(data stored in ACNUC7421 zone)

EMBL: CP000885

ID   CP000885; SV 1; circular; genomic DNA; STD; PRO; 4847594 BP.
XX
AC   CP000885; AAQT01000000-AAQT01000169;
XX
PR   Project:PRJNA16184;
XX
DT   20-NOV-2007 (Rel. 93, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 5)
XX
DE   Lachnoclostridium phytofermentans ISDg chromosome, complete genome.
XX
KW   .
XX
OS   Lachnoclostridium phytofermentans ISDg
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
XX
RN   [1]
RP   1-4847594
RA   Leschine S.B., Warnick T.A., Blanchard J.L., Schnell D.J., Petit E.L.,
RA   LaTouf W.G.;
RT   "Complete sequence of Clostridium phytofermentans ISDg";
RL   Unpublished.
XX
RN   [2]
RP   1-4847594
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Kiss H., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Kuske C., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Kim E.A., Richardson P.;
RT   ;
RL   Submitted (08-NOV-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 32b7c822a42b59d5a49c9ea0169a3d65.
DR   BioSample; SAMN02598360.
DR   EnsemblGenomes-Gn; Cphy_R0001.
DR   EnsemblGenomes-Gn; Cphy_R0002.
DR   EnsemblGenomes-Gn; Cphy_R0003.
DR   EnsemblGenomes-Gn; Cphy_R0004.
DR   EnsemblGenomes-Gn; Cphy_R0005.
DR   EnsemblGenomes-Gn; Cphy_R0006.
DR   EnsemblGenomes-Gn; Cphy_R0007.
DR   EnsemblGenomes-Gn; Cphy_R0008.
DR   EnsemblGenomes-Gn; Cphy_R0009.
DR   EnsemblGenomes-Gn; Cphy_R0010.
DR   EnsemblGenomes-Gn; Cphy_R0011.
DR   EnsemblGenomes-Gn; Cphy_R0013.
DR   EnsemblGenomes-Gn; Cphy_R0014.
DR   EnsemblGenomes-Gn; Cphy_R0015.
DR   EnsemblGenomes-Gn; Cphy_R0016.
DR   EnsemblGenomes-Gn; Cphy_R0017.
DR   EnsemblGenomes-Gn; Cphy_R0018.
DR   EnsemblGenomes-Gn; Cphy_R0019.
DR   EnsemblGenomes-Gn; Cphy_R0020.
DR   EnsemblGenomes-Gn; Cphy_R0021.
DR   EnsemblGenomes-Gn; Cphy_R0022.
DR   EnsemblGenomes-Gn; Cphy_R0023.
DR   EnsemblGenomes-Gn; Cphy_R0024.
DR   EnsemblGenomes-Gn; Cphy_R0025.
DR   EnsemblGenomes-Gn; Cphy_R0026.
DR   EnsemblGenomes-Gn; Cphy_R0027.
DR   EnsemblGenomes-Gn; Cphy_R0028.
DR   EnsemblGenomes-Gn; Cphy_R0029.
DR   EnsemblGenomes-Gn; Cphy_R0030.
DR   EnsemblGenomes-Gn; Cphy_R0031.
DR   EnsemblGenomes-Gn; Cphy_R0032.
DR   EnsemblGenomes-Gn; Cphy_R0033.
DR   EnsemblGenomes-Gn; Cphy_R0034.
DR   EnsemblGenomes-Gn; Cphy_R0035.
DR   EnsemblGenomes-Gn; Cphy_R0036.
DR   EnsemblGenomes-Gn; Cphy_R0037.
DR   EnsemblGenomes-Gn; Cphy_R0038.
DR   EnsemblGenomes-Gn; Cphy_R0039.
DR   EnsemblGenomes-Gn; Cphy_R0040.
DR   EnsemblGenomes-Gn; Cphy_R0041.
DR   EnsemblGenomes-Gn; Cphy_R0042.
DR   EnsemblGenomes-Gn; Cphy_R0043.
DR   EnsemblGenomes-Gn; Cphy_R0044.
DR   EnsemblGenomes-Gn; Cphy_R0045.
DR   EnsemblGenomes-Gn; Cphy_R0049.
DR   EnsemblGenomes-Gn; Cphy_R0050.
DR   EnsemblGenomes-Gn; Cphy_R0055.
DR   EnsemblGenomes-Gn; Cphy_R0056.
DR   EnsemblGenomes-Gn; Cphy_R0059.
DR   EnsemblGenomes-Gn; Cphy_R0060.
DR   EnsemblGenomes-Gn; Cphy_R0062.
DR   EnsemblGenomes-Gn; Cphy_R0063.
DR   EnsemblGenomes-Gn; Cphy_R0064.
