534396
FT                   /locus_tag="Daci_R0005"
FT                   /note="tRNA-Thr1"
FT   tRNA            534322..534396
FT                   /locus_tag="Daci_R0005"
FT                   /product="tRNA-Thr"
FT   gene            534475..535665
FT                   /locus_tag="Daci_0503"
FT   CDS_pept        534475..535665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0503"
FT                   /product="translation elongation factor Tu"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: ajs:Ajs_3904 translation elongation factor Tu;
FT                   TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33149"
FT                   /db_xref="GOA:A9BR91"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR91"
FT                   /protein_id="ABX33149.1"
FT                   /translation="MAKAKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAK
FT                   AYDQIDAAPEEKARGITINTAHVEYETAGRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLAKYDF
FT                   PGDDTPIIRGSAKLALEGDQSDKGEAAILRLAEALDSYIPTPERAVDGAFAMPVEDVFS
FT                   ISGRGTVVTGRIERGIIKVGEEIEIVGIRDTQKTIVTGVEMFRKLLDQGQAGDNVGLLL
FT                   RGTKREDVERGQVLCKPGSIKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPADKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIA"
FT   gene            535675..535750
FT                   /locus_tag="Daci_R0006"
FT                   /note="tRNA-Trp1"
FT   tRNA            535675..535750
FT                   /locus_tag="Daci_R0006"
FT                   /product="tRNA-Trp"
FT   gene            535837..536220
FT                   /locus_tag="Daci_0504"
FT   CDS_pept        535837..536220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0504"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: aav:Aave_4537
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33150"
FT                   /db_xref="GOA:A9BR92"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR92"
FT                   /protein_id="ABX33150.1"
FT                   /translation="MATTQVETVSSGADKAKLAAVAALVVAAIAGFYLLSKQGPIVQWL
FT                   VLLVGLAAAAGTFLVSEPGKRFVSFAQDAWREVKKVVWPTRKETMQMTLYVFGFVVIMA
FT                   LFLWFTDKTLEWVLYDLILGWRK"
FT   gene            536220..536804
FT                   /locus_tag="Daci_0505"
FT   CDS_pept        536220..536804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0505"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: KOW domain protein; NGN domain protein;
FT                   KEGG: ajs:Ajs_3902 NusG antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33151"
FT                   /db_xref="GOA:A9BR93"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A9BR93"
FT                   /protein_id="ABX33151.1"
FT                   /translation="MDAVETGVNDGGAAPANPDLRWYIVHAYSGMEKAVERNIIERIAR
FT                   SDMQSKFGRILVPTEEVVEMKNGQRRTTERRLFPGYVFVEMVMDDDTWHLVKHTSKVTG
FT                   FVGGAKNRPAPISEEEVRKIVSQMQEGTEKPRHKVEFMPGELVRVKEGPFTDFNGSVEE
FT                   VNYEKSRLRVSVMIFGRSTPVELEFAQVEKT"
FT   gene            536946..537377
FT                   /locus_tag="Daci_0506"
FT   CDS_pept        536946..537377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0506"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: ajs:Ajs_3901
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33152"
FT                   /db_xref="GOA:A9BR94"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BR94"
FT                   /protein_id="ABX33152.1"
FT                   /translation="MAKKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQ
FT                   TQGVEPGLPLPVVITAFADKSFTFIIKTPPATVLIKKAIKLDKGSSNPLKNKVGKITRA
FT                   QLEEIANTKLKDMNAADVDAAVRTLAGSARSMGVIVEGV"
FT   gene            537378..538073
FT                   /locus_tag="Daci_0507"
FT   CDS_pept        537378..538073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0507"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: ajs:Ajs_3900
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33153"
FT                   /db_xref="GOA:A9BR95"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BR95"
FT                   /protein_id="ABX33153.1"
FT                   /translation="MAKLTKKQKALQGKVESTKLYAFADAVALVKDAATAKFDESIDVA
FT                   VQLGVDAKKSDQVVRGAVVLPHGTGKVARVAVFAQGAKAEEAKAAGADVVGMDDLAARV
FT                   KAGDMPFDVVIAAPDAMRVVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQY
FT                   RVDKAGIIHATIGRRSFDNEKLQGNLAALIDALNKSKPASSKGLYLRKVAVSSTMGVGV
FT                   RVDTQTISA"
FT   gene            538300..538827
FT                   /locus_tag="Daci_0508"
FT   CDS_pept        538300..538827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0508"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: aav:Aave_4533
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33154"
FT                   /db_xref="GOA:A9BR96"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BR96"
FT                   /protein_id="ABX33154.1"
FT                   /translation="MSLNRSEKEAVINEVTSLAAKAQTLVIAEYRGITVADMTKLRSDA
FT                   RSKGVSLSVLKNTLARRAVAGSQFDVVADQMTGPLIYGFSEDAVAAAKVVADFAKTNDK
FT                   LVIRGGAFAGKALDVNGVKQLANIPSKEVLLAQLCGLLMSPISRTAVVLGALAAKKSEG
FT                   SAEEPAAEAVAA"
FT   gene            538865..539242
FT                   /locus_tag="Daci_0509"
FT   CDS_pept        538865..539242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0509"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: ajs:Ajs_3898 ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33155"
FT                   /db_xref="GOA:A9BR97"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BR97"
FT                   /protein_id="ABX33155.1"
FT                   /translation="MAFDKDAFLTALDGMTVLELNDLVKAIEEKFGVSAAAMAAPAAGG
FT                   AAGGAAAAEEKTEFNVVLTEAGANKVSVIKAVREITGLGLKEAKDLVDGAPKNVKEGVA
FT                   KADAEAAVKKLVEAGAKAELK"
FT   gene            539519..543631
FT                   /locus_tag="Daci_0510"
FT   CDS_pept        539519..543631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0510"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG: ajs:Ajs_3897
FT                   DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33156"
FT                   /db_xref="GOA:A9BR98"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BR98"
FT                   /protein_id="ABX33156.1"
FT                   /translation="MAYSYTERKRIRKSFGSRDSVLEVPYLLQMQKDAYTAFLQSDVAP
FT                   KKRTIEGLQAAFNSAFPIVSHNGFVEMKFVEYNLAKPAFDVRECQTRGLTFASAVRAKV
FT                   QLIIYDRESSTSQSKVVKEVKEQEVYMGEVPLMTEKGSFIINGTERVIVSQLHRSPGVF
FT                   FEHDKGKTHSSGKLLFSARIIPYRGSWLDFEFDPKDLLFFRVDRRRKMPVSILLKAIGL
FT                   TPESILANFFVNDNFRLMDSGAQMEFVSERLRGEVARFDITDKSGKVVVAKDKRVTARH
FT                   TRELEQSGTKFISVPEDFLIGRVVAKNIVDPDTGEIIAKANEELTESLLKKLRSAGIQD
FT                   LQCIYTNELDQGAYISQTLRTDETVDEFAARVAIYRMMRPGEPPTEDAVQALFQRLFYN
FT                   PDTYDLSRVGRMKFNAKVGRDGATGPMVLSNEDILAVVKILVDLRNGKGEVDDIDHLGN
FT                   RRVRCVGELAENQYRTGLARIEKAVKERLGQAEQEPLMPHDLINSKPISAALKEFFGAS
FT                   QLSQFMDQTNPLAEITHKRRVSALGPGGLTRERAGFEVRDVHVTHYGRVCPIETPEGPN
FT                   IGLINSLALYARLNEYGFIETPYRRVADGKVTMEIDYLSAIEEGKYIIAQANAELDAEG
FT                   RLIGDLVSAREKGDSTLVSAERVQYMDVSPAQIVSVAASLIPFLEHDDANRALMGANMS
FT                   RQAVPVLRPEKPMVGTGIERVAAVDSGTVVTATRGGIVDYVDATRIVVRVNDAEAVAGE
FT                   VGVDIYNLIKYQRSNQNTNIHQRPIVKRGDKLAKGDVVADGASTDLGEIAIGQNMLIAF
FT                   MPWNGYNFEDSILINERVVAEDRYTSIHIEELVVMARDTKLGAEEITRDIPNLSEQQLN
FT                   RLDESGIIYVGAEVQPGDVLVGKVTPKGETTLTPEEKLLRAIFGEKASDVKDTSLRVDQ
FT                   GSQGTVIDVQVFTREGIQRDKRAQQIIDDELKRYRLDLNDQLRIVEADAFDRIEKLLNG
FT                   RVANGGPQKLAKGAKIDKAYLDGVEKFHWFDIRPAEDEVATQLESIKNSLEQTRHSFDL
FT                   AFEEKRKKLTQGDELPAGVLKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIVPVEDMP
FT                   YMADGSTADIVLNPLGVPSRMNIGQVLEVHLGWAGKGLGQRIGDMLQQEARAAEIRTFM
FT                   EEIYNSRGRKEDLTQLDDKEIVSMAQALTTGVPFATPVFDGASEQEIQDMLHLAYPEEL
FT                   AQRKGLTESRTQAYLYDGRTGDRFERPTTIGYMHYLKLHHLVDDKMHARSTGPYSLVTQ
FT                   QPLGGKAQFGGQRFGEMEVWALEAYGAAYVLQEMLTVKSDDVVGRTKVYESIVKGEHAI
FT                   EAGMPESFNVLVKEIRSLGLDIELERS"
FT   gene            543655..547884
FT                   /locus_tag="Daci_0511"
FT   CDS_pept        543655..547884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0511"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: aav:Aave_4530 DNA-directed RNA polymerase,
FT                   beta' subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase alpha subunit; RNA polymerase
FT                   Rpb1 domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33157"
FT                   /db_xref="GOA:A9BR99"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BR99"
FT                   /protein_id="ABX33157.1"
FT                   /translation="MKSLLDLFKQFTPDEHFDAIKIGLASPEKIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IDLAAPCAHIWFLKSLPSRLGLVLDMTLRDIERVLYFEAYVVTDPGMTPLKKFSIMTED
FT                   DYEAKRTEYGDEFEAKMGAEGIKDLLEGIDIDVETERLRGDLTGSEVKVKKNAKRLKLL
FT                   EAFKKSGIKPGWMVMEVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNSRLRRLL
FT                   ELKAPEIIARNEKRMLQEAVDSLLDNGRRGKAMTGANKRALKSLADMIKGKSGRFRQNL
FT                   LGKRVDYSGRSVITVGPYLKLHQCGLPKLMALELFKPFIFAQLEQRGIATTIKAAKKEV
FT                   ESGTPVVWDILEEVIKEHPVMLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCAAFNAD
FT                   FDGDQMAVHVPLSVEAQMEARTLMLASNNVLFPASGEPSIVPSQDVVLGLYHATRERIN
FT                   GKGEGMIFADIGEVQRALDSDQVELAAKISVRLTEWTKNKDSGEFEPSTSLVETTVGRA
FT                   LMSEILPKGLPFSHMNKALKKKEISKLINASFRKCGLKATVVFADKLLQNGFRLSTHAG
FT                   ISIAIGDMLVPPQKAEIIGRAEAEVKEIEQQYVSGLVTAGERYNKVVDIWGKAGDEVSK
FT                   VMMAQLAKEKVIDRHGNEVEQESFNAIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSI
FT                   IETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVTQDLVVNEDD
FT                   CGTTNGALMRAIVEGGEVIESLRDRVLGRTTAEDVVHPETLAVLLPAGTLLNEDGIDEL
FT                   ELQGVDEIKVRTALTCETRYGLCAKCYGRDLGRGGLINLGEAVGVIAAQSIGEPGTQLT
FT                   MRTFHIGGAASRAAIASSVEAKSNGSISFNSTMRYVSNTKGELVVISRSGEIVISDNGR
FT                   ERERHKVPYGAVLTVRPDQQVKAGLILANWDPLTRPIITEYAGQVRFENVEEGLTVAKQ
FT                   VDEVTGLSTLVVIDPKRRGSAKVVRPQVKLIDANNQEVKIPGTDHSVTIGFQVGALIQV
FT                   RDGQDVGPGEVLARIPVEGQKTRDITGGLPRVAELFEARTPKDKGTLAEMTGTISFGKE
FT                   TKGKVRMQITDLDGKVWEELVPKEKNILVHEGQVVNKGESIVDGPADPQDILRLLGIEE
FT                   LSRYIVDEVQDVYRLQGVKINDKHIEVIVRQMLRRVVVENTGDSTYIAGEQVERSEILN
FT                   TNEALQREGKIPATYSNVLLGITKASLSTDSFISAASFQETTRVLTEAAIMGKRDELRG
FT                   LKENVIVGRLIPAGTGLAYHQARKAKDAMDDAERRAIADAEAAELAGVMADDDTAAVSV
FT                   AGDASAD"
FT   gene            547966..548649
FT                   /locus_tag="Daci_0512"
FT   CDS_pept        547966..548649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0512"
FT                   /product="LemA"
FT                   /note="KEGG: aav:Aave_4529 LemA"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33158"
FT                   /db_xref="GOA:A9BRA0"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRA0"
FT                   /protein_id="ABX33158.1"
FT                   /translation="MGITRVRPDQPPAGPLQTMWSLSLEWMLLALLVFWAVGAYNRLAR
FT                   LRSGCVQQFGVLDAHLGQWHAMLQAFEAQPKAEGQSPALVHAQAALHQTAAQLQAALVD
FT                   ARGRPLRETALASLEHACSALDVAWQAMTKVAVDTGAGAAGTGAAPSDAPSPDPDPLQP
FT                   WQQRWTEHQVRNRLGLQQFNAAAERYNAAIAQYPARLLAWLLGFRPVRSLLVEPVASKA
FT                   QESGT"
FT   gene            548646..550034
FT                   /locus_tag="Daci_0513"
FT   CDS_pept        548646..550034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0513"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; KEGG: vei:Veis_2266 sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33159"
FT                   /db_xref="GOA:A9BRA1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRA1"
FT                   /protein_id="ABX33159.1"
FT                   /translation="MNQRTHSSPRRAAAPSQAPAAPPLWQQLDAVAQCLQSVLEGQSSR
FT                   SVLARVAQPLRPGVQALLFQVLRQLGRAQALQKQLASRNPPPRVSALLNTALALAWDES
FT                   RAPYPPFTLVNQTVEAAKQGPTRAQSGFINACLRRFLRERDALVAATDDQPQAVWNHPA