DR   EnsemblGenomes-Gn; Cphy_R0065.
DR   EnsemblGenomes-Gn; Cphy_R0066.
DR   EnsemblGenomes-Gn; Cphy_R0067.
DR   EnsemblGenomes-Gn; Cphy_R0068.
DR   EnsemblGenomes-Gn; Cphy_R0069.
DR   EnsemblGenomes-Gn; Cphy_R0070.
DR   EnsemblGenomes-Gn; Cphy_R0071.
DR   EnsemblGenomes-Gn; Cphy_R0072.
DR   EnsemblGenomes-Gn; Cphy_R0073.
DR   EnsemblGenomes-Gn; Cphy_R0074.
DR   EnsemblGenomes-Gn; Cphy_R0075.
DR   EnsemblGenomes-Gn; Cphy_R0078.
DR   EnsemblGenomes-Gn; Cphy_R0079.
DR   EnsemblGenomes-Gn; Cphy_R0080.
DR   EnsemblGenomes-Gn; Cphy_R0082.
DR   EnsemblGenomes-Gn; Cphy_R0083.
DR   EnsemblGenomes-Gn; Cphy_R0084.
DR   EnsemblGenomes-Gn; Cphy_R0085.
DR   EnsemblGenomes-Gn; Cphy_R0086.
DR   EnsemblGenomes-Gn; Cphy_R0087.
DR   EnsemblGenomes-Gn; Cphy_R0088.
DR   EnsemblGenomes-Gn; Cphy_R0089.
DR   EnsemblGenomes-Gn; Cphy_R0090.
DR   EnsemblGenomes-Gn; Cphy_R0091.
DR   EnsemblGenomes-Gn; Cphy_R0092.
DR   EnsemblGenomes-Gn; Cphy_R0093.
DR   EnsemblGenomes-Gn; Cphy_R0094.
DR   EnsemblGenomes-Gn; Cphy_R0097.
DR   EnsemblGenomes-Gn; Cphy_R0098.
DR   EnsemblGenomes-Gn; Cphy_R0100.
DR   EnsemblGenomes-Gn; Cphy_R0101.
DR   EnsemblGenomes-Gn; Cphy_R0105.
DR   EnsemblGenomes-Gn; Cphy_R0106.
DR   EnsemblGenomes-Gn; Cphy_R0107.
DR   EnsemblGenomes-Gn; Cphy_R0108.
DR   EnsemblGenomes-Gn; Cphy_R0109.
DR   EnsemblGenomes-Gn; EBG00001043555.
DR   EnsemblGenomes-Gn; EBG00001043556.
DR   EnsemblGenomes-Gn; EBG00001043557.
DR   EnsemblGenomes-Gn; EBG00001043558.
DR   EnsemblGenomes-Gn; EBG00001043559.
DR   EnsemblGenomes-Gn; EBG00001043560.
DR   EnsemblGenomes-Gn; EBG00001043561.
DR   EnsemblGenomes-Gn; EBG00001043562.
DR   EnsemblGenomes-Gn; EBG00001043563.
DR   EnsemblGenomes-Gn; EBG00001043564.
DR   EnsemblGenomes-Gn; EBG00001043565.
DR   EnsemblGenomes-Gn; EBG00001043566.
DR   EnsemblGenomes-Gn; EBG00001043567.
DR   EnsemblGenomes-Gn; EBG00001043568.
DR   EnsemblGenomes-Gn; EBG00001043569.
DR   EnsemblGenomes-Gn; EBG00001043570.
DR   EnsemblGenomes-Gn; EBG00001043571.
DR   EnsemblGenomes-Gn; EBG00001043572.
DR   EnsemblGenomes-Gn; EBG00001043573.
DR   EnsemblGenomes-Gn; EBG00001043574.
DR   EnsemblGenomes-Gn; EBG00001043575.
DR   EnsemblGenomes-Gn; EBG00001043576.
DR   EnsemblGenomes-Gn; EBG00001043577.
DR   EnsemblGenomes-Gn; EBG00001043578.
DR   EnsemblGenomes-Gn; EBG00001043579.
DR   EnsemblGenomes-Gn; EBG00001043580.
DR   EnsemblGenomes-Gn; EBG00001043581.
DR   EnsemblGenomes-Gn; EBG00001043582.
DR   EnsemblGenomes-Gn; EBG00001043583.
DR   EnsemblGenomes-Gn; EBG00001043584.
DR   EnsemblGenomes-Gn; EBG00001043585.
DR   EnsemblGenomes-Gn; EBG00001043586.
DR   EnsemblGenomes-Gn; EBG00001043587.
DR   EnsemblGenomes-Gn; EBG00001043588.
DR   EnsemblGenomes-Gn; EBG00001043589.