FT                   WWIARLRKDHPDHWQAILQANNEQPPMTLRVNRQQTDRQSYQAALQAMDVPSLAVADSG
FT                   LQLQQALPVQSLPGFDEGLASVQDAAAQLAAPLLLQGLEQPAGRALRVLDACAAPGGKT
FT                   AHLLEYAAPQTLEVTALEIDAERAARIADTLGRLRLQARVVVADASRPDQWFDAQCGGQ
FT                   RFDAILLDAPCTASGIVRRQPDVRWLRRESDVRQLAEIQARLLDTLWPLLQPGGRLLYC
FT                   TCSVFREEGEAQVQAFVTRNSEARTLAAPGHLIPGKADKAGMLADNALGDHDGFFYALL
FT                   QKTR"
FT   gene            550099..550662
FT                   /locus_tag="Daci_0514"
FT   CDS_pept        550099..550662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0514"
FT                   /product="putative proline rich signal peptide protein"
FT                   /note="KEGG: aav:Aave_4527 putative proline rich signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33160"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRA2"
FT                   /protein_id="ABX33160.1"
FT                   /translation="MLAGVLAGLSLQARADALTAEIGPMQLDRSDDGLLLSATLHFELP
FT                   YQIDDALRQGIPMYFVADAQIQRERWYWSDQQLATASRHYRLSHQPLTRRWRLHISSTP
FT                   FSSSGLGLALGQTFESLDDALASMQRISRWKIMDTAPTQSGVSVQLRFRIDLSQLPRPL
FT                   QIGALGRSGWNLQLSRTQMLEDAP"
FT   gene            550659..553001
FT                   /locus_tag="Daci_0515"
FT   CDS_pept        550659..553001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0515"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: aav:Aave_4526 multi-sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33161"
FT                   /db_xref="GOA:A9BRA3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRA3"
FT                   /protein_id="ABX33161.1"
FT                   /translation="MSRASADDERVALPASAGLSRGTRWAVGVGAGLMGLVGVLLLFLL
FT                   TLATNNRLDYERNYNWLFAANVVVAGLLLAILAWGGIRLAIRLQRGRFGSRLLLKLAGI
FT                   FTLVGLVPGLLIYIVSYQFVSRSIESWFDVQVEGALSAGVSLASATLETVANDMANNTR
FT                   TAGAQLSQVSDAGAALILERVRDQLGATDVVLWSASELAVMGPTQTTRSGDLAGLRAIA
FT                   SVGQSRFNLQPERPSAQMLRSLREQRAVASIEGLDDDGMAQPGATAPGAQVRTLALVPN
FT                   PSVGLLTEPRYLQATIALPQALVTNALAVQAANREYQERALARGGLQRMYIGTLTLSLF
FT                   LAVFGAVVLAIVLGNQLARPLLLLAQGMRDVARGDLRPKPALQTRDEIGGLTRSFALMT
FT                   QQLADARAEANRSMGQLDAARGNLQTILDNLTSGVIVLDARGAIVLSNPGATRILRAPM
FT                   AVHEGRLLSQVPGLEQFGEVVQEQFALFLGEQGRDRWQLVHELHASTDGGVIQHTTTLV
FT                   MRGAELPDAQRLLVFDDISEIVSAQRAQAWGEVARRVAHEIKNPLTPIQLSAERMAMRL
FT                   TDKLQPAEQALLAKSVKTIVDQVGAMKRLVDEFRDYARLPAANLQSLDLNALVTDVLQL
FT                   YGEENAEVRVDCVLDPQCPPISGDGQQLRQVIHNLLQNAQDATAQRAQESGQPPGPVTI
FT                   ETRWNESARRVRLSISDSGTGFAANILQRAFEPYVTTKVRGTGLGLAVVKKIADEHGAR
FT                   IDLGNREDDGVIQGAQVSLSFAPERTG"
FT   gene            553043..553714
FT                   /locus_tag="Daci_0516"
FT   CDS_pept        553043..553714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0516"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix
FT                   Fis-type; KEGG: aav:Aave_4525 two component transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33162"
FT                   /db_xref="GOA:A9BRA4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRA4"
FT                   /protein_id="ABX33162.1"
FT                   /translation="MANILVVDDELGIRDLLSEILNDEGHSVDVAENAGQARSARASNT
FT                   YDLVLLDIWMPDTDGVSLLKEWASAGLLTMPVIMMSGHATIETAVEATRIGALSFLEKP
FT                   ITMQKLLKAVEQGLARNAASQAPAAAPVAVVEPDTAAVVTPAASRVPVDNNVPHAHQGF
FT                   DLDRPLREARDGFEKAYFEFHLAREGGSMTRVAEKTGLERTHLYRKLRQLGVDLGRNKR
FT                   G"
FT   gene            553781..553856
FT                   /locus_tag="Daci_R0007"
FT                   /note="tRNA-Phe1"
FT   tRNA            553781..553856
FT                   /locus_tag="Daci_R0007"
FT                   /product="tRNA-Phe"
FT   gene            complement(553958..554287)
FT                   /locus_tag="Daci_0517"
FT   CDS_pept        complement(553958..554287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0517"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   mms:mma_3216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33163"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRA5"
FT                   /protein_id="ABX33163.1"
FT                   /translation="MALEHAKPLEVIALHARDGMPISTSLIRTPKLQLLRLVLPPGHAL
FT                   PSHQVPGEATIHCLAGEAGIATRLASLRLVAGSVVLVPAGELHDVHARGDQGCVLLVTI
FT                   AGAND"
FT   gene            554572..555012
FT                   /locus_tag="Daci_0518"
FT   CDS_pept        554572..555012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0518"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   rfr:Rfer_1866 transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33164"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRA6"
FT                   /protein_id="ABX33164.1"
FT                   /translation="MRLTLMTDYALRLLMHVARHPGRLCTIAEIAQAHAISEAHLMKVT
FT                   HQLALRGWIVTVRGKGGGMRLAHAPADIGLGDVVRGMEPDLAIVECFTGTSPPACTLAQ
FT                   DCRLAGVLGGALDSFMAHLDGFTLADLLPAPASLPLPHRSRA"
FT   gene            555009..555461
FT                   /locus_tag="Daci_0519"
FT   CDS_pept        555009..555461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0519"
FT                   /product="protein of unknown function DUF474"
FT                   /note="KEGG: net:Neut_0622 protein of unknown function
FT                   DUF474"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33165"
FT                   /db_xref="GOA:A9BRA7"
FT                   /db_xref="InterPro:IPR007418"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRA7"
FT                   /protein_id="ABX33165.1"
FT                   /translation="MSYGLLLTLHLLAAIAFAGTVFFEVVLLAGARRHLPAAVARATEQ
FT                   ALGDRAVAVMPWVLVVLYGAGLGLAWQHRAALAAAFAAPLASSFGLLLALKIVLALSVF
FT                   GHFLAAMWWRRRGVPGGRRSHRLHLSVFCHVLAIVLLAKAMFYLHW"
FT   gene            555532..559056
FT                   /locus_tag="Daci_0520"
FT   CDS_pept        555532..559056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0520"
FT                   /product="exodeoxyribonuclease V, gamma subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease V, gamma subunit;
FT                   PFAM: Exodeoxyribonuclease V RecC subunit; KEGG:
FT                   pau:PA14_55690 exodeoxyribonuclease V gamma chain"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33166"
FT                   /db_xref="GOA:A9BRA8"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRA8"
FT                   /protein_id="ABX33166.1"
FT                   /translation="MASHWQPGLIALHGNQTEVLADTVLAWLAAHPLDVLEPEVVLVQS
FT                   NGMAEWFKMRMAEQLGVCAAARVELPARFVWRSYRQVLGRQAVPRESPLDKTPMTWRLM
FT                   RLLPQCLHDPAFAPIAGFLRPGEPERLLQLAQRLADLFDQYQIYRADWLDAWEAGHDVL
FT                   PMPLRPGVADATVPEGQQWQPRLWRAVLAELDEDQRGATRARLQGRVLAALQSGEAPAA
FT                   PLARRVVVFGISQLPLSLLEFLAAMARHSQVLLAVPNPCRFHWADAIDGRELLRMARRR
FT                   QPLRGGRDLAQLPLEAMHAHAHPLLAAWGRQSRDYVRQLDAFDTTGAAAQLQMPRVDLF
FT                   DETDAEDLRTAPLLAQVQQRIRDLVPLAEHPPLEVARADRSIVFHSAHSVVRELEVLHD
FT                   QLLQMLARPPDPAQPGQAPLAPRDVVVMLPSIETAAPSIRAVFGQYGRHDPRHIPFDIA
FT                   DLGARASSPLAVALQWLLRLPQQRCRLSELCDLLDVPAIAARMGLAADDLPQLTRWMAG
FT                   AGIRWGLNAPQRGALGLQACGEHNSAWFGLQRMLLGYAGGVAQDGQAFGGIEPYDEVGG
FT                   LSAELAGVLAALLERMLAWWREAGRPATPEAWAQRFRALLQDFFKAQDDEDEAMLAALD
FT                   AALTDWQRACEQAGYADAVELGVAQEAWMQALEQPSLSQRFRAGGVTFCTLMPMRAIPF
FT                   EVVCLLGMNDGDYPRRATRSDFDLMALPGQQRPGDRARRDDDRQLMLEALLSARRALYI
FT                   SWTGHHVRDNSEQPPSVLVSQLRDYLETGWRGEGGQPLLAQRTQQHPLQPFSRRYFEEG
FT                   SPWTTYAREWRAAHAQSDGTDVLPALPAQPRPPFVPDASAPLTLARLTDFLRHPARAYL
FT                   RQRLQVRFEQEDNPVVDEELFQLDGLTEYLLVQQLQQQVAAGLDEPGQAPQAMEDSVRA
FT                   AVARLTRSGRLPLAGLGERGARALQSSVTPSLRAWRQQLDRYAHPAPRRRLLIEDDGLV
FT                   FDDWIDGLRQSCETEESPDADDAQCWLLLDPRNLLNAKGRPHADKLMPVYLRSLALAAS
FT                   GSQAELRVVARDGLVQVLPMDPSEALTRLRELMALWREGQNGPLPLPLRSGLAMAEGFP
FT                   AAAQQAYEGGHLVGGEGEDPSWARCYPDFERLSADGRFEALAHAAHAPLLDWVAAQVQV
FT                   LPYQGDAQ"
FT   gene            559053..562877
FT                   /locus_tag="Daci_0521"
FT   CDS_pept        559053..562877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0521"
FT                   /product="exodeoxyribonuclease V, beta subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease V, beta subunit; PFAM:
FT                   UvrD/REP helicase; KEGG: pmy:Pmen_1986 exodeoxyribonuclease
FT                   V, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33167"
FT                   /db_xref="GOA:A9BRA9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRA9"
FT                   /protein_id="ABX33167.1"
FT                   /translation="MSASEMIGDVTSHVLDAQRFPLWGSRLIEASAGTGKTWTIAALYL
FT                   RLVLGHGEGSLDGISSTAFERPLMPPDILVMTFTRAATRELSDRIRKRLIEAVQCFRGE
FT                   AEPAPHDAFLHALREAYPEGAARERAAWRLAMAAECMDDAAIHTIDAWCQRMLREHAFD
FT                   SGNLFDETLEPDESQRQTEAAQDYWRQQCYPLSDELLDEVLKIWPHVGALVDDMRALLR
FT                   EPPVPGAGEGSLADCLQRAMEQRRSRLLALAAGWDDKAQRLQLWLDGQLDGHGALWDKR
FT                   KLQPARYTGWLAALADWSRAPLDGPLALTEAARHRLSPEGLAEAFKGSAGDVLMPLELA
FT                   ELQALLLQLEQLPPVSVAVRLHAAARVAQRLAHLKRQAGSFGFADMLQRLDTALAGDNG
FT                   AVLRERILAQYPVALIDEFQDTSPLQYRLFDQIYRTAANDPHSALLLIGDPKQSIYGFR
FT                   GADIHSYLQARRATEGRHYVLGTNYRSTEALVGAVNHWFAQAEQRSGEGAFMFRRGSHN
FT                   PLPFEPVAAQGRSEQLHTRDGAMHALTVAWSAGRDEDTGIPLPLAADEVRRRFAAHCAE
FT                   QIVQWLTDPQAGFVQPDGRLVRLRPADIAVLVRTGREAAAVRRELQARAVASVYLSDQD
FT                   SVFASDEAHDLLYWLRAVAAPLDAQAVRAGLATRLIGLSLDELAWLAADEEAFDARSEQ
FT                   LRELHSIWLRLGVLAMLRQTLYRLDLPVRWLQDPAMGGERRLTNYLHLAELLQTASAQL
FT                   EGEQALIRWLATQIETPGSGSEEQVVRLESDADLVKLVTVHKSKGLEYPLVCLPFAGSF
FT                   RPMERARTPFLTLSAQDESQDDAAPARRLLLDFSDEELAQADRERLREDLRLFYVALTR
FT                   PRHALWLGLAPLKRGNGKACVNEQGAAGYLLGGTEPRSAQGWRDGLQQLCGEDPHMAWR
FT                   DLDAVPLQRTRWQPPAGATPLHDAPAYDARFDTRWGIGSFSALVRAMAAPSLPVLPVAV
FT                   QRPAEDEQALEPPPSPELADIAGLAGLQPLQDGPAGGPAVWHRFLRGPVVGNFVHDQLE
FT                   WLGGEDFALPVDGQGALADRLVRRCERAGRGEQARDLLAWLTAVVHQPLAPLDVTLATL
FT                   GPQLSEMEFWLPARQLPAERIDQLCRRFILPGQERPALPQRSLHGMLMGFADLVFCHEG
FT                   RYWVLDYKSNHLGPDGAAYGQEALARAMLHHRYDVQAALYLLALHRLLRSRLGTAYEPQ
FT                   RQLGGALYYFLRGIDGPAGGMHAMAPELPLLDALDELLGPGRADIQEPP"
FT   gene            562874..565081
FT                   /locus_tag="Daci_0522"
FT   CDS_pept        562874..565081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0522"
FT                   /product="exodeoxyribonuclease V, alpha subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: pmy:Pmen_1987 exodeoxyribonuclease V, alpha
FT                   subunit; TIGRFAM: exodeoxyribonuclease V, alpha subunit;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33168"
FT                   /db_xref="GOA:A9BRB0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041851"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRB0"
FT                   /protein_id="ABX33168.1"
FT                   /translation="MSPRPRSRTVDTATLDLFDERPGDDSPGGETPGDASLGGKPPGAV
FT                   PPDTNELLALLRRWADAGLLRRLDAALASFVAGQDAQAGPALLVAAALLAQMEGRGHSC
FT                   LPLAPLAGNPNDVLAWPAEALPAQQALWQILPARLSGWVAALGASPVVRVVGDAGQDGG
FT                   EDLGQPLVLAGADGPAPLLYLRRYWDYERAVAIHVIQRTAVQAVAAQPLDEALARHWLD
FT                   RLFPPAAGGGPVDWQKLACALALRGRLSVITGGPGTGKTYTAARLLALLFATAPDAGQL
FT                   RVALAAPTGKAAARLKQSIDGALLQLQGSMGGEIDLAGLVQRMGAARTLHSMLGARPDT
FT                   RHWGFHAGRQLDVDVLIVDEASMVHLEMMAALLEALPAGARLVLLGDKDQLASVEAGAV
FT                   LGDLCRDAQAGRYLPDTLDYALRVADQAVPPQFAAPAGDRPPALAQHTVMLRESRRFGG
FT                   PIGQLARAVNAGHAAQAQALLDAGTQGGTHSELWERQGGGVQAVTELAVGGRGGLASYA
FT                   LYARALQNRPAADGDYEAAHRAWVIDVLQAFERFRLLCAVREGDWGVSGLNRAVEQALE
FT                   AQGAIRRSGEWYAGRPVMVTRNDAQLGVFNGDIGIALPGGSQGGSHGGSQGGPQGGPGQ
FT                   PLRVYFLQGDELRSVGVSRLAHVETAFAMTVHKSQGSEFEHTALVLPSRGGSVLGRELV
FT                   YTGITRARQAFSLFSEVPGLLASAVGSPTQRASGLLRWLQD"