DR   EnsemblGenomes-Gn; EBG00001043590.
DR   EnsemblGenomes-Gn; EBG00001043591.
DR   EnsemblGenomes-Gn; EBG00001043592.
DR   EnsemblGenomes-Gn; EBG00001043593.
DR   EnsemblGenomes-Gn; EBG00001043594.
DR   EnsemblGenomes-Gn; EBG00001043595.
DR   EnsemblGenomes-Gn; EBG00001043596.
DR   EnsemblGenomes-Gn; EBG00001043597.
DR   EnsemblGenomes-Gn; EBG00001043598.
DR   EnsemblGenomes-Gn; EBG00001043599.
DR   EnsemblGenomes-Gn; EBG00001043600.
DR   EnsemblGenomes-Gn; EBG00001043601.
DR   EnsemblGenomes-Gn; EBG00001043602.
DR   EnsemblGenomes-Gn; EBG00001043603.
DR   EnsemblGenomes-Gn; EBG00001043604.
DR   EnsemblGenomes-Gn; EBG00001043605.
DR   EnsemblGenomes-Gn; EBG00001043606.
DR   EnsemblGenomes-Gn; EBG00001043607.
DR   EnsemblGenomes-Gn; EBG00001043608.
DR   EnsemblGenomes-Gn; EBG00001043609.
DR   EnsemblGenomes-Gn; EBG00001043610.
DR   EnsemblGenomes-Gn; EBG00001043611.
DR   EnsemblGenomes-Gn; EBG00001043612.
DR   EnsemblGenomes-Gn; EBG00001043613.
DR   EnsemblGenomes-Gn; EBG00001043614.
DR   EnsemblGenomes-Gn; EBG00001043615.
DR   EnsemblGenomes-Gn; EBG00001043616.
DR   EnsemblGenomes-Gn; EBG00001043617.
DR   EnsemblGenomes-Gn; EBG00001043618.
DR   EnsemblGenomes-Gn; EBG00001043619.
DR   EnsemblGenomes-Gn; EBG00001043620.
DR   EnsemblGenomes-Gn; EBG00001043621.
DR   EnsemblGenomes-Gn; EBG00001043622.
DR   EnsemblGenomes-Gn; EBG00001043623.
DR   EnsemblGenomes-Gn; EBG00001043624.
DR   EnsemblGenomes-Gn; EBG00001043625.
DR   EnsemblGenomes-Gn; EBG00001043626.
DR   EnsemblGenomes-Gn; EBG00001043627.
DR   EnsemblGenomes-Gn; EBG00001043628.
DR   EnsemblGenomes-Gn; EBG00001043629.
DR   EnsemblGenomes-Gn; EBG00001043630.
DR   EnsemblGenomes-Gn; EBG00001043631.
DR   EnsemblGenomes-Gn; EBG00001043632.
DR   EnsemblGenomes-Gn; EBG00001043633.
DR   EnsemblGenomes-Gn; EBG00001043634.
DR   EnsemblGenomes-Gn; EBG00001043635.
DR   EnsemblGenomes-Gn; EBG00001043636.
DR   EnsemblGenomes-Gn; EBG00001043637.
DR   EnsemblGenomes-Gn; EBG00001043638.
DR   EnsemblGenomes-Gn; EBG00001043639.
DR   EnsemblGenomes-Gn; EBG00001043640.
DR   EnsemblGenomes-Gn; EBG00001043641.
DR   EnsemblGenomes-Gn; EBG00001043642.
DR   EnsemblGenomes-Gn; EBG00001043643.
DR   EnsemblGenomes-Gn; EBG00001043644.
DR   EnsemblGenomes-Gn; EBG00001043645.
DR   EnsemblGenomes-Gn; EBG00001043646.
DR   EnsemblGenomes-Gn; EBG00001043647.
DR   EnsemblGenomes-Gn; EBG00001043648.
DR   EnsemblGenomes-Gn; EBG00001043649.
DR   EnsemblGenomes-Gn; EBG00001043650.
DR   EnsemblGenomes-Gn; EBG00001043651.
DR   EnsemblGenomes-Gn; EBG00001043652.
DR   EnsemblGenomes-Gn; EBG00001043653.
DR   EnsemblGenomes-Gn; EBG00001043654.
DR   EnsemblGenomes-Gn; EBG00001043655.
DR   EnsemblGenomes-Gn; EBG00001043656.
DR   EnsemblGenomes-Gn; EBG00001043657.
DR   EnsemblGenomes-Gn; EBG00001043658.
DR   EnsemblGenomes-Gn; EBG00001043659.
DR   EnsemblGenomes-Gn; EBG00001043660.
DR   EnsemblGenomes-Gn; EBG00001043661.
DR   EnsemblGenomes-Gn; EBG00001043662.