FT   gene            complement(565100..565762)
FT                   /locus_tag="Daci_0523"
FT   CDS_pept        complement(565100..565762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0523"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   vei:Veis_4930 glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33169"
FT                   /db_xref="GOA:A9BRB1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRB1"
FT                   /protein_id="ABX33169.1"
FT                   /translation="MLTLCGFAASNYYNKVKLALLEKQLPFNEELDWLGETDMALSPLG
FT                   KVPYLRIDDGRGLCESAAMVEYVETLSPSPALLPADAFEAAKVRELCVYLDLHLELVAR
FT                   ILYPQAFFGGQVSDSTRERTLAQLDKNVAAFAKLARFSPFVAGDSFTLADCCAIVHLPL
FT                   VSAASKIVGGRDVLADLPVREYLARMAERPTVQQVNADRKTNTALMMSRYASDKTPA"
FT   gene            565882..566241
FT                   /locus_tag="Daci_0524"
FT   CDS_pept        565882..566241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33170"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRB2"
FT                   /protein_id="ABX33170.1"
FT                   /translation="MPLRLPSTLAACARWVLGLWLCVALASAFAPLARASGWERLCSAA
FT                   GESVWVPSPAGQDNALAGSHGIDCPLCLPPLAPPPARCSAAPAPLMADAPPRAHPASVH
FT                   SVAMPALPQARAPPR"
FT   gene            566338..566850
FT                   /locus_tag="Daci_0525"
FT   CDS_pept        566338..566850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0525"
FT                   /product="protein of unknown function DUF461"
FT                   /note="PFAM: protein of unknown function DUF461; KEGG:
FT                   pna:Pnap_1514 protein of unknown function DUF461"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33171"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRB3"
FT                   /protein_id="ABX33171.1"
FT                   /translation="MTLRQWTTPFLIAASLSMGLAHAHADAAHVKADAAWARASVPGQQ
FT                   ATGAFMRLTAEEPLRLVGVESPAAGLAEVHEMKMEGDVMRMRAIDGLDLPKGVAVDLKP
FT                   GGYHVMLQQLKSPLLKDSQVPITLVFKDAKGETSRLSLQVPVRAMAPGAAAAPAAGHGG
FT                   GHAGHSH"
FT   gene            566993..567949
FT                   /locus_tag="Daci_0526"
FT   CDS_pept        566993..567949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33172"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRB4"
FT                   /protein_id="ABX33172.1"
FT                   /translation="MSDASSFGFGKFIPGFDFLQGLAQSAGSATARPLGRLPEWVAPTV
FT                   SIEEVDKRITELKAVQFWLDQNGKALAATIQALEVQRMTLSTLQGMNVSMGELAQAFQF
FT                   PAAAAATAAAATAGKGAASAGQSDHSDWPMSSAGKAGKQEKPQAAPAQPPAEPPAAAAA
FT                   AASADAGSKASGPEASAPKDEPAQAAAMGQAMQWWGALTQQFQQIAAKAMAEPMAPEAV
FT                   AAAQRATGMAGDIAKAAMDRMTAQAGAFAAQAGKAAAPAAKAPAEAAKAPAKAPAKAPP
FT                   KAPAKAAARKTAAKTTAKTTAKAPAAGKAPAKSRPPR"
FT   gene            568026..569261
FT                   /locus_tag="Daci_0527"
FT   CDS_pept        568026..569261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0527"
FT                   /product="domain of unknown function DUF1745"
FT                   /note="KEGG: aav:Aave_4508 domain of unknown function
FT                   DUF1745"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33173"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRB5"
FT                   /protein_id="ABX33173.1"
FT                   /translation="MSLFPVGHASHSDWRAAADAVLLQLRSQMADPGHAQRPRLGLVYL
FT                   SHAHAAHARPLLQHLARALPHVADWAGCSAGGVLAMPHEYLSGSALAVMLLDVPAAHYR
FT                   LYSGLAPLHAPGGEAGFTAHSALVHAGGGQPELAELLYELSERTESGLLFGGVGDDGDD
FT                   GVEGVQIACRTEDLHAQHADARGIFSGGFSGVAFGAGVPCITGMAQGCVPLGEGLEITE
FT                   ARGALVTGLNGDPALQRLLQLLGVELEGSDWQPALTTVRSTLAAIAPPGRGMAHGVLTE
FT                   EAQVLTLVGLDPLRQGVALSSAVEAGHSVIFCRRQAQVARQELLQLGAALRDAAEPEEA
FT                   APEGEAQPRIRGAIYISCRGRGGGLFGGPDAELRTLRHALGDVPLIGFVAEAEIMDARL
FT                   HRFAGVLTVFTA"
FT   gene            complement(569285..570616)
FT                   /locus_tag="Daci_0528"
FT   CDS_pept        complement(569285..570616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0528"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ajs:Ajs_3886 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33174"
FT                   /db_xref="GOA:A9BRB6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRB6"
FT                   /protein_id="ABX33174.1"
FT                   /translation="MRVIVLGAGLIGTASAYYLQSLGHEVTVIDRQAAPGAETSFANGG
FT                   QISVSHAEPWANPGAPLKLLGWLGRQDAPLLFRLRADMRQWLWGLSFLRNCTPARTRHN
FT                   IQQIVRLGTYSREALQQLRSDTGIQYEQRMQGILHFYTNAREFEGALKPTEQMQALGCD
FT                   RRLIDADEAVRLEPALAHVRGQIAGATYTAEDESGDANLFTRELARIATTTGVQFRHGH
FT                   HVMALRTTGAGASRHIDHVEVTNADGRYERIQGDAYVLAMGSFSPLLAQPLGLHLPIYP
FT                   AKGYSVTLPVLDPAKAYQVSLTDDEFKLVFSRYTGAQGDRLRIAGTAEFNGYDRNLDPV
FT                   RCEAIVRRVQQLFPGAGDTGRAQFWSGLRPATPSNVPLIGRSPIANLFLNTGHGTLGWT
FT                   HACGSGMALADLVSGRQPAVDFDFLGAAAMDPDRSAGTVRPRAV"
FT   misc_binding    complement(570709..570814)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   43.57"
FT   misc_binding    complement(570817..570913)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   34.38"
FT   gene            571464..581093
FT                   /locus_tag="Daci_0529"
FT   CDS_pept        571464..581093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0529"
FT                   /product="Ig domain protein group 1 domain protein"
FT                   /note="PFAM: Ig domain protein group 1 domain protein;
FT                   KEGG: mmu:239611 mucin 19"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33175"
FT                   /db_xref="GOA:A9BRB7"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015217"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRB7"
FT                   /protein_id="ABX33175.1"
FT                   /translation="MQMRWVQLMAIAIGKIIFLSYLLEKTGNIMHALNRLPGLAFFRKW
FT                   RAAKCLFSLLLLSCAGISSTALAATIVFTVTDNSDAPNANATTPTTCVSTLGGTFAGAC
FT                   TLRAAIQAANYTLQTLDPSADVSIVFAPTLSTSVRTIQSGTSKDAAGNLFPYVDNQTVY
FT                   VRCANTFVSGAQSGAVTGATNACGQTQMISGGDTGTTTGAGGAWYWIKGTVPAGTGSLT
FT                   IDFGGVIQVQNWADSAWETFYLGGKNITLTNSPNMTCGEALFVVGSQANNVIIDRVGLV
FT                   NVAPTPAGEGTPFNCELYAEIHQGAQNVFFANSTINSAIWNGNYGNNKGSAISVAATNG
FT                   TGTVSNIVVDNFTVTNLPNPIGGMQLEQFFQVMSNMTVNGLTIKNSNIALSPTGGNAPR
FT                   SVVSVDGAISLANGIGLAVKGNNFSLPIAAYTASSPTHVSAPTVNTAASGTTQVVTVSD
FT                   NNFTGGGDGVNIGGTGTAPGLIGNNKMTSQSRSAIRITAHDFFKLSQNTLFSVPVAANS
FT                   GISLLTAGNGQTGWTPTLGVGASDTAACTWTFNITANANASEPAPYTVEAFWSPTGAGV
FT                   NDAQVYLGSGTMAGASGTLTVPSYLSGQVRVTVTDSNSGGAQTSQLSTAASVTGFPCAL
FT                   KSGVLATTNNQPVGSSDLLEVYIVDGQGNAWTGGSDTVTFAAPPAGVTFNGGSAAVSCT
FT                   TNSSGKCASPINASSSVAGTFTTPVTLSSSVAGATFSNLPLGGSPVSGAVTYQPSPVAY
FT                   SFTALPASTSGSEIAASPPSIAANGVSTSTLAVQLKDALGNLVTTCTDTVAFTLNAGTQ
FT                   GVPAVSVTGCSAGMYTGTVTSPVLVGSGTFGFTINGSAAVATATVSYAAATPSTSASTI
FT                   AATPASIVANGSSTSLLRVQLVDASSNPINTCTNTVAFTLKGGTQGTPNVGAASCTAGI
FT                   YTGTVTSPTAVGSGIFGFTINGSAAVATASVSYTAGPPSTSASTIVASPTSIIANGTAT
FT                   STLTAQLKDASGNSIATCANTVAFTLNSGTQGSPAVGAGSCSAGVYTATVTAPTAVGSG
FT                   TFGFTINGSAATATAVVNYTAGSPSNGANGNLISASPLSVVADNTATSSISVTLRDANG
FT                   NPATDTVAHTIVFTKTGAGTTTPAAPTCTIAANANPATCSVTVKSATVGTASFTATDNG
FT                   TAVSNGSPISVNFIAGPPSNTASGNLLSATPLSVMADGTSTGTVTVALQDANGNATVDT
FT                   VAHTIGFVHTGAGTPSATSCTIAANANPARCSITVTSTVAGAASFTATDNNGTTTQSVA
FT                   NGSPAVINFTANAADPARSGVRTVTSPVTANGSATDVLEAFVGDVNGNPVAGSVVTFSP
FT                   TANITFSGTCTTNAAGTCQVTAKTTVAGSYTSGASIASGALSGSGVSSGGNTYGATAAY
FT                   VFTAGAVDPANSTMSVDVNNQAAGGGQDVVSVVTKDAFGNPVTGVAVNFSVTPAGAAPA
FT                   TASCTTAGAAATCSVSFTSVTASTYSAAATVGAAAIGNSPQSMAFVAGNASASNSGLRV
FT                   VSDNAAANGTATDVVEAYVRDAGGNPKGGEVVTFAGTAGVKLNGGAAGASATCTTGTSG
FT                   ATLGICSITATSTASGTYSIATSIPAGTLGGTFTVGANAYSPSAAQIHFVSVVNLSVTK
FT                   ANPGSLAVGTPFNYAFSVSNAASAFGPANSLTIKDLVPAGISITGVPTGANVASATCTP
FT                   NAFPFAGNGSSVLTCTVNFTAAVAAGGNTSFNLPAVPTAVGSSTNTASYDPSGGISPVN
FT                   PTAGCTTDCASTPSTPVTPGTPALTVTKANPGSLAVGTPFNYAFSVSNAAGAFGPATSV
FT                   TIKDLVPAGISITGVPTGANVASATCTPNTFPFVGNGTAILSCTVNFTAAVAAGGNTSF
FT                   NLPAVPTAVGSSTNTASYDPSGGISPVNPTAGCTTNCASTPATPVTPGTPALTVTKANP
FT                   GSLAVGTPFNYAFSVSNAASAFGPATSVTIKDLVPAGISITGVPTGANVASATCTPNTF
FT                   PFAGNGSSVLTCTVSFTASVAAGGSTSFNLPAVPTAVGSSTNTASYDPSGGISPVNPTA
FT                   GCTTDCASTPVTPVTPGTPALTVTKANPGSLAVGTAFNYAFTVANAAGAFGPANSVTIK
FT                   DLVPAGISITGVPIGANVASATCTPNTFPFAGNGSSVLTCTVSFTTPVAAGGNSSFNLP
FT                   AVPTAVGSSTNTASYDPAGGISPVNPTAGCTTDCASTPSTPVTPGTPALTVTKANPGSL
FT                   AVGTAFNYAFTVANAAGAFGPATSVTIKDLVPAGISITGVPTGANVASATCTPNTFPFA
FT                   GNGSSVLTCTVNFTAAVAAGGNTSFNLPAVPTAVGSSTNTASYDPSGGISPVNPTAGCT
FT                   TNCASTPSTPVTPGTPALTVTKANPGSLAVGTPFNYAFTVANAAGAFGPATSVTIKDLV
FT                   PAGISITGVPTGANVASATCTPNTFPFAGNGSSVLTCTVNFTAAVAAGGNTSFNLPAVP
FT                   TAVGSSTNTASYDPSGGISPVNPTAGCTTNCASTPSTPVTPGTPALTVTKANPGSLAVG
FT                   TPFSYAFSVSNAASAFGPATSVTIKDLVPAGISITGVPTGANVASATCTPNTFPFAGNG
FT                   SSVLTCTVNFTAAVAAGGNTSFNLPAVPTAVGSSTNTASYDPSGGISPVNPTAGCTTNC
FT                   ASTPSTPVTPGTPALTVTKANPGSLAVGTPFNYAFSVSNAAGAFGPANSVTIKDLVPAG
FT                   ISITGVPSGANVASATCTPNTFPFVGNGTAILSCTVNFTAAVAAGGNSSFNLPAVPTAV
FT                   GSSTNTASYDPSGGISPVNPTAGCTTNCASTPSTPVTPGTPALTVTKANPGSLAVGTPF
FT                   NYAFTVANAASAFGPATSVTIKDLVPAGISITGVPTGANVASATCTPNTFPFAGNGSSV
FT                   LTCTVNFTAAVAAGGNTSFNLPAVPTAVGSSTNTASYDPSGGISPVNPTAGCTVNCAST
FT                   PATPVTPSTQVPVAPTLTVSPTTVGGYPQISGTGTPGYTITVKDGSTTLCTAIVAADQT
FT                   WSCTPGGGLPTPGLHTISATQTNPGNGNTGPATTTSLNVLGTTFTGPTATGAGNATATL
FT                   SGGGAGCGFDVSQSSFVAAAAGAPGQLSFPYGNVHFVARGCTASSSITVSVTWPGPVTG
FT                   MAYWKFGPASAGAADSWYQPPGAVVSGNTTSVVVTDGGQGDDDRAANGVIVDPSGPARV
FT                   GAAPDATPIPALEPRMLAMAMLLMLAAGLWNLRRRRG"
FT   gene            581400..584057
FT                   /locus_tag="Daci_0530"
FT   CDS_pept        581400..584057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0530"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; PepSY-associated TM helix domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: aav:Aave_4788
FT                   flavodoxin/nitric oxide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33176"
FT                   /db_xref="GOA:A9BRB8"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRB8"
FT                   /protein_id="ABX33176.1"
FT                   /translation="MDFRPTPPARLLPMTFKKIWFQLHWFVGITAGTVLIVIGLSGAVF
FT                   SFHEEILGWMNPGTASVPARNAAPLAPPQVAQALREAGEQRVVQRITVFAEPGRSAQVA
FT                   FKPPAGQRRGQTVFVDPYTGAQLPEQHGTEFFEWVERLHRWLLLSRDDGKPITGTLAGL
FT                   LLMLSLSGLYLRWPRRPLSWRTWLTFDPALKGRSFLWGLHSVAGTWALVAYVVFTCTGM
FT                   YWAFGVVRSTVDGWAGVPPRVAAPAAPSSKTGGGRPEPAGAQQPIDIAPGWAAFERIAH
FT                   GWQFAQLRLPERAGQPLQISWLDAEAAHERARNQMALLPDGTVQRDERYAGLPTGRRAV
FT                   GAIYPLHMGTYFGMPGRIFMTLASLIMPLFAITGWMLYLDRRRKARALAKERQALMKEP
FT                   PPSAPAGQDTVLVAFASQAGRAERLAVATVAALRGAGMAASLQSVAALDAEQLRHHRRV
FT                   LFVASTFGEGDPPDAARRFARLLGAASGSALPHLQYGLLALGDRQYAAFCGFGHALDHQ
FT                   LRRLGAQPVFPLIEMDGEQPQAWNAWQQALAGHFGALPPASDALPASAAGPLADATAFA
FT                   AWPLQARSLCNAGSQGAGLYVLELSPPEGVAPLWRAGALAEVLPRHGAATVQAWLAAQE
FT                   CDGSAPVQWRQQTCTLGEALAASVLPAPGDIAPGTAPQAVADALRPLLPRSYSVASLPQ
FT                   DGHVRLLVRQARHDGGLGVASGWLTAHAAQGISVAMRLVENRAFEPRDEADAEPDAPAI
FT                   FIGNGSGYAGLRGHLLARMHAGRHRNWLLFGERQRAHDGYCEAEVSGWLAAGKLQRADF
FT                   IYSRDQARRRYVQDALREAAEPLRDWIADGAVLYVCGSADGMAAGVDAALADILGATAV
FT                   EDLIVEGRYRRDVY"
FT   gene            complement(584210..585370)
FT                   /locus_tag="Daci_0531"
FT   CDS_pept        complement(584210..585370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0531"