DR   EnsemblGenomes-Tr; Cphy_R0001-1.
DR   EnsemblGenomes-Tr; Cphy_R0002-1.
DR   EnsemblGenomes-Tr; Cphy_R0003-1.
DR   EnsemblGenomes-Tr; Cphy_R0004-1.
DR   EnsemblGenomes-Tr; Cphy_R0005-1.
DR   EnsemblGenomes-Tr; Cphy_R0006-1.
DR   EnsemblGenomes-Tr; Cphy_R0007-1.
DR   EnsemblGenomes-Tr; Cphy_R0008-1.
DR   EnsemblGenomes-Tr; Cphy_R0009-1.
DR   EnsemblGenomes-Tr; Cphy_R0010-1.
DR   EnsemblGenomes-Tr; Cphy_R0011-1.
DR   EnsemblGenomes-Tr; Cphy_R0013-1.
DR   EnsemblGenomes-Tr; Cphy_R0014-1.
DR   EnsemblGenomes-Tr; Cphy_R0015-1.
DR   EnsemblGenomes-Tr; Cphy_R0016-1.
DR   EnsemblGenomes-Tr; Cphy_R0017-1.
DR   EnsemblGenomes-Tr; Cphy_R0018-1.
DR   EnsemblGenomes-Tr; Cphy_R0019-1.
DR   EnsemblGenomes-Tr; Cphy_R0020-1.
DR   EnsemblGenomes-Tr; Cphy_R0021-1.
DR   EnsemblGenomes-Tr; Cphy_R0022-1.
DR   EnsemblGenomes-Tr; Cphy_R0023-1.
DR   EnsemblGenomes-Tr; Cphy_R0024-1.
DR   EnsemblGenomes-Tr; Cphy_R0025-1.
DR   EnsemblGenomes-Tr; Cphy_R0026-1.
DR   EnsemblGenomes-Tr; Cphy_R0027-1.
DR   EnsemblGenomes-Tr; Cphy_R0028-1.
DR   EnsemblGenomes-Tr; Cphy_R0029-1.
DR   EnsemblGenomes-Tr; Cphy_R0030-1.
DR   EnsemblGenomes-Tr; Cphy_R0031-1.
DR   EnsemblGenomes-Tr; Cphy_R0032-1.
DR   EnsemblGenomes-Tr; Cphy_R0033-1.
DR   EnsemblGenomes-Tr; Cphy_R0034-1.
DR   EnsemblGenomes-Tr; Cphy_R0035-1.
DR   EnsemblGenomes-Tr; Cphy_R0036-1.
DR   EnsemblGenomes-Tr; Cphy_R0037-1.
DR   EnsemblGenomes-Tr; Cphy_R0038-1.
DR   EnsemblGenomes-Tr; Cphy_R0039-1.
DR   EnsemblGenomes-Tr; Cphy_R0040-1.
DR   EnsemblGenomes-Tr; Cphy_R0041-1.
DR   EnsemblGenomes-Tr; Cphy_R0042-1.
DR   EnsemblGenomes-Tr; Cphy_R0043-1.
DR   EnsemblGenomes-Tr; Cphy_R0044-1.
DR   EnsemblGenomes-Tr; Cphy_R0045-1.
DR   EnsemblGenomes-Tr; Cphy_R0049-1.
DR   EnsemblGenomes-Tr; Cphy_R0050-1.
DR   EnsemblGenomes-Tr; Cphy_R0055-1.
DR   EnsemblGenomes-Tr; Cphy_R0056-1.
DR   EnsemblGenomes-Tr; Cphy_R0059-1.
DR   EnsemblGenomes-Tr; Cphy_R0060-1.
DR   EnsemblGenomes-Tr; Cphy_R0062-1.
DR   EnsemblGenomes-Tr; Cphy_R0063-1.
DR   EnsemblGenomes-Tr; Cphy_R0064-1.
DR   EnsemblGenomes-Tr; Cphy_R0065-1.
DR   EnsemblGenomes-Tr; Cphy_R0066-1.
DR   EnsemblGenomes-Tr; Cphy_R0067-1.
DR   EnsemblGenomes-Tr; Cphy_R0068-1.
DR   EnsemblGenomes-Tr; Cphy_R0069-1.
DR   EnsemblGenomes-Tr; Cphy_R0070-1.
DR   EnsemblGenomes-Tr; Cphy_R0071-1.
DR   EnsemblGenomes-Tr; Cphy_R0072-1.
DR   EnsemblGenomes-Tr; Cphy_R0073-1.
DR   EnsemblGenomes-Tr; Cphy_R0074-1.
DR   EnsemblGenomes-Tr; Cphy_R0075-1.
DR   EnsemblGenomes-Tr; Cphy_R0078-1.
DR   EnsemblGenomes-Tr; Cphy_R0079-1.
DR   EnsemblGenomes-Tr; Cphy_R0080-1.
DR   EnsemblGenomes-Tr; Cphy_R0082-1.
DR   EnsemblGenomes-Tr; Cphy_R0083-1.
DR   EnsemblGenomes-Tr; Cphy_R0084-1.
DR   EnsemblGenomes-Tr; Cphy_R0085-1.
DR   EnsemblGenomes-Tr; Cphy_R0086-1.
DR   EnsemblGenomes-Tr; Cphy_R0087-1.
DR   EnsemblGenomes-Tr; Cphy_R0088-1.
DR   EnsemblGenomes-Tr; Cphy_R0089-1.
DR   EnsemblGenomes-Tr; Cphy_R0090-1.
DR   EnsemblGenomes-Tr; Cphy_R0091-1.
DR   EnsemblGenomes-Tr; Cphy_R0092-1.
DR   EnsemblGenomes-Tr; Cphy_R0093-1.
DR   EnsemblGenomes-Tr; Cphy_R0094-1.
DR   EnsemblGenomes-Tr; Cphy_R0097-1.
DR   EnsemblGenomes-Tr; Cphy_R0098-1.
DR   EnsemblGenomes-Tr; Cphy_R0100-1.
DR   EnsemblGenomes-Tr; Cphy_R0101-1.
DR   EnsemblGenomes-Tr; Cphy_R0105-1.
DR   EnsemblGenomes-Tr; Cphy_R0106-1.
DR   EnsemblGenomes-Tr; Cphy_R0107-1.
DR   EnsemblGenomes-Tr; Cphy_R0108-1.
DR   EnsemblGenomes-Tr; Cphy_R0109-1.
DR   EnsemblGenomes-Tr; EBT00001646586.
DR   EnsemblGenomes-Tr; EBT00001646587.
DR   EnsemblGenomes-Tr; EBT00001646588.
DR   EnsemblGenomes-Tr; EBT00001646589.
DR   EnsemblGenomes-Tr; EBT00001646590.
DR   EnsemblGenomes-Tr; EBT00001646591.
DR   EnsemblGenomes-Tr; EBT00001646592.
DR   EnsemblGenomes-Tr; EBT00001646593.
DR   EnsemblGenomes-Tr; EBT00001646594.
DR   EnsemblGenomes-Tr; EBT00001646595.
DR   EnsemblGenomes-Tr; EBT00001646596.
DR   EnsemblGenomes-Tr; EBT00001646597.
DR   EnsemblGenomes-Tr; EBT00001646598.
DR   EnsemblGenomes-Tr; EBT00001646599.
DR   EnsemblGenomes-Tr; EBT00001646600.
DR   EnsemblGenomes-Tr; EBT00001646601.
DR   EnsemblGenomes-Tr; EBT00001646602.
DR   EnsemblGenomes-Tr; EBT00001646603.
DR   EnsemblGenomes-Tr; EBT00001646604.
DR   EnsemblGenomes-Tr; EBT00001646605.
DR   EnsemblGenomes-Tr; EBT00001646606.
DR   EnsemblGenomes-Tr; EBT00001646607.
DR   EnsemblGenomes-Tr; EBT00001646608.
DR   EnsemblGenomes-Tr; EBT00001646609.
DR   EnsemblGenomes-Tr; EBT00001646610.
DR   EnsemblGenomes-Tr; EBT00001646611.
DR   EnsemblGenomes-Tr; EBT00001646612.
DR   EnsemblGenomes-Tr; EBT00001646613.
DR   EnsemblGenomes-Tr; EBT00001646614.
DR   EnsemblGenomes-Tr; EBT00001646615.
DR   EnsemblGenomes-Tr; EBT00001646616.
DR   EnsemblGenomes-Tr; EBT00001646617.
DR   EnsemblGenomes-Tr; EBT00001646618.
DR   EnsemblGenomes-Tr; EBT00001646619.
DR   EnsemblGenomes-Tr; EBT00001646620.
DR   EnsemblGenomes-Tr; EBT00001646621.
DR   EnsemblGenomes-Tr; EBT00001646622.
DR   EnsemblGenomes-Tr; EBT00001646623.
DR   EnsemblGenomes-Tr; EBT00001646624.
DR   EnsemblGenomes-Tr; EBT00001646625.
DR   EnsemblGenomes-Tr; EBT00001646626.
DR   EnsemblGenomes-Tr; EBT00001646627.
DR   EnsemblGenomes-Tr; EBT00001646628.
DR   EnsemblGenomes-Tr; EBT00001646629.
DR   EnsemblGenomes-Tr; EBT00001646630.