FT                   /product="uncharacterized peroxidase-related enzyme"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; uncharacterized peroxidase-related enzyme; PFAM:
FT                   Carboxymuconolactone decarboxylase; KEGG: aav:Aave_4506
FT                   uncharacterized peroxidase-related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33177"
FT                   /db_xref="GOA:A9BRB9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRB9"
FT                   /protein_id="ABX33177.1"
FT                   /translation="MTTANDTIDRLAGLTDQSPVFATRRQRDKVAIATQACEDLLLGDG
FT                   LADSLSRAERLVLASEQCRVSGVQALADEYRQRAESLGDALTPALRTVLAQPGAQTGNA
FT                   RLDAALHFVRTLALHPAESDRAALLAMPESGLSIDDTVLVAQLVGFIAYQLRLFAGVQA
FT                   MDALGGQASAPAAEAAAAPFVHPANLPPPGEPLRRNGYTSETLDWTSWLPVLDPATATA
FT                   EQQAVLDLSHPKARTSDFYLLLARQPRVLSERSQAFNAIMYAPGGLSRAEREVAATAVS
FT                   RSNGCVYCASVHAQRFEQLAKRNDVMAQMFDDPDTAGTNARERAIIQSSLALTRAPGSF
FT                   GAAQLQPLRDAGLTDQEILDMLHSAALFGWANRLMLNLGKERYITP"
FT   gene            complement(585378..586859)
FT                   /locus_tag="Daci_0532"
FT   CDS_pept        complement(585378..586859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0532"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: aav:Aave_4505 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33178"
FT                   /db_xref="GOA:A9BRC0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRC0"
FT                   /protein_id="ABX33178.1"
FT                   /translation="MSLTEPAAPAPAGLAALEERLRDDLVALGWPAKAWIPPSTRDGQP
FT                   VHDVLVIGAGQAGLALSAALSQLGIAAVLLDKAPLDFEGPWATTARMETLRSPKELTGP
FT                   ALGLPSLTFRAWFIAQWGREAWAALDKIPRLQWMDYLRWYRRVMRCDVRNGHQVTAIRP
FT                   QADGTVEVDVTADGASRTWLARRVVLATGRDGLGGPQIPAFMQGVDRSRWAHSSDVLDY
FT                   RRLAGLHVGVVGAGSSAMDSAATALENGAASVDLLVRRSDLPRINKSKGSGTPGLTHGQ
FT                   FLLPDAWKWRIRHYINVQQVPPPHGSTLRVSRHANAHFNLGCAVQKVEQDGDRLRVDTP
FT                   RGVFVLDFLIVSTGFAIDWRQRPEFADLAPHVRIWSDRFVPEAGAEDQELSDSPDLGPL
FT                   FEFQEKTPGALPGLDHVHCFCYPAALSHGTVSGDIPAISDGARKLAQGLASLFYREDLE
FT                   HHYAQLQSYSEPELDGGEWTPADPEARVRALADKT"
FT   gene            complement(586925..587959)
FT                   /locus_tag="Daci_0533"
FT   CDS_pept        complement(586925..587959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   aav:Aave_4503 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33179"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRC1"
FT                   /protein_id="ABX33179.1"
FT                   /translation="MIHRISLHTMRPSFFRSWIPAAAAALAVFGSTAAVAADSAASWPH
FT                   QPVTMILGFPAGSGVDVIARGVQEPLSQRLGQPLIIDYKSGAAGNIASEIVARAKPDGY
FT                   TLAFGTAATHGSNAALYKKLPFDVETDFVPVAPLIDVSNVLTINPNVINVKNLKEFVDE
FT                   IKANPGKYNYASTGNGAGTHMAFAEFNARLGLNMVHVPYKGGPEAITSVLRGETCCIMN
FT                   QVQTVLPHYKSGKVRLLGVTTAKPVEVIKEVPTIASSGLTGTKGFDSSIWFGIFAPKGT
FT                   DPAIVAKLSQAVREVLELPEVRARFESQGNAIRIETPEQFKKTVHNDRLKWAQVVKDAK
FT                   ISID"
FT   gene            complement(588095..588484)
FT                   /locus_tag="Daci_0534"
FT   CDS_pept        complement(588095..588484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3882 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33180"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRC2"
FT                   /protein_id="ABX33180.1"
FT                   /translation="MISLRTPLIAATLALAGWAGTAQAQANVTYAAPGAAISVQFGAPP
FT                   PMRYEAVPAPRRGYVWAPGYWRPQGHRHAWVAGHWVKARPGYVYRQPVWSQHGGRWGYA
FT                   PGRWDRDRDGVPDRHDRRPNNPYRH"
FT   gene            complement(588667..589407)
FT                   /locus_tag="Daci_0535"
FT   CDS_pept        complement(588667..589407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0535"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   aav:Aave_4499 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33181"
FT                   /db_xref="GOA:A9BRC3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRC3"
FT                   /protein_id="ABX33181.1"
FT                   /translation="MSTTADLVIALKKELKAAQMTYADLARALGMAESSVKRMLAKGDM
FT                   PLSRIDAICRALSLDFADLARRVADSQPLLQEMTPEQENAVVADRKLLLMAICVLSQWT
FT                   LEQIVATYRMTEAEGIRYLAQLDRIGIIELRPGNRYRLRLAKTFRWRARGPVMEYFREN
FT                   AVLDYFGGGFDQPGEGMLMVHGSIGRHLAPSFVERIQRLAHDFSQQHLQDQRLPPGQRE
FT                   GYTLVLAMRSWEFTAFTALRRGTV"
FT   gene            589522..590346
FT                   /locus_tag="Daci_0536"
FT   CDS_pept        589522..590346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_1658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33182"
FT                   /db_xref="GOA:A9BRC4"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRC4"
FT                   /protein_id="ABX33182.1"
FT                   /translation="MPSVSISPAAALRALYWGAALLLLAAWLGPAVPQPQDFHAFADQR
FT                   AWGALPHALDVLSNLGFAWAAVAGARLLLDRRSQALAPALRWLAALFFTGLACSAIGSS
FT                   VYHWAPHDATLAGDRLGMSMAFAGMLGLALQSRIADRVAVRAAVAMLVAAVASVLVWLH
FT                   GGNLLPWALVQGGGMLAVLGLACVAPRHGALALRLGVVIAWYGAAKLLEWGDVVVFEAT
FT                   AGLVSGHSLKHVVAAAAALPVIAALRAAGTARMASTGTMCADACGHGGATNR"
FT   gene            590358..592322
FT                   /locus_tag="Daci_0537"
FT   CDS_pept        590358..592322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0537"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; major
FT                   facilitator superfamily MFS_1; KEGG: ajs:Ajs_3878
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33183"
FT                   /db_xref="GOA:A9BRC5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRC5"
FT                   /protein_id="ABX33183.1"
FT                   /translation="MFQQETGSPSAPTATAGAVPSAAHEHPNQFALLGQRRFAPFFWTQ
FT                   FSGAANDNLFKFALTVMVTYQLSVSWLPSAMAGLVIGALFILPFLLFSATSGQLTDKWD
FT                   KTRMFRLVKNLEIAIMALAAWGFIQANVPLLLGCVFLMGLHSTLFGPVKFAYLPQVLSE
FT                   RELTGGNGMVEMGTFVAILLGNVAGGLLVAVPEVGHMQVAVACLALAVIGRIFAQFIPN
FT                   APATDPHLVINWNPFTETWRNLQLAREQPAVFRSLLGISWMWFFGAVFLAQFPSFAKEV
FT                   LHGDEHVASLLLVVFSVGIGTGSLLCEVFSRRHVEIGLVPLGAIGMSVFAVDLFFASRA
FT                   LPASELMGVGAFFAQPAHWRVMADLGMLALSAGIYSVPMYALIQMRSQPTHRARIIAAN
FT                   NILNALFMIASSVLAGALLAAGFSIPQVFLITGIANAVVAAYIFLLVPEYLLRFVAWVA
FT                   SRFVYRFKVQGDEHIPATGAAILACNHVSFVDAVLLMAASPRPIYFLMDHRIFRVPVLG
FT                   WLFRLAKAIPVAPQKEDPATYEAAFERAAQVLREGDLLAIFPEGGITRDGQLQEFRGGI
FT                   MKIIERAQADGLQVPVVPMALTNLWGSYFSRIEQGGAMVRPFRRGLFNRVGLNVGQPMA
FT                   QSEVQPALLRERVLRLLAA"
FT   gene            complement(592319..593503)
FT                   /locus_tag="Daci_0538"
FT   CDS_pept        complement(592319..593503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0538"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   pat:Patl_0966 saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33184"
FT                   /db_xref="GOA:A9BRC6"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRC6"
FT                   /protein_id="ABX33184.1"
FT                   /translation="MTKPFDLVVHGATGFTGRLVVEYLLRRYPAGSGLRWAMGGRNAAK
FT                   LAAVRDELGAPADTPLVVTDTGIPASLQALMEQTRLVLTTVGPYQLYGNELVAACASAG
FT                   VDYVDLCGEPAWMRQMIDAHEAAARASGARIVFSCGFDSIPFDLGVFMLQREMQARFGQ
FT                   PAQRVRGRVRKMKGTFSGGTAASLKATMAAAAAQPGVLELLRNPFSLTPGFEGPRQPSG
FT                   SKPMVDEVLGLWVAPFVMAAINTRNVHRSNFLLGHAYGADFVYDEMMVTGAGEKGEALA
FT                   NAVAADKSLGADDGPKPGEGPSREERESGFYDVLFIGTDAAGHSLRVGVKGDRDPGYGS
FT                   TSKMITEAAVCLLQDAPDTPGGIWTTAPAMGNALIARLKANAGLSFTVEEQNPS"
FT   gene            593814..594287
FT                   /locus_tag="Daci_0539"
FT   CDS_pept        593814..594287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0539"
FT                   /product="YiaAB two helix domain protein"
FT                   /note="PFAM: YiaAB two helix domain protein; KEGG:
FT                   aav:Aave_4490 YiaAB two helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33185"
FT                   /db_xref="GOA:A9BRC7"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRC7"
FT                   /protein_id="ABX33185.1"
FT                   /translation="MSSSPIVVQRDTRAWQLQVWVSFGIAVSLCAIGLAWLPGEQLEQA
FT                   FMVMGYVFCLSAAFVLAKFVRDNEGGRSGAGDTPMWKLVVWGGFAVSMALTGWGLVSMD
FT                   INVTYKAFLGVSWLYLITTAFTLAKMLRDRHEADLAQARMHGRREAAQPADAE"
FT   gene            594325..594795
FT                   /locus_tag="Daci_0540"
FT   CDS_pept        594325..594795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33186"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRC8"
FT                   /protein_id="ABX33186.1"
FT                   /translation="MMVNQSVFARLPRALLTAGALCAALAMAPAHAQSEASVALSMLPV
FT                   ASVVGTASVASTAAGAVVALPAALSVGGAVLTVKAVQASATGTVYLLERASDGAQASVE
FT                   VVGRGASASAYAVGTVLTCSVIGAGVVISAAGKVLAFIPNEMGKALLHNERL"
FT   gene            594804..595622
FT                   /locus_tag="Daci_0541"
FT   CDS_pept        594804..595622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_4488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33187"
FT                   /db_xref="InterPro:IPR014547"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRC9"
FT                   /protein_id="ABX33187.1"
FT                   /translation="MKPSLSPSPVARAACLVLLLAAALGTAHAGRSCEDKPLTPQSLQK
FT                   GLDLAQRTSQALDAEYAKNGTRVVLLARVGQDLSKYDLHYSHYGWAYRTPEGPWRVAHK
FT                   LNECGTAGGHVYRQGLGEFFLDDLWRYEAGVQVPTPAVQQALWTFLTQPQTVLRLQHEP
FT                   YSMVSYAWGQRYQQSNQWATETLAAAMEPATVQRREQAQAWLQFKGYEPGVLVIRALSR
FT                   LGGRVTAANIAFDDHPNDKRYASRIETVTVESVTQWLQRSQLAGPVRVLP"
FT   gene            595690..596814
FT                   /locus_tag="Daci_0542"
FT   CDS_pept        595690..596814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33188"
FT                   /db_xref="GOA:A9BRD0"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRD0"
FT                   /protein_id="ABX33188.1"
FT                   /translation="MSKALRLPEKWFRRGLWLVAVVFASFLIGLGGLVVGDLPQVESPR
FT                   TVEDFIAPAAAEPVKAEIKAADADHDKAETALQNARLKYQATQARYRSARETFDNWVAT
FT                   RRATARPEQDSELLSRTQALDAIKQEENAARAAVERLQDASLQARQRLDAANRQWDGLR
FT                   DGAMQAWRKEMRAIELRVFLYRLALTLPLLLVAGWLFAKQRKSTWWPFVWGFIFFALFA
FT                   FFVELVPYLPDYGGYVRYVVGIVVTVLLGRAAILGLNRYLERQKQQESLPETQRRQELG
FT                   YDVALARLAKGVCPGCERPVDLKDGAIDFCPHCGIGLFDRCGSCNTRKSAFVHYCHSCG
FT                   TQADGNRRKPGAVLPSTSAAPAVPPVQEAGPAAG"
FT   gene            596924..598186
FT                   /locus_tag="Daci_0543"
FT   CDS_pept        596924..598186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0543"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: rca:Rcas_2750 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33189"
FT                   /db_xref="GOA:A9BRD1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRD1"
FT                   /protein_id="ABX33189.1"
FT                   /translation="MACALGRGADVFSEDAMSRQLPYPPQHTPAQPAQPPAGASAHLLP
FT                   LAAWAVGAALLAAHVLAGPSSWKAWAAYAALSALAGMAWVWRCHAAGLPLTRTLRGHGW
FT                   IQATMALLLAAWQPSLAWASALLWLAAIAWLPWDGEREQALHLPAGQIVLLCAMLAMLC
FT                   AVVVARPMPQMAPGSVAVRILWLASVLLPLAVHALALWQALSRMQRQYTEELAQLSSYC
FT                   GQLADDVQQLQTRVGSLQLPTGRDTLTGVANYSRLMDAVDGLRERHARKPEPFCVVLLE
FT                   LDPWVERAGVHPPHKGPSLQERVLLMLSGLLVTHLRTVDGIGRYRDDTFMLVMPDTASV
FT                   QAVWALQRVREGVRQQHWSEKPIPDPDKDPLTLTLAVAEFQAGETSERLVQRAEAALAH
FT                   GRACGRNQIVVAEDVRPPRTS"
FT   gene            598230..599474
FT                   /locus_tag="Daci_0544"
FT   CDS_pept        598230..599474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0544"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bra:BRADO2669 conserved
FT                   hypothetical protein; putative membrane protein; putative
FT                   diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33190"
FT                   /db_xref="GOA:A9BRD2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRD2"
FT                   /protein_id="ABX33190.1"
FT                   /translation="MGAHEGRRPAALLRMPVLSSISRNFPDRLLWGPKPASPLVDEALH