DR   EnsemblGenomes-Tr; EBT00001646631.
DR   EnsemblGenomes-Tr; EBT00001646632.
DR   EnsemblGenomes-Tr; EBT00001646633.
DR   EnsemblGenomes-Tr; EBT00001646634.
DR   EnsemblGenomes-Tr; EBT00001646635.
DR   EnsemblGenomes-Tr; EBT00001646636.
DR   EnsemblGenomes-Tr; EBT00001646637.
DR   EnsemblGenomes-Tr; EBT00001646638.
DR   EnsemblGenomes-Tr; EBT00001646639.
DR   EnsemblGenomes-Tr; EBT00001646640.
DR   EnsemblGenomes-Tr; EBT00001646641.
DR   EnsemblGenomes-Tr; EBT00001646642.
DR   EnsemblGenomes-Tr; EBT00001646643.
DR   EnsemblGenomes-Tr; EBT00001646644.
DR   EnsemblGenomes-Tr; EBT00001646645.
DR   EnsemblGenomes-Tr; EBT00001646646.
DR   EnsemblGenomes-Tr; EBT00001646647.
DR   EnsemblGenomes-Tr; EBT00001646648.
DR   EnsemblGenomes-Tr; EBT00001646649.
DR   EnsemblGenomes-Tr; EBT00001646651.
DR   EnsemblGenomes-Tr; EBT00001646653.
DR   EnsemblGenomes-Tr; EBT00001646654.
DR   EnsemblGenomes-Tr; EBT00001646657.
DR   EnsemblGenomes-Tr; EBT00001646658.
DR   EnsemblGenomes-Tr; EBT00001646660.
DR   EnsemblGenomes-Tr; EBT00001646661.
DR   EnsemblGenomes-Tr; EBT00001646663.
DR   EnsemblGenomes-Tr; EBT00001646665.
DR   EnsemblGenomes-Tr; EBT00001646667.
DR   EnsemblGenomes-Tr; EBT00001646668.
DR   EnsemblGenomes-Tr; EBT00001646669.
DR   EnsemblGenomes-Tr; EBT00001646671.
DR   EnsemblGenomes-Tr; EBT00001646673.
DR   EnsemblGenomes-Tr; EBT00001646674.
DR   EnsemblGenomes-Tr; EBT00001646675.
DR   EnsemblGenomes-Tr; EBT00001646679.
DR   EnsemblGenomes-Tr; EBT00001646681.
DR   EnsemblGenomes-Tr; EBT00001646682.
DR   EnsemblGenomes-Tr; EBT00001646683.
DR   EnsemblGenomes-Tr; EBT00001646684.
DR   EnsemblGenomes-Tr; EBT00001646686.
DR   EnsemblGenomes-Tr; EBT00001646688.
DR   EnsemblGenomes-Tr; EBT00001646690.
DR   EnsemblGenomes-Tr; EBT00001646692.
DR   EnsemblGenomes-Tr; EBT00001646693.
DR   EnsemblGenomes-Tr; EBT00001646695.
DR   EnsemblGenomes-Tr; EBT00001646696.
DR   EnsemblGenomes-Tr; EBT00001646697.
DR   EnsemblGenomes-Tr; EBT00001646700.
DR   EnsemblGenomes-Tr; EBT00001646701.
DR   EnsemblGenomes-Tr; EBT00001646702.
DR   EnsemblGenomes-Tr; EBT00001646704.
DR   EnsemblGenomes-Tr; EBT00001646705.
DR   EnsemblGenomes-Tr; EBT00001646707.
DR   EnsemblGenomes-Tr; EBT00001646708.
DR   EnsemblGenomes-Tr; EBT00001646709.
DR   EnsemblGenomes-Tr; EBT00001646711.
DR   EnsemblGenomes-Tr; EBT00001646712.
DR   EnsemblGenomes-Tr; EBT00001646713.
DR   EnsemblGenomes-Tr; EBT00001646716.
DR   EnsemblGenomes-Tr; EBT00001646718.
DR   EnsemblGenomes-Tr; EBT00001646720.
DR   EnsemblGenomes-Tr; EBT00001646721.
DR   EuropePMC; PMC2740546; 19491100.
DR   EuropePMC; PMC3147429; 21685171.
DR   EuropePMC; PMC3584212; 23239474.
DR   EuropePMC; PMC3639104; 23578222.
DR   EuropePMC; PMC4149025; 25197485.
DR   EuropePMC; PMC5309861; 28198470.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01059; mir-598.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP000885.
DR   SILVA-SSU; CP000885.
DR   StrainInfo; 302291; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634491
CC   Source DNA and bacteria available from Susan Leschine
CC   (suel@microbio.umass.edu)
CC   Contacts: Susan Leschine (suel@microbio.umass.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4847594
FT                   /organism="Lachnoclostridium phytofermentans ISDg"
FT                   /strain="ISDg"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:357809"
FT                   /type_material="type strain of Lachnoclostridium
FT                   phytofermentans"
FT   gene            75..1436
FT                   /locus_tag="Cphy_0001"
FT   CDS_pept        75..1436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: cbf:CLI_0001 chromosomal replication initiator
FT                   protein DnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator DnaA
FT                   domain; Chromosomal replication initiator DnaA; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40392"
FT                   /db_xref="GOA:A9KPP1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KPP1"
FT                   /protein_id="ABX40392.1"
FT                   /translation="MKSLIQEKWNEILEFLKIEYNVTEVSYKTWLLPLKVYDVKDNVIK
FT                   LSVDDTKIGANSLDFIKNKYSQFLKTAIAEVINQDFEIEFVLLSQTKAEEKVQTQAPNK
FT                   IKNESLSYLNPRYTFDTFVVGANNNLAHAASLAVAESPAEIYNPLFIYGGVGLGKTHLM
FT                   HSIAHYILEQNPNSKVLYVTSEKFTNELIESIRNADTTPTEFREKYRNIDVLLIDDIQF
FT                   IIGKERTQEEFFHTFNTLHESKKQIIISSDKPPKDILTLEERLRSRFEWGLTVDIQSPD
FT                   YETRMAILKKKEELDCLTIDDEVMKYIASNIKSNIRELEGALTKIVALSRLKKKEVDVI
FT                   LAEEALKDLISPDNKKTVTLDLIIEVVSEHFTTSTSEIYSDNRSRNIAYPRQIAMYLCR
FT                   KLTSLSLTDIGKMMGNRDHSTVLHGCNKVEKDIKKDPSFQNTIDVLIKKINPTP"
FT   gene            1849..2961
FT                   /locus_tag="Cphy_0002"
FT   CDS_pept        1849..2961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: cth:Cthe_2372 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40393"
FT                   /db_xref="GOA:A9KPP2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPP2"
FT                   /protein_id="ABX40393.1"
FT                   /translation="MKIACQKNELLNSVNIALKAVSSKSTMPILECIVIEVQNDTIKLI
FT                   SNDMEIGIETIVKGSIISNGSVAINAKVFSEIIRKLPDNEVNVETDEKFMTTITCEKAK
FT                   FTIAGKSAEEFPMLPTIEKKEAIELSQFTLKEVIRQTVFSISDNESNKIMTGELFEING
FT                   NELRVVSLDGHRISIRKVELKNSYAPKKILVPGKTLQEVSKILSGEISDEVFIYYTDRH
FT                   VLFVFDDTLVLSRLIEGEYYKIDQMLSGDYETKVKINKKEFLSCIDRATLLIKETEKKP
FT                   IIVGIEDKKLELKINTSIGTMDEDIDIEKEGKDILIGFNPKFLIDALRVIDDEEVEIYL
FT                   INPKAPCFIKDKEESYIYLILPVSFNAAQY"
FT   gene            3099..3314
FT                   /locus_tag="Cphy_0003"
FT   CDS_pept        3099..3314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0003"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   art:Arth_1328 RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40394"
FT                   /db_xref="GOA:A9KPP3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPP3"
FT                   /protein_id="ABX40394.1"
FT                   /translation="MEKIILREEFIKLGQALKAAGLVDSGVEAKDVITEGLVKVNGVVE
FT                   YQRGKKIHGGDSIEFNNEIVQIVDHE"
FT   gene            3870..4952
FT                   /locus_tag="Cphy_0004"
FT   CDS_pept        3870..4952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: cpr:CPR_0004 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40395"
FT                   /db_xref="GOA:A9KPP4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KPP4"
FT                   /protein_id="ABX40395.1"
FT                   /translation="MIVKSLELSNFRNYENLSLEFSPSTNILYGDNAQGKTNILEAVFL
FT                   CATTKSHKGSKDREIIKLQSEEAHIRMRINRDDVDHRLDMHLKKNKPKGVAIDGIPIKR