FT                   LERWKRRTWQLHISVLVSHIYALLLFLGHAWAGYAPWAVVLGYGLWVAAGMGFITWAYA
FT                   SDWCHRLRDPGMFLTHQLVSIIGVLGMVMAAPALAFQSMVMLIAFSADGFLARSRTSFW
FT                   LTWMGTLIAVAAIILWRGPLMRMTTDTAAGQLLAFGVVLGAVVRCSVQATFFRSMQYRL
FT                   GIANDKLATALAQIEALLRHDDLTGVSNRRGVIERLHEVRTAAHDRGTVLCVALLDIDH
FT                   FKRINDSFGHEGGDRVLRAFGTLLKSQLRSADGVGRYGGEEFLLVLPDTDLAQAGELLE
FT                   RLRLRIAEAPWTQTLGEGARVTCTLGAAQYRAGESVEATIARADAALYRGKAQGRNCTV
FT                   LEPQQARPAPSATPA"
FT   gene            599595..600365
FT                   /locus_tag="Daci_0545"
FT   CDS_pept        599595..600365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll7009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33191"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRD3"
FT                   /protein_id="ABX33191.1"
FT                   /translation="MNQWIAETAGNIAGNMAVDIAGWEGHLSSGPRQLQAGPLSAELAD
FT                   GCLRSVRYGSLEILRSVAFAVRDEQGDRCVHGSGELSLREKGDRFEVLYETAVDCGALR
FT                   LAWRVRIAGSARGLGFTAWARALDGMEGGLQRGLRGGCAGLEIVYPRNALAGRSVHVEH
FT                   ADGSAQSTVLPEPDALLRLSQLSAITHEPAPGLRVGCRLEGAEFEMVGQCCGGKSFFRL
FT                   QPRAQSPAHSYLLTRGRALVQMASFSFAAPGAMQ"
FT   gene            complement(600395..601393)
FT                   /locus_tag="Daci_0546"
FT   CDS_pept        complement(600395..601393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   reh:H16_A0091 probable extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33192"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRD4"
FT                   /protein_id="ABX33192.1"
FT                   /translation="MSLNRRQLAAWMLGAPWLSPAARASTAGADAWPSQPLTVVVPFSP
FT                   GGSVDVAARLVMPRLAERLRQPVVIENTVGASGTIATQRVIKARPDGHTALFGVASCVL
FT                   IAPLVSPERFRYDGLRELLPVAPVASSAFVLAGRPDLPATTAAELVQLSRQQPGRLTVG
FT                   TDGVGTSLHLTAEMLQQQAGLSWTHVPYKSGPQALTELAGGQIDLAVLPVALVQSFVRE
FT                   GKLRGLGVTSRLRAATLPQTPSLQETPVWQSFDVEAWQGLLLPARTDARIAERLARETA
FT                   AVLAEPDLVRKLAEAGFKPMAMEQAQFIAHLERERKLLEATVHAARIHGAG"
FT   gene            complement(601390..602520)
FT                   /locus_tag="Daci_0547"
FT   CDS_pept        complement(601390..602520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33193"
FT                   /db_xref="GOA:A9BRD5"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRD5"
FT                   /protein_id="ABX33193.1"
FT                   /translation="MASTVDQVTQRRRGVGLIAHDPALSAGGYTLIAPQTADGHVYLVD
FT                   IEGRVAHEWKLPVRAGRHAVILPNGNLGYNGNHPRSPDRYAPWSMWHGGDFYEVTPQGE
FT                   IVWRHEDPDHHHDAQWLPNGHLLYAACAPVPAGFAERVPGGTAHGPGEVMYGDVIREVD
FT                   RSGRLVWEWKAWEHLAPEDFPIHPGFGRYHWPLVNGLGVRADGSVLMSLRTTSGIIAVD
FT                   KASGAVKLHIPPSVVSHQHAPVALDNGHILAFDNGNFREGAHVAFSRVVEIDPADHRVV
FT                   WSYQDEMVNAFYTAFMGNAQRLWNGNTHITESATGRLFEVTPAGEVVWEYILPWFAEYP
FT                   DAAARRTGPGRLNSVFQTWRYHADQLPWLGAAGRLS"
FT   gene            602632..603582
FT                   /locus_tag="Daci_0548"
FT   CDS_pept        602632..603582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0548"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bch:Bcen2424_6218 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33194"
FT                   /db_xref="GOA:A9BRD6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BRD6"
FT                   /protein_id="ABX33194.1"
FT                   /translation="MPAISQAFRCFDEVARRGSVRKAAVTLHLTAAAVNQQILNLEAQV
FT                   GVPLFDRLPRGMQLTTAGELMLAAVRRSQRDFDNALAQVEDLRALRRGHVRVGVSHATA
FT                   EYLLPLVIASLHGRYPGITFSVRSGTGEELLRGVAQGEIDVAYCLRRPPPPGVQEVRAW
FT                   PQPLGAVMAPGHPLATEPRLLRLRDCVDYPLILMAPGMELRSMLEQMDSAALHQQRPLV
FT                   ETSSVPMVRRLVAGSTALGFLVPDNVAEDVAAGRLLWRPLHDAGAQLPGCLYQRIGYTK
FT                   AAAMRLFLDELERVADEMRAGFETGVSWSLKDLAT"
FT   gene            complement(603619..604791)
FT                   /locus_tag="Daci_0549"
FT   CDS_pept        complement(603619..604791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0549"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: ajs:Ajs_3870 queuine tRNA-ribosyltransferase;
FT                   TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33195"
FT                   /db_xref="GOA:A9BRD7"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BRD7"
FT                   /protein_id="ABX33195.1"
FT                   /translation="MLQFDLLKTDPSSHARRGQLTLNHGVVQTPIFMPVGTYGTVKGVM
FT                   PRSLQEMGAQIILGNTFHLWMRPGLDIMQSFGGLHGFEKWDKPILTDSGGFQVWSLGAM
FT                   RKITEEGVHFASPVNGDKLFMSPEVSMQIQTVLNSDIVMQLDECTPYETNGHKTTEAEA
FT                   RKSMEMSRRWAKRSSDEFQRLGNPNALFGIVQGGMYENLREESLQALVEMDFPGYAVGG
FT                   VSVGEPKDEMLAIMAHTPHRLPAHKPRYLMGVGTPEDLVQGVADGVDMFDCVMPTRNAR
FT                   NGTIFTRYGDLKIRNARHKTDHQPLDPSCTCHACAGTSGVSWEQGGRDGFSRAYLHHLD
FT                   RCGEMLGPMLTTIHNLHYYLNLMQEVRNALEAGNFTEMRARFKAERARGV"
FT   gene            604927..605397
FT                   /locus_tag="Daci_0550"
FT   CDS_pept        604927..605397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0550"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: ajs:Ajs_3869 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33196"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPY1"
FT                   /protein_id="ABX33196.1"
FT                   /translation="MLKIMIAVDGSEPSLDAVHHAISLVRQGLQAHFVLAHVQQEASLF
FT                   ELATQDSDMIAAASVDAGMHLVAPAVALVRAAGISYEVEIGLGEPAAALADIAESTGCE
FT                   QIIIGALGQGGLRRVLIGSVSREVARNSRLPVTIVKHAEPQDEEGEEDLGPE"
FT   gene            complement(605421..605873)
FT                   /locus_tag="Daci_0551"
FT   CDS_pept        complement(605421..605873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33197"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPY2"
FT                   /protein_id="ABX33197.1"
FT                   /translation="MDLQYQLKAGSYCLYDMRETPSAITGERRCRLRTELVAIAFDLVT
FT                   GQVHEHGSPTRIHAWALCTRRRLRAAGDWDQADSIVVVSGPLPVDEINKCLGIRGYCRR
FT                   MFQRLASLPHGKLQPHAHAHAHGAYGAYGAHAGRHQSHQGQQRRAA"
FT   gene            complement(606041..607261)
FT                   /locus_tag="Daci_0552"
FT   CDS_pept        complement(606041..607261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0552"
FT                   /product="phospholipase A1"
FT                   /note="PFAM: phospholipase A1; KEGG: aav:Aave_4476
FT                   phospholipase A1"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33198"
FT                   /db_xref="GOA:A9BPY3"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPY3"
FT                   /protein_id="ABX33198.1"
FT                   /translation="MTTPTHLDRRKRPSRTPTPLQWALAMGLGATPWLGAQAQTAPRPL
FT                   SEDAWRQCAATTDNQSRLACFDTWAQQQQPLTAPPATGWSAPAASAAADPGALPTPAPV
FT                   VTADSGQGLALPTTPTNGGCRDPRYSELSRYFELEPGSDCGTFSFRGYRPMSVSVVTAD
FT                   HVNRQPTTPGKDPAQSQPYKTEEMRVQLSVRTKVAQGLLTSSTSAGKDSLWVGYTQQSY
FT                   WQLFSPAISRPFRNTDHEPEIFYVYPTDARLPFGWRWRYSGVGLVHQSNGQSDPLSRSW
FT                   NRWYLMTGFELDNRWQLHAKAWQRIRESAEHDDNPRIQDYIGRGEVKLGWNVNAQNYLG
FT                   FTARGSLGQGRGSGRVEWLRTLGEGWNGGKSNLRLHVQLFSGYGDSLIDYNYKRTVLSV
FT                   GFSLLDF"
FT   gene            complement(607350..607796)
FT                   /locus_tag="Daci_0553"
FT   CDS_pept        complement(607350..607796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33199"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPY4"
FT                   /protein_id="ABX33199.1"
FT                   /translation="MTTACSSTDLQTTTRPTLQAAPKAARAATALPHAPCLDDEEMKDS
FT                   QLQGEWTGTVEGQSQPVRLQLGPHPQWKGNVKGTIARGADTRPMVGDVADDHITLEESA
FT                   DGKRITATWLGDVVEGSCAREIRGNFIEGDDAAPRPFVLRKLAP"
FT   gene            complement(607856..609973)
FT                   /locus_tag="Daci_0554"
FT   CDS_pept        complement(607856..609973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0554"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: ajs:Ajs_3865 UvrD/REP
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33200"
FT                   /db_xref="GOA:A9BPY5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPY5"
FT                   /protein_id="ABX33200.1"
FT                   /translation="MLPLPSLSRLSPRNAPMSAGLNLAQLQAVHYTEGPCLVLAGAGSG
FT                   KTRVITHKIGRLIEMGMAPRRIAAITFTNKAAAEMRERAAGLIGRQAKDVLVCTFHALG
FT                   VRMVREDGHVLGLKPQFSILDADDVTGILKDCSGGTTDLATARQWQWTISNWKNAGWDS
FT                   RKALAMAQDDNERSTALIMQRYEERLTAYQSVDFDDLIGMPMRLLKNHIEVREKWQRLL
FT                   GHVLVDEYQDTNATQYELLKMLVGSRAHFTAVGDDDQSIYGWRGATLDNLKKLPVEFPQ
FT                   LKVIKLEQNYRSTSAILRAANNVIQPNPKLYPKTLFSELGEGEPVRIVDCDTEEHEAER
FT                   AVARIQSLRAASNPPPDWKDFAILYRANHQAKPFEKALRKASIPYKVSGGTSFFDRAEI
FT                   KDLCAWFRLWINNDDDPAFLRAIGTPRRGIGHTTLGKLGEFSSQHKLSMFGALFAHMLE
FT                   AALPKKAHDSLLEFGRYINDLEYRARHTLGAEQSRGFMLDWLKEIGYEQYLYDSEDSES
FT                   VAAARWSNVLEFCDWMAQRAGGQIEDAAGTTTHTEVKSLLEVARNIALLSTISEREKEQ
FT                   DMVILSTLHASKGLEWPHVMLVGVTEGMLPFKLDDDNGRQQKVSDETAQRLQEERRLMY
FT                   VGITRARRSLAVSWTKRRKKGREMVSTLPSRFIKEMGLDAATSREDPREKLRQLRAEFA
FT                   LKAQQSTPADS"
FT   gene            610207..610953
FT                   /locus_tag="Daci_0555"
FT   CDS_pept        610207..610953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33201"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPY6"
FT                   /protein_id="ABX33201.1"
FT                   /translation="MARTTDEIGLAAELWSPLLKQRFEALFAVASRKSLRGWRQVPLVS
FT                   AQVLVVDGNMPAPEAAGWMPCVVYVGGVPQGQHLERTQQRLATYLDMNFTLSDLIDMLD
FT                   RAAVFLMDWTVRQQVATSHTLARALDDLQQQGVDCRYRFQLKAWVALPAPWNNSECLRA
FT                   LAMLCRGPMEVALLCEHSGMQARAVAELLRHPRLRSLLECSLRPAREDDLPPLRRSRAQ
FT                   ASDTVPGLPRQWVQKLAGWIRRGGVA"
FT   gene            610950..611513
FT                   /locus_tag="Daci_0556"
FT   CDS_pept        610950..611513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0556"
FT                   /product="Miro domain protein"
FT                   /note="PFAM: Miro domain protein; KEGG: dno:DNO_0146
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33202"
FT                   /db_xref="GOA:A9BPY7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPY7"
FT                   /protein_id="ABX33202.1"
FT                   /translation="MSLWMNAQPAAGLVRVSLVGPMGIGKTTALRSLCGALMAAADVPN
FT                   LDRASHSKEFTTVGAEFGEIDLGGGERLQLVGSPGQERFDFVRRWVLNASVGVLLMVDV
FT                   CDARAPDYAAQCLAEIASLESEPLVVVVSCRDASEQQQEAFSSALADRGHGIVPVIQAD
FT                   PRDRQQLLDALGVLVSLLSLQSQA"
FT   gene            611510..611911
FT                   /locus_tag="Daci_0557"
FT   CDS_pept        611510..611911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dno:DNO_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33203"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPY8"
FT                   /protein_id="ABX33203.1"
FT                   /translation="MKTPTLPRIPPSLIEAGSDVLHRVVAPLEGVHIALLCTPDGFEIT
FT                   SLRVRSELPTERLSAMAGSLMAMARAVATEIGHKSCRRLTFETELGTVLFQAVAGNQPA
FT                   ILCMVVDQSALLGRALWAAGEVASELSRS"
FT   gene            612011..612370
FT                   /locus_tag="Daci_0558"
FT   CDS_pept        612011..612370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dno:DNO_0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33204"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPY9"
FT                   /protein_id="ABX33204.1"
FT                   /translation="MASIHDSLNGLLGIDGALCAALVDSTSGMLMGSVGSGLDMELAAA
FT                   GNTEVVRAKLKTMRMLKLDDAIDDILITLTHQYHIIRPVAAHEGVFFYLVLDKSRSNLA
FT                   LARRKVQDVEKDLAL"
FT   gene            612499..613449
FT                   /locus_tag="Daci_0559"
FT   CDS_pept        612499..613449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0559"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: ajs:Ajs_3864 auxin
FT                   efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33205"
FT                   /db_xref="GOA:A9BPZ0"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPZ0"
FT                   /protein_id="ABX33205.1"
FT                   /translation="MLSVLLITFPFFALVACGFAATWRGVLPQAAIPGLNAFVLYFALP
FT                   CMLFRFGAQTPIAQLLDVGVSVVYLLCALLMVGATVALTVRRVGWNDAAFGALVAAFPN
FT                   TGFMGVPMLVALLGERAAGPVIVTMAIDMVVTTSLCIALSRLGLPGGHGVSVALRRAFA
FT                   GMAANPMPWAIVLGGVASAAGWTLPGPIDRTVAMLAGAASPVALFTIGAVLARSQMNSH
FT                   ERVAARDYVPIALAKLLVHPLLVWAVARAAMALGLPLGEEAFVALVLLAALPSASNVSL
FT                   LTERFGAHGGRVARIILVSTVLAFLSFSGAVALMT"
FT   gene            613551..615170
FT                   /locus_tag="Daci_0560"
FT   CDS_pept        613551..615170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0560"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferase of PMT family-like protein"
FT                   /note="KEGG: rpb:RPB_0468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33206"
FT                   /db_xref="GOA:A9BPZ1"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPZ1"
FT                   /protein_id="ABX33206.1"
FT                   /translation="MKSSPSAPAGVPTGAALLWMVTLACLLWALVSWLANGNLDGYHDM
FT                   LENYAWAQPLQLGTHKHPPFFAWVVGLWFMVFPQNDGFYRLLSYANVGVGIWGVYVLGR
FT                   RLGLARLAPLGAALLLWCFPYTTLAGKFNANSQLLSLWPWAAALLLASWQEKGARGVAF
FT                   SVALGVVSAACMLSKYYSGVFLAGFLLPIFLVREGRQWLLTPRPYVALAAFGLALAPHV
FT                   AWIAHHQWVTLGYAMDQGGGQVVWGYVLRFALAPIFYWLPAWLAVCLVYGFMQARQQGG
FT                   GWLRWSARFLRRSWCWQGRGDTLFWLALMPWLATLGFGATGVVELSTPWAIPIGYAFVL
FT                   LWLRNLDAEAPAVTQAALAALRRAWWPSLAVVLVIGVAAGWGNARKSSSDYYRPAADAA
FT                   QAIVLSWNQRHPQQPLQWVGGDWAENAMLSFYAQPHLRTIPGLPDSEYARVLALPDWRQ
FT                   QPGLLLCPRGPVASEPGPTAKSRDCEQQAQAWLAKLGLPQEARVLTVQRSGWRFPRPSP
FT                   YAYAVFDVLPRAGSQPADNAGL"
FT   gene            615167..616171
FT                   /locus_tag="Daci_0561"
FT   CDS_pept        615167..616171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0561"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   aav:Aave_0599 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33207"
FT                   /db_xref="GOA:A9BPZ2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPZ2"
FT                   /protein_id="ABX33207.1"
FT                   /translation="MTELHADIAPAAPKGMLPRPPLRLSCVVPAHNEEGNLEAFLRALD
FT                   ATVRTLTPDYELIVVNDGSRDATHEIALRMAQELPVRYLALSRNFGKEAALSAGIDHAR
FT                   GNAVVLIDADFQHPLEMLPQMCELWQSGYDMVYGVIADRGAESGAKRVGTNLFYRLMNA
FT                   GNLVKIPPNAGDFRWLDRCVADALKALPESHRFMKGLYAWVGFKAAALPFVPADRTAGA
FT                   SSFNFRRLGSLALLGLTSFTTLPLRVWSVVGGIISLAALLYGLWITMETLIFGNPLDGW
FT                   PTLAASIMLFSGVQLMSIGILGEYIGRIYDEVKRRPTYLLARDEDRSPLAPRD"
FT   gene            616174..616596
FT                   /locus_tag="Daci_0562"
FT   CDS_pept        616174..616596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0562"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: aav:Aave_0598 GtrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33208"
FT                   /db_xref="GOA:A9BPZ3"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPZ3"
FT                   /protein_id="ABX33208.1"
FT                   /translation="MHDVIAQLRRLPQALQFVLVGGCAAATHLAVVALLVQRVGMAPLH
FT                   ANVLAFLVAFVVSYNGHALFTFVQAGAQGWAVAGKYFAVACASFVANELLYWVALHWLH
FT                   WHYFWSLALVLVLVAVGTFVFAKFWAFAAPGRKESS"
FT   gene            616593..617459
FT                   /locus_tag="Daci_0563"
FT   CDS_pept        616593..617459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0563"
FT                   /product="YdjC family protein"
FT                   /note="PFAM: YdjC family protein; KEGG: aav:Aave_0597
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33209"
FT                   /db_xref="GOA:A9BPZ4"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPZ4"
FT                   /protein_id="ABX33209.1"
FT                   /translation="MNTVPARNNGEKALARTVVLCADDYALHPLVDEAVEQLTLQGRLS
FT                   ATSCMTTSPHWRQAARRLPALRPRLSLGLHFNLTEGHGLQPAAGIGAVIARAYAGALGG
FT                   TAMRDAWRRQLDAFEDALGMAPDFIDGHQHVHQLPGVRAALVQELRQRYGDNADDLPWV
FT                   RSTTPAGQLWRDPKAAIIALLGGWTTTRRLRRQGVPLNHGFGGVYAFDQPTPEGYGRHM
FT                   AQWLTQLQPGSLMMCHPATAPVQGDAIGAQRAVEYAYLRSDAFAQALEQAHCHIAQGPL
FT                   TPLFTSN"
FT   gene            complement(617643..618779)
FT                   /locus_tag="Daci_0564"
FT   CDS_pept        complement(617643..618779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0564"
FT                   /product="L-asparaginase, type II"
FT                   /EC_number="3.5.1.38"
FT                   /note="KEGG: aav:Aave_4182 L-asparaginases, type II;
FT                   TIGRFAM: L-asparaginase, type II; PFAM:
FT                   Asparaginase/glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33210"
FT                   /db_xref="GOA:A9BPZ5"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPZ5"
FT                   /protein_id="ABX33210.1"
FT                   /translation="MPFTPFRMTLMAVALALAGCASQPGASQAPAAAAPATAAAPAPAP
FT                   TAQAGKPNVVVLATGGTIAGAGASAVNSATYTAAKVPVDKLLAGLPELSNIANVSGEQV
FT                   FQIASESFTNKELLTLARRVNELAKQPGVDGIVVTHGTDTLEETAYFLNLVVPTDKPIV
FT                   VVGSMRPGTAISADGALNLLGAVATAASKDSAGKGVLVSMNDNIDSARDVAKLTNIKTN
FT                   AFASQWGPLGMVVEGKTYWFRAPVKRHTRGSEFNIEQITDLPAVDIVYGYGNVPATAID
FT                   ALGKAGVKAIVHAGTGNGSVADRIVPKLNELRQKGVIVVRSSRVPAGFVLRNAEQPDDK
FT                   YDWVVAHDLNPQKARLLAAVALTKTQDTKQLQRIFWEY"
FT   gene            complement(619003..621291)
FT                   /locus_tag="Daci_0565"
FT   CDS_pept        complement(619003..621291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0565"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: aav:Aave_4471 primosomal protein N'; TIGRFAM:
FT                   primosomal protein N'; PFAM: helicase domain protein; type
FT                   III restriction protein res subunit; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33211"
FT                   /db_xref="GOA:A9BPZ6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPZ6"
FT                   /protein_id="ABX33211.1"
FT                   /translation="MLGGLVAAGPAVRRPRFQAPLSRIRMSLPAHTVHVAVQTPAHSAV
FT                   GELLSYTCDQPLEAGTLVRVPLGRRDLLGVVWDAPPRPAAMPEGVELRPVAAVLQGIAP
FT                   LPAAWRRLVAFAAYYYQRSVGEIAVTALPPQLREMTAEQLARRLRPTKAAAKRAAKAAK
FT                   EEQAQQAPGSAPAPAPVSALAQAPAAADIPPIVLSAEQADVFTQIAAHPGPFLLFGSTG
FT                   SGKTEVYLRATQAALDADPGAQVLVMVPEINLTPQLEQRFTERFAPQYGAACVVSMHSA
FT                   MTNPQRLKSWLAAHTGVARIVLGTRMSVFASLPGLSLIVVDEEHDASYKQQEGARYSAR
FT                   DLAIWRARDTGAKVILGSATPSLESWHASRPPNADEPQGGRYLRLHMPSRIGAAALPRV
FT                   RLVDMGQQPRKAVFSPPLIDAITERVQRGEQSLVLLNRRGFAPVLFCADCGWKSDCPHC
FT                   SAHQVFHKADRTLRCHHCGYTQRVPMACPGCGNPDILPLGKGTEQLEEELARLLRNVQR
FT                   PDREPARVARIDADTTRAKGALEEQLAQVHAGDIDVLVGTQMVAKGHDFRRITLVAAVQ
FT                   PDSALFSSDYRAPERLFSLLMQAAGRAGRDAHYVAAQGSHPEMWIQTHDPSHPVYTALR
FT                   SHDYPAFAARQLRERRDAGMPPFAFQAIVRADARTQEAAQAFLAAAAEAARQAGLPHVD
FT                   DVFLYPPIPMSVQRVANVERAQMLIESAQRPALLRFLWAWQAHLHWIRAQPGHRALVRW
FT                   LVDVDPLAI"
FT   gene            complement(621740..622852)
FT                   /locus_tag="Daci_0566"
FT   CDS_pept        complement(621740..622852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0566"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: aav:Aave_4469 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33212"
FT                   /db_xref="GOA:A9BPZ7"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9BPZ7"
FT                   /protein_id="ABX33212.1"
FT                   /translation="MSFAPLTNDTFLRACRRQATDYTPLWLMRQAGRYLPEYKATRARA
FT                   GSFMGLATNVDYATEVTLQPLERFPLDAAILFSDILTVPDAMGLGLSFAEGEGPRFAKV
FT                   VRDEAAVAELAVPDMDKLRYVFDAVTSIRRALDGRVPLIGFSGSPWTLACYMVEGKGSD
FT                   DYRLVKSLMYARPDLMHRILAINADSVAAYLNAQIDAGAQAVMVFDSWGGVLADGAFQE
FT                   FSLAYTKRVLAGLNRTGADGQDVPRIVFTKGGGIWLPDMKDLDCEVLGLDWTANLARAR
FT                   AIVGGEVGGPGKALQGNIDPNVLFAPPERVAEQARAVLDSFGAPHTDRTTTGPTHIFNL
FT                   GHGISQFTPPEHVAALVETVHSHSRALRQR"
FT   gene            623030..624019
FT                   /locus_tag="Daci_0567"
FT   CDS_pept        623030..624019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   vei:Veis_2295 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33213"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPZ8"
FT                   /protein_id="ABX33213.1"
FT                   /translation="MQRRTLTQILALAPAVSAASWLAGSATAAEPLFPGKAPLRIVVGY
FT                   PPGGATDRVARIVADKLQARVGSPVVVENKPGAGGRLSAQYVKNAPASQPALLLANPAV
FT                   MLVAPLVFPDSGYDPDKDFRPVSEVNRYEFGVAVASAVPVRQLSHLLAWLRANPQQANV
FT                   GVPATGSLPHFFSLMLGEAAKVRTETVGYKGSAPLLTDLVGGQVPLAIDTFDVLLPQHE
FT                   AGKIRVLAVSGERRSTMAPDISTLKESGLNLSGMGWNTLFAPQSMAPDIAERLSRMVQE
FT                   IMKEPDTRQKFEASRLTPVSSSSAQTAEMLKAYRAQWTPVVQRSGFKP"
FT   gene            624251..625033
FT                   /locus_tag="Daci_0568"
FT   CDS_pept        624251..625033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0568"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mpt:Mpe_A0984 putative enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33214"
FT                   /db_xref="GOA:A9BPZ9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9BPZ9"
FT                   /protein_id="ABX33214.1"
FT                   /translation="MPPSLVLVEQQDAVRTLVLNRPDALNSFNAQLHEQLLSALEQAAG
FT                   DATVRCVVLTGAGRGFCAGQDLSDPEAAPDQNLGDLIERRYQPLCLRLKSMPVPVVAAV
FT                   NGVAAGAGANIALACDLVLAARSASFIQAFAKIGLVPDCGGTWLLPRLVGRARALGLAL
FT                   LGDKLPAAEAERIGLIWRCVEDADLRSEAQALAQRLAAMPVRALARTREAMDSAQLLDY
FT                   EHALTREARQQGQLGAAHDYQEGVAAFLGKRAAVFSDR"
FT   gene            625045..625512
FT                   /locus_tag="Daci_0569"
FT   CDS_pept        625045..625512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0569"
FT                   /product="phenylacetic acid degradation protein PaaD"
FT                   /note="TIGRFAM: phenylacetic acid degradation protein PaaD;
FT                   PFAM: thioesterase superfamily protein; KEGG: azo:azo0302
FT                   phenylacetic acid degradation protein PaaI"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33215"
FT                   /db_xref="GOA:A9BQ00"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ00"
FT                   /protein_id="ABX33215.1"
FT                   /translation="MQDTHTPDEAAQRLAEQVRDGMLARDRAAQGLGLRITDIAPGAAR
FT                   MEMAVRDDMLNGFDICHGGFITALADTAFAYACNARNEMTVASGLSVDFVAPGRPGDVL
FT                   TAQAREISRAGRTGVYDVQVTNQRQEVIALFRGRSHSFKGRPTVPGLTEPA"
FT   gene            625524..626828
FT                   /locus_tag="Daci_0570"
FT   CDS_pept        625524..626828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0570"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="TIGRFAM: phenylacetate-CoA ligase; KEGG:
FT                   mpt:Mpe_A0986 phenylacetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33216"
FT                   /db_xref="GOA:A9BQ01"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ01"
FT                   /protein_id="ABX33216.1"
FT                   /translation="MSLQRPAPGELDPIETASRDEIASLQLLRLRWSLQHAYDHVPHYR
FT                   RAFDEKGVHPSDLRTLSDLARFPFTTKKDLRENYPFGMFAVPRQKVARVHASSGTTGKP
FT                   TVVGYTLKDLDNWANLVARSIRAAGGRPGDMVHVAYGYGLFTGGLGAHYGAERAGCTVV
FT                   PMSGGQTEKQVQLIQDFRPDIIMVTPSYMQVIVEEMQRQGLDPRESSLRIGIFGAEPWT
FT                   EAMRREIEGKAGLDAVDIYGLSEVMGPGVASECVESKDGPVIWEDHFYPEIIDPDTGEV
FT                   LPDGSEGELVFTSLSKEAMPIIRYRTRDLTRLLAPTSRSFRRMGKIVGRSDDMLIIRGV
FT                   NLFPTQIEEIVLQNAQLSGQYQLVVTRDGNLDRLAVRCEMQPGTQGDTEALALWVQQRI
FT                   KTLVGVSAEVEVLRPDSIERTLVGKARRVIDHRSR"
FT   gene            626846..627505
FT                   /locus_tag="Daci_0571"
FT   CDS_pept        626846..627505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0571"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: vei:Veis_3950
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33217"
FT                   /db_xref="GOA:A9BQ02"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ02"
FT                   /protein_id="ABX33217.1"
FT                   /translation="MARGRSSGYDDQRELILGHAAALFARSGYPGTSMNEVAQACGLSK
FT                   PTIYHYFRDKYALLVDITDGHMTRLQSLVDEVQSMGLPPEPRLRMLIERFVQEYAHARH
FT                   AHRVLTEDVRFLQDDDRQRVLGKERAVVETFAQAVAQLRPDADGAGLSKALAMLLFGMM
FT                   NWMFTWLRPDGSLDHEAMAPVVADLFLGGLPAVQTPGKPGHQTAGKKIVTTVNCGA"
FT   gene            627541..628692
FT                   /locus_tag="Daci_0572"
FT   CDS_pept        627541..628692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0572"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vei:Veis_3951 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33218"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ03"
FT                   /protein_id="ABX33218.1"
FT                   /translation="MKRLTKLGLLAATLATVWGSALADINVGVVVSATGPAASLGIPEK
FT                   NTVALMPRTVAGQKVNYIILDDASDTTAAVANTRKLISESKVDVILGSSITPNSLAMVD
FT                   VVSEAKTPMITLAASAKIVEPVDAKKFWVFKTPQHDAMMAAAIGEHMAKAGIKTVGYIG
FT                   FNDAYGESWLQEFRKVAEAKGLKLTATEAYSRSDTSVTGQTLKLMSAKPDAVLIAGSGT
FT                   PAALPQKSLKERGYQGKIYQTHGVANADFLRVGGKDVEGTLLPAGPVLVAHQLPDSNPV
FT                   KKSAVSYVEAYEAANGKGTASTFGAHSWDAGRVLEAAIPAALKKAQPGTAEFRAALRDA
FT                   LEQTKDVAGAHGIFNMTPTDHLGLDQRAAVMVKIENGTWKYQP"
FT   gene            628776..629804
FT                   /locus_tag="Daci_0573"
FT   CDS_pept        628776..629804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0573"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vei:Veis_3952 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33219"
FT                   /db_xref="GOA:A9BQ04"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ04"
FT                   /protein_id="ABX33219.1"
FT                   /translation="MDLQIALLLGQDGIVNGAVYGLMALALVLVFSVTRIIFIPQGEFV
FT                   AFGALTLAMMQAGRVPTTLWLLLALAAAVLVVDLLRWRAGSQVSWPATFLWCLALPAIA
FT                   VALAWGLRPSSLMLQALATLVLITPMGPLLYRLAYRPLAHASVLMLLIVSVAMHGVLVG
FT                   LGLLFFGAEGSRTPAFSEAQLRLGDITISGQSLVVVGVTLVLVALLFVFFERSMIGKAL
FT                   RATAINRVGARLMGIPTAMAGDVSFALAALIGAISGLLIAPLTTVYYDTGFLIGLKGFV
FT                   AAIVGGLASYPLALAGALLVGLLEAFSSFWASAYKEVLVFTLIIPVLWWRSRNSHHVEE
FT                   EE"
FT   gene            629801..631693
FT                   /locus_tag="Daci_0574"
FT   CDS_pept        629801..631693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0574"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: inner-membrane translocator; ABC transporter
FT                   related; SMART: AAA ATPase; KEGG: vei:Veis_3953 ABC
FT                   transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33220"
FT                   /db_xref="GOA:A9BQ05"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ05"
FT                   /protein_id="ABX33220.1"
FT                   /translation="MSAPVSSQAAAPAKAASGGISTRVLTVAAIALLAASWGFLPDFTV
FT                   VILSYIGLFAMVAAGLVMLTGVGGMTSFGQAAFVGIGAYATAWVCTAPASVAALGGLVG
FT                   AAGLPWVGLALGLLITFVVAWLLGAVTVKLQGHYLPLCTIAWGLSLYYLFGNMEFLGGQ
FT                   TGITGIAPLVIGGVSLASPRAMGVVIWAVLLVALWLLHNLLDSREGRAIRALRGGRVMA
FT                   ESMGIDTAHYRVKLFVLAALLATLSGWLYAHMQRFVSPAPFNLNVGIEYLFMAVVGGAG
FT                   HLWGAVLGATLITLVKQKLQDILPALLGTSGNFEVIVFGLLMVLVLQRFAEGLWPTLQA
FT                   LTARWVRRPVSDLKLADAAPLAQRALPATGQVLLAAEHVTKRFGGLVANNDVAMTLKAG
FT                   EVHALIGPNGAGKSTFFNMISGVDSPTEGQVRFMDQAMNDAPSRRFAALGLGRTFQHVR
FT                   LLGQRSVLENVAVGAHRRAHRGWLASMLRLDRAEEASVLAEARRQIERCGLGAFADVPA
FT                   ASLALGQQRIVEIARALAGQPAALLLDEPAAGLRHLEKQALADLLRQLRAEGLGILVVE
FT                   HDMEFVMNLADRITVLEFGTVIAEGTPAQIQVNQRVLDAYLGGGDDDEATGETA"
FT   gene            631690..632436
FT                   /locus_tag="Daci_0575"
FT   CDS_pept        631690..632436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0575"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eba:ebA3560 amino-acid composite ATP-binding
FT                   transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33221"
FT                   /db_xref="GOA:A9BQ06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ06"
FT                   /protein_id="ABX33221.1"
FT                   /translation="MSDTLLQLRGLSVSYGPVEAVHQVDLDVRSGEIVTVIGPNGAGKT
FT                   TLLSAAMGLLPSRGEIHLDGKRIARPGVEVMVANGVALVPEKRELFGEMSVEDNLLLGG
FT                   FSRWRRGLRDQAQRMDEVFAIFPRLRERRPQMASTLSGGERQMLAIGRALMARPRLLLL
FT                   DEPSLGLAPLIVREVLQVVAGLRDHGVSVLLVEQNARAALKVADRAYVLEMGAVALSGA
FT                   ARDLLHDRRIIDTYLGMGRSAEAVAA"
FT   gene            632450..632833
FT                   /locus_tag="Daci_0576"
FT   CDS_pept        632450..632833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33222"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ07"
FT                   /protein_id="ABX33222.1"
FT                   /translation="MLLSGSGDCGCGRDIQACRQVIQVNPPPASALHVIKIILLCLVDA
FT                   LGDAVAWIVFDVSRNIKQVSFAGDWVYVVQEFFVPKRGLQRQHFPGISHPCLNEIFKRF
FT                   MKNRFVRSIRLEGFQPILISEDI"
FT   gene            complement(633469..634557)
FT                   /locus_tag="Daci_0577"
FT   CDS_pept        complement(633469..634557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33223"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ08"
FT                   /protein_id="ABX33223.1"
FT                   /translation="MKKFHIIFTIALLFLIPKTAFCKGWLDVSTTYNRYIGWACQPGSA
FT                   DPVGIHIYADGHYIGGGNAAIVREFAVQYACNSITSRHGFDISIDVPAVLLDGTIRDVT
FT                   VYAIYANNRSERLNNTPVKLKFFALPGKEKPTVIGDVVGRDLGSQEVGSLGHIGIWDGR
FT                   NVLEAIGYGDANDTIKETPWSSFSSKPNLWKTISPVWQGDFRQRFCDESVCWHRQNDNG
FT                   VLYLLGNQTRTTWLQEMAARSAYVKYKIGASYTLSAYFTPARQGLSYWTKSFCSPFASQ
FT                   CQMTKVERKPIRGFYRCDGLVLDAWTSTAIRGGTPLLGQEIYAAPHQSVVDSWNRQMSY
FT                   QIAWNRIITPANVHANLQQRNW"
FT   gene            complement(635590..636573)
FT                   /locus_tag="Daci_0578"
FT   CDS_pept        complement(635590..636573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pol:Bpro_4537 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33224"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ09"
FT                   /protein_id="ABX33224.1"
FT                   /translation="METRMQRKQFLAALACSGLALAAGPAALAQDKPLEWVVGYAAGGG
FT                   SDVVARVIAEAMGRNMERVIVINNKPGAGTNIAAEYSARSRDHGNLMFTADFATLAANP
FT                   FLFSKLNYNAERDFKPVGMLVRFPMLLVVNNEVPATNLAEFLAWAKQQKTGVSWGSAGL
FT                   GSPHHLVGELFREQAGISNMTHVPYRGAAPAVQDVVGGQIPAMWADSATIIPFLSEKKL
FT                   KAIGVASPARVDVLPQIATLQEQGLKGFEGYAWQGIVVPTGSSAEVVKKFSQSLQQALA
FT                   DTRTKARLAAMGVEPMPGSADQMGQFVRAERSKWGRVISANNIKLD"
FT   gene            complement(637064..638740)
FT                   /locus_tag="Daci_0579"
FT   CDS_pept        complement(637064..638740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0579"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: pol:Bpro_4535 monooxygenase,
FT                   FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33225"
FT                   /db_xref="GOA:A9BQ10"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ10"
FT                   /protein_id="ABX33225.1"
FT                   /translation="MSHPAISLQALRGSGADIQSIHIPYERHADQDAGADTPARHPVVI
FT                   VGAGPVGLSLAIDLAQRGQRVVLLDNDCRLSTGSRAICFSKRTLEIWDRLGVGQAMVDK
FT                   GVSWNLGKVFFKDQPLYRFDLLPEDGHERPAFINLQQYYAEAYLVERALQLPLIDLRWH
FT                   SKVTALEPQAEGALLTVETPDGSYRIDAQWVLACDGSRSPLRGLLGQESHGRIFRDRFL
FT                   IADVKMHAEFPTERWFWFDPPFHPGQSVLLHRQPDDVWRIDFQLGWDADPEEEKKPENI
FT                   VPRIRALLGKDAPFELEWASVYTFACLRMDRFVHGRVVFAGDSAHGVSPFGARGANSGV
FT                   QDAENLAWKLDRVLRGQADASLIATYGAEREYAADENIRNSTRATDFITPKSEISRLFR
FT                   DAVLDLARDHEFARRIVNSGRLSVPATLHGSALNTPDTDTFDGTQLPGAVLADAPMRRP
FT                   GADGTAWLLRALGPDFTLLHFGPTPAWAQALPGVLNLSIAAEGEAHAHGADLIDARGLA
FT                   AKRLDARPGTSYLLRPDQHVCARWRRPDEAGVRAALQRASP"
FT   gene            complement(638874..639839)
FT                   /locus_tag="Daci_0580"
FT   CDS_pept        complement(638874..639839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0580"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   vei:Veis_4551 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33226"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ11"
FT                   /protein_id="ABX33226.1"
FT                   /translation="MTTKTFASAADLEIKQVSFDKLSEHAYAYTAEGDPNTGIIIGDDA
FT                   VMVIDTQATPVMAQDVIRRIREVTDKPIKYVTLSHYHAVRVLGASAFFAEGAEHIIASQ
FT                   DTYDLIVERGEQDKASEIGRFPRLFQNVESVPEGMTWPTLTFTGKMTLWLGKLEVQILQ
FT                   LGRGHTKGDTVVWLPQDKVLFSGDLVEFGATPYAGDAYFQDWPHTLDAIAALQPEKLVP
FT                   GRGAALQTPAEVQAGLAGTRDFISDLWTEVKAGADAQQDLRKVYEAAFAKLQPKYGQWV
FT                   IFNHCMPFDVTRAYDEASGHADPRIWTAERDRQMWLALEG"
FT   gene            639914..640807
FT                   /locus_tag="Daci_0581"
FT   CDS_pept        639914..640807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0581"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bbt:BBta_4674 putative
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33227"
FT                   /db_xref="GOA:A9BQ12"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ12"
FT                   /protein_id="ABX33227.1"
FT                   /translation="MNNSFDIVKNPRSRKLRVPAFTMPAMSDAASSPNDPVFPSDSADD
FT                   EPARGPRGIQSVEVGGQLLKALARTGRRMALKDLAREAGMTAAKAHPYLVSFCKLGLME
FT                   QDRASGHYGLGPLAIQMGLISLQQADPVRLAIAELPALAQEVGSTVSIAMWSGQGPTII
FT                   RVEEGPTHVYVAMRHGTPASLRHTATGKIFAAFGEPGRIAPLLDAEGHSLEEPAFAKEL
FT                   AAIRASRLSRVENQLLSGVSALAVPVFDGFGQLVLAIAAIGPSATLDLDLQGRPALLLQ
FT                   AQARSLSQRLGAPAQA"
FT   gene            complement(640827..642659)
FT                   /locus_tag="Daci_0582"
FT   CDS_pept        complement(640827..642659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0582"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: aav:Aave_1100
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33228"
FT                   /db_xref="GOA:A9BQ13"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ13"
FT                   /protein_id="ABX33228.1"
FT                   /translation="MLQTLRSKILAISTATVVGALAITGAATYHIVRGSTFQTIEQDLD
FT                   AITAGNTMAIDQWVASKARAVSAAAAVIEHGDPQGFAAHMGQASGFPITTVGWEDKTYK
FT                   STTSTPPDYDPTARPWYKSAVQAGKLTLTKPYGDSTTGVPYVAFVAPMLRGGALQGVIS
FT                   GAVPLEGVREVVSAIRPTPGSLGFVVSRDGQVLAHADAKLLLKPTSDLSELLTPAALTA
FT                   LASATAPLEVNLGGSAKLLKARPVQGTDWLLVVALDKAEATTGLQSVLKTLAIAIVLLA
FT                   CLATAVAAALTAQSFRRLSQVRDAMDKIGSGGGDLTQRLPVSGNDEVAQIASSFNGFVE
FT                   QIGTVLKDVRNGVESMKTATDEIKLGNLDLSNRTESSASSLQETSASLSQLTANVRQSA
FT                   EAAAMATRLAQSASSSATKGGDVVGSAVSTMDDISKASSKIGEIIGVIDAIAFQTNILA
FT                   LNAAVEAARAGEQGRGFAVVAAEVRSLAHRSAAAAKEIKTLIDASGASVAMGTDRVRAA
FT                   GQTMGEIVDGIQRVSQIIVEINGAMTEQSVGIGQINQAVADMDRATQQNAALVEESTAA
FT                   SSVLNEQAHHLSRTVAGFTLEGRAPARDQLLLTN"
FT   gene            642838..643800
FT                   /locus_tag="Daci_0583"
FT   CDS_pept        642838..643800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0583"
FT                   /product="Putative hemolysin-like protein"
FT                   /note="KEGG: pol:Bpro_2243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33229"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ14"
FT                   /protein_id="ABX33229.1"
FT                   /translation="MTCCCNATVAGLSWPLSTMAARRQTEWHRQVTDCVQHDEEGGHMD
FT                   VLDTLRNAAIDVAKPPLSALLQPPQAADKPLRLDVRWARHLDEVRQVQRLRHAVFAAEM
FT                   GAVLQTPLAGHDIDAFDDFCEHLMVCDADKGVVIGTYRLLTPTQALRAGGLYSDQEFDL
FT                   APLHAWRPRMVELGRSCVHASHRQGGVILALWGALAEFMQRNQLDAMVGCASIPMQYPG
FT                   LAHGEGPARVWQQLRQTHLAEPELQVRPRVALPEELASVSTSGMSVEPPALIQGYLRTG
FT                   AKVLGAPAWDSDFNTADLPIMMRMQDLPSRYMRLFTRRG"
FT   gene            complement(644057..644584)
FT                   /locus_tag="Daci_0584"
FT   CDS_pept        complement(644057..644584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0584"
FT                   /product="CoA-binding domain protein"
FT                   /note="KEGG: ajs:Ajs_3857 CoA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33230"
FT                   /db_xref="GOA:A9BQ15"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ15"
FT                   /protein_id="ABX33230.1"
FT                   /translation="MLRPRQCSRPDPHALRTLRRMSDTATVSRLRDILVQCRTLAVVGL
FT                   SPQPDRPSHQASQYMQRHGYRIVPVNPVVAREGGRILGEPVHASLADAAAALAAQGLRI
FT                   DMVDCFRKSEDIPPLAAEAVAIGARCLWLQLGVVNDAALELARAAGLWTVQDRCVKIEH
FT                   QRLLADTPAAAR"
FT   gene            complement(644553..645824)
FT                   /locus_tag="Daci_0585"
FT   CDS_pept        complement(644553..645824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0585"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="PFAM: Na+/H+ antiporter NhaA; KEGG: ajs:Ajs_3856
FT                   Na+/H+ antiporter NhaA"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33231"
FT                   /db_xref="GOA:A9BQ16"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ16"
FT                   /protein_id="ABX33231.1"
FT                   /translation="MNTYTTPRPSGPRTPLFLSFADRVGAFLSRWSHAEAAGGIVLLLA
FT                   AAAALLWANSGWAGSYEALWHTPLSLGLGPWQLSQSLHFWVNDALMSVFFLVVGMEIRR
FT                   EMHSGALAQPRQALLPVMAALGGVVAPALIFLAFNAAPPLRNGWAVPTATDIAFAMGVL
FT                   ALLGRGLPPALRVFLLALAIIDDLVAVLIIALFYSGGLQWSQLLVAAAGLAGVFLLQSL
FT                   GVRRAWAYVLPGAVLWWGIWQTGAHPTLAGVVLGLVTPVHALAGRESAAPVERVQADLH
FT                   PWVAFGVMPLFALANAGVPLQGAGTAGIDVAGTSAVMWGVALALVLGKPLGVLLSCWLA
FT                   VRLRMCALPPGMGWGDTLLAGLLAGIGFTMAIFIATLAFDSEALLNAAKLGVLMASATA
FT                   AVLGLAWGLVLRRRHAASATVQPA"
FT   gene            complement(646060..646593)
FT                   /locus_tag="Daci_0586"
FT   CDS_pept        complement(646060..646593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33232"
FT                   /db_xref="GOA:A9BQ17"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ17"
FT                   /protein_id="ABX33232.1"
FT                   /translation="MHALITHSHPSGVHHRSRGKGLLLALGLASLAVAGIVLPFVWDLL
FT                   GFVNGLPKMGWLQSILAVSPVFSWLMMFAWGLAVPVALIYALYHPQTHPWGNAAMVAGA
FT                   MFIAVTWYVHMPAASQCTAMYPQTGMACSVLQWGFSISLGVATAAYVFLVFMIALSSLG
FT                   LLAECVARNEPPRP"
FT   gene            complement(646787..649183)
FT                   /locus_tag="Daci_0587"
FT   CDS_pept        complement(646787..649183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0587"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: aav:Aave_4456 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33233"
FT                   /db_xref="GOA:A9BQ18"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ18"
FT                   /protein_id="ABX33233.1"
FT                   /translation="MQRYLLPIVLQPATGDLSGRPATIAACSRGNQRPCPWLPQSAMPH
FT                   QPPLRHTVPQHLAFWLLAFFLAAASLLATPAGAQLRLKTGSGAAAAVDTPRVRAELVAQ
FT                   APEGVQPGQTLWLGLLITHQPEWHTYWKNAGDSGLATELNWQLPAGLTAGEIQWPVPEA
FT                   LRVGPLLNYGYEGQVLLPVPVQVAADFKPPASGMLDLRLHANWLVCRVECIPEEGDFQL
FT                   QLPVQGSTAGQGQAFTQAWALKPQALSAPAQAKVVPASQPAAEGRTPDERVQLRIEGLP
FT                   ESLQGRTLDFYPESSDTFHHAAELGKDWQQRWDGAAWVAELPLSDMRGDTPAKLPVVLA
FT                   LPPAERTAALEQGQPVAWRVEAPVEGRWTAAAMASVSPALAAALAANQAAAPAASATSL
FT                   WMALLGGLVGGLILNLMPCVFPVLAIKILGFARHGQDRRAQRLGGLAYTAGVVLSFLAL
FT                   GGLLLALRAAGEQLGWGFQLQSPAIVALLAALFTLLGLNLAGLFEFGSMLPGRWAAAHA
FT                   RHPVADAFLSGVLAVAIASPCTAPFMGASLGFAIDMPALQALTVFAALGLGMALPYLLA
FT                   SFVPAVVRWLPRPGAWMDTFRRAMAFPMFATVVWLVWVLGHQSGIDAATALLALLLAFS
FT                   ALVWTLTLKGRTRAVLATLAVVLAGALLATTAPLITTPAQAEGTGTASAAGERWQPWSA
FT                   ARVAELQAAGKPVFVDYTAAWCVTCQVNKRTTLNHEEVLAAFDKHGVTLLRADWTRRDP
FT                   AITAALQQLGRSGVPVYVLHAPGKPPVVLSELLSKSEVLGALAAL"
FT   gene            649272..650249
FT                   /locus_tag="Daci_0588"
FT   CDS_pept        649272..650249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rme:Rmet_5616 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33234"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ19"
FT                   /protein_id="ABX33234.1"
FT                   /translation="MQETSRRHFLAAGAAAAAAWGLPQHARAAAAYPDKSVRVIVPFPA
FT                   GGTTDVVARLAMQKLGELTGQSFVVDNKGGANGVIGTELAARATPDGYTLLMNTAGAQT
FT                   LSPVLYKTSYEALSSFEPISHLCDVGFVLIARKDLPVNSLQELVAMAKQGKPLSVSSGS
FT                   SMISLITEQFKKVIGAPGIVNAQYKGTAPQMQAVVAGEVDFSFDSFTSVEMIRTGKVKA
FT                   LAVLLPQRAEVFPQVPTIKEAGVDGMGFSSWSGLLAPKGTPRDIVAQLAQQMDKVMQMP
FT                   DVLAKLRSYSYVPRRGTPDEFARLIESDNERWKRIVKESNFKAE"
FT   gene            650291..651154
FT                   /locus_tag="Daci_0589"
FT   CDS_pept        650291..651154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0589"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: ajs:Ajs_3852 creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33235"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ20"
FT                   /protein_id="ABX33235.1"
FT                   /translation="MQDSPPEQISPGAWPSRWWAEASARDFAQAQASGLAAETIAVLPV
FT                   AAVEQHGPHLPLSVDARLLQGVIDAALPLLPPELPALFLPPQNIGFSVEHQSFAGTLTL
FT                   SPATVIALWTELGACVARAGVRRLLLLNGHGGQVSVMDIVARELRMRHGLLVYSSSWFG
FT                   LVDDAANAHFSAHEHRFGIHGGEVETSMMLHLAPESVRMEHARDFHSTSEDRAQRHALL
FT                   GNGRSAKMGWAIEDYNVCGAVGNAAGATAERGALMVEASARGLVRLLSEIVALPADTVG
FT                   RAPEPL"
FT   gene            complement(651513..652487)
FT                   /locus_tag="Daci_0590"
FT   CDS_pept        complement(651513..652487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pol:Bpro_4316 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33236"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ21"
FT                   /protein_id="ABX33236.1"
FT                   /translation="MNKRRFTRSALACAALLLAAITSQAQPLSNKPIRIVVPFGAGGVA
FT                   DVTSRVVAQKLASQLGQPVIIDNKPSAGGIVAADTVAKSAPDGHTLFLMSNGSAVTVGL
FT                   FSQLPFDMVKDFTPISTLGYFDIGVLTASDSRFKNLGELVAWAKANPGKLNIGSIAIGS
FT                   TQHLAAELFKTTAGIDAQIVPFNGTPAVVTALRGKQIDAAVEILTPIMGQINSKAVNLL
FT                   AITGDKRSALLPGVPTAQESGVKGFVASSWNALAAPAKTPPEIIARLNKEIAAAVNSPE
FT                   VTQKLREMNVQAQSSTPEQTAQLLQSEIKRWGDVIVQAKIPKQ"
FT   gene            complement(652607..653290)
FT                   /locus_tag="Daci_0591"
FT   CDS_pept        complement(652607..653290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0591"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: aav:Aave_4443
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33237"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ22"
FT                   /protein_id="ABX33237.1"
FT                   /translation="MGTLYLVRHGQASFGAEDYDQLSERGTAQSQRLGAYWRERGLRFD
FT                   AVYTGTLRRHAQTLAGIADGLGSLPAEQHRTQALAGLDEYDSGALLQAIHPAPLPKPDT
FT                   PELYRHHFRLLCDALAQWMAGTISPKGMPSWDDFSGGVRQVLERVRHEHADENVLLVSS
FT                   GGPISTAVGHVLGTSPEVTIALNMRIRNSAVTEFTTSPKRLMLQTFNTLNHLDSDEHRS
FT                   WITHA"
FT   gene            complement(653378..654337)
FT                   /locus_tag="Daci_0592"
FT   CDS_pept        complement(653378..654337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0592"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   pol:Bpro_4242 phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33238"
FT                   /db_xref="GOA:A9BQ23"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ23"
FT                   /protein_id="ABX33238.1"
FT                   /translation="MTPAYVSRQRPFMTVDVFTARPYLGNPLAVVLDATGLTDAQMQSF
FT                   AAWTNLSETTFVLPPTEAGRAAGADYRVRIFTPGGELPFAGHPTLGSCHAWLAQGGVPQ
FT                   QAQRIVQECAKGLIGIERQDGRLAFQAPSTDISDVEPGLLDDVAAALGAERGQILRAAW
FT                   LDNGPRWMGVLFEHPDQVLSLEPDHARLKALNTKVGACALYESTQDAPALIGRSSREAR
FT                   AFATGQRPAGADADAAPSLEVRGFASPVGVTEDPVTGSLNASLALWLRGEGLLHAPYIA
FT                   SQGCCVGRDGRVHVSEDAQGALWIGGHVVECVSGQVLL"
FT   gene            complement(654562..655914)
FT                   /locus_tag="Daci_0593"
FT   CDS_pept        complement(654562..655914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0593"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   aav:Aave_4437 putative transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33239"
FT                   /db_xref="GOA:A9BQ24"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ24"
FT                   /protein_id="ABX33239.1"
FT                   /translation="MRRPFTPATKYPHCRRKSERTIRTPLFTCGRPVPHDGMAIHTSPP
FT                   AWRAPQRPGTAFFMTTWTLADRAAKMNPSAIREILKLTDRPGIISMAGGLPSPLAFPLD
FT                   EFTQACQSVMQRDGASALQYATSEGFAPLRQAVADFLPWEVDPDQVLITTGSQQALDLI
FT                   GKVFLDRGSRMLVEKPTYLGALQAFAPQEPIPVGVDSDDDGILVEDFAAKAGTGADKAR
FT                   LAYVLPNFQNPTGRTMAEARRQALVDKARELNIPLIEDNPYGDLWFEQAPALPLAARNP
FT                   EGVIYLGSFSKVLAPGLRIGFLVAPKSVYNKLLQAKQAADLHTPGFNQRVVSEVIKDGF
FT                   LDRHVPTIRAMYKRQRDAMLAALEREMAGLDVQWTRPVGGMFLWVRLPKGMDAQKLLPA
FT                   AVERGTAFVPGAPFYADEPQANTLRLSYVTVSAEQIDKGIAALADAIRSTM"
FT   gene            complement(655975..656577)
FT                   /locus_tag="Daci_0594"
FT   CDS_pept        complement(655975..656577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0594"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   ajs:Ajs_3843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33240"
FT                   /db_xref="GOA:A9BQ25"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ25"
FT                   /protein_id="ABX33240.1"
FT                   /translation="MPPSELTALLLLAASMSFSPGPNTTLSTALAANHGLRPALRFVLA
FT                   VPVGWCVLLVLSTAGVGAAIVAAPLLLWLVKAAGIGYLLWMAWRLSSSAQMASLQSPQQ
FT                   LQVGFWQGVGLQFLNIKAWLLALAIVAGWLAGRDDLTERLAVVLPVMAAYAFFSNLLYA
FT                   CVGALLRHWLAQGRRLLWFNRAMATMLALTAIWMVAA"
FT   gene            656795..658246
FT                   /locus_tag="Daci_0595"
FT   CDS_pept        656795..658246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0595"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: aav:Aave_4434 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33241"
FT                   /db_xref="GOA:A9BQ26"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ26"
FT                   /protein_id="ABX33241.1"
FT                   /translation="MTVPLSRLAPQTLSTQLAERLGERIRMRLLPAGARLPSVRECARQ
FT                   QGVSTHTVVAAYDLLQAQGLVEARPQSGFFVRDFVQDAPLLQPEQARAAPAEEAPGVPK
FT                   GTRINASMLVRGMFHQSVGGRPQPGAGVLPAEWLEAGFLAAAMRKACSGKSLHDSCVGY
FT                   GDPLGDIGLREALSRRLARLGIAAAPQHIITTMGATHGLDVVSRALLQPGDPVMVEEPG
FT                   WAVEFARLASLGMRVLPVPRGPDGPDLAVMQRYCESCAPKLYVSVSVLHNPTGYSLSPA
FT                   SAHEVLQLARRFGFYVVEDDTYGEIAPDHAARMTVLDRLSHSIYVSGFAKLLAPNWRVG
FT                   YLAPPPALVERLVDTKLLSTLTTPSLMERALAHCMDQGQLRRHAERLRQHLAQARMRSV
FT                   ALAQQAGARFAAEPAGMFGWVDTGVDTETLAQRLLDAGYFIAPGAMFHAGRQPSTCMRI
FT                   NFATTQEPAFWRIFEREVQAMRGSG"
FT   gene            complement(658460..659173)
FT                   /locus_tag="Daci_0596"
FT   CDS_pept        complement(658460..659173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0596"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: ajs:Ajs_3823 RNA polymerase, sigma 28 subunit,
FT                   FliA/WhiG family; TIGRFAM: RNA polymerase sigma factor,
FT                   FliA/WhiG family; RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33242"
FT                   /db_xref="GOA:A9BQ27"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028617"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ27"
FT                   /protein_id="ABX33242.1"
FT                   /translation="MYTAKGQLDRDALIRRHVPLVRRIALHMIAKLPPNVELDDLIQVG
FT                   MIGLAEALSRFESEQGVQFETFASQRIRGAMLDELREGDWMSRSSRKSQKDIEHALHRL
FT                   EQRLGRTPLESEIADELGMDLDDYQSLLGKVRGTQLVYLEDMSGGDEGEDFLERHVADS
FT                   GADPFALLRDHRLRVALVEAIKALPEREQYIMGMYYEHDMNLKEIAAVLGVTESRVCQL
FT                   HSQAIARLRTKMRAH"
FT   gene            complement(659179..660060)
FT                   /locus_tag="Daci_0597"
FT   CDS_pept        complement(659179..660060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Daci_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Daci_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABX33243"
FT                   /db_xref="UniProtKB/TrEMBL:A9BQ28"
FT                   /protein_id="