FT                   SSELFGIINVVFFSPEDLSIIKNGPSERRRFIDMELCQLSKLYLHNLINYNKVLNQRNN
FT                   LLKQIGFNKSLLDTLYVWDQQLIHFGSALIKERDAFMKSMNELIIALHKKLSDGKEELE
FT                   IVYEASVAESEFENKLKKSMERDIALKVTNVGPHRDDLSFLINGQDVRKYGSQGQQRTA
FT                   ALSLKLAEIELVKQVTKDKPILLLDDVLSELDRKRQNQLLDSIVGIQTIVTCTGLEEFV
FT                   NNRIETDRIYKVIQGTVEKG"
FT   gene            4986..6914
FT                   /locus_tag="Cphy_0005"
FT   CDS_pept        4986..6914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: cno:NT01CX_0862 DNA gyrase, B subunit;
FT                   TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase subunit B
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   TOPRIM domain protein; DNA topoisomerase type IIA subunit B
FT                   region 2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40396"
FT                   /db_xref="GOA:A9KPP5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPP5"
FT                   /protein_id="ABX40396.1"
FT                   /translation="MSKDYGADQIQILEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDN
FT                   AVDEALAGYCNTIDVSINPDNSITVIDNGRGIPVETNKKKGISTVEVVFTILHAGGKFG
FT                   GGGYKVSGGLHGVGASVVNALSEWLEVTVELEGKMYKQRYECGKVIEPLRVVGESDRTG
FT                   TTVSFLPDRSIFEETVYDYDILKQRLREMAFLTKGLKIILRDLRTSEEEGNTEPNVKEF
FT                   HYEGGIKEYVQYLNKHKSNLYPEIIYCEGTRDSVYVEVAMQHNDSYSESCYSFVNNITT
FT                   PEGGTHYTGFKNAITKTFNDFARQMKFLKDNETNLSGEDIREGLTAIISIKLPDPQFEG
FT                   QTKQKLGNSEARAAVDSVVSEQLTYFLEQNPSVAKIILEKAVLAQRARDAARKARDLTR
FT                   RKTALEGMSLPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILN
FT                   VEKSRLDKILVNNEIKAMITAFGTGISDDFDISKLRYHKIIIMTDADVDGAHISTLLLT
FT                   FLYRFMPELIRDGYVYLAQPPLYKVEKSKQVWYAYSDEDLNNILLQIGRDQNNKIQRYK
FT                   GLGEMDAEQLWETTMDPERRVLLRVKMDEENSSEIDLTFTTLMGDNVEPRREFIEANAK
FT                   YVKNLDI"
FT   gene            6932..9631
FT                   /locus_tag="Cphy_0006"
FT   CDS_pept        6932..9631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: amt:Amet_0007 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40397"
FT                   /db_xref="GOA:A9KPP6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPP6"
FT                   /protein_id="ABX40397.1"
FT                   /translation="MDENIFDKVHDVDLKKTMETSYIEYAMSVIAARALPDVRDGLKPV
FT                   QRRILYAMIELNNGPDKPHRKCARIVGDTMGKYHPHGDSSIYGALVNLAQEWSTRYPLV
FT                   DGHGNFGSVDGDGAAAMRYTEARLSKISMEMLSDINKDTVDFAPNFDETEKEPLVLPAR
FT                   YPNLLVNGTSGIAVGMATNIPPHNMREIIGAVVRIIDNKIEEKETTIEELLEIVKGPDF
FT                   PTGAMILGTRGIEEAYRTGRGKIRVRAVTNIEPMANGKNRIIVTELPYMVNKARLIEKI
FT                   AELVRDKKIDGITELRDESDREGMRICIELRRDVNANVILNQLYKHTQLQDTFGVIMLA
FT                   LVNNQPKVLTLLEMLSYYLKHQEEVVTRRITYDLNKAKERAHILEGLLKALDFIDEVIN
FT                   IIRASKNGAMAKERLIERFEFDDIQAQAIIDMRLRALTGLEREKLQDEFAELQRRIAEF
FT                   EAILADEKLLLGVIKGEIQVINDKFGDERRTSIGFDEFDISMEDLIPDENTVIAMTRLG
FT                   YIKRMTIDNFKSQHRGGKGIKGMQTIDEDFIEDLFMTTTHHYIMFFTNKGRVYRLKAYE
FT                   IPESSRTARGTAIVNLLQLLPEERITAIIALKEYKDNRYLFMATKDGIVKKTKIKEYQN
FT                   IRKTGLQAINLREDDELIEVKTTNSQKDIVLVTKNGMCIRFHEKDVRNTGRASMGVIGM
FT                   NLTNGDEVVAMQIHTQGKYLLTVSEYGLGKLTDLDEFTPQRRGGKGVKCYKITEKTGNV
FT                   VGAKAVNEEHEVMIITNEGIIIRLEVNGISILGRITSGVKLINIDAGKDIRVASLAKVK
FT                   ESSMNSEEDVLKKLEEELKEENVVIPPEDDQEEEEYSEEDDSFEGDNSLEEEDLMDDTK
FT                   DLEELVSRALKDQEEQEDQEKQEEDQED"
FT   gene            9911..10753
FT                   /locus_tag="Cphy_0007"
FT   CDS_pept        9911..10753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0007"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="KEGG: cth:Cthe_3090 hydro-lyases, Fe-S type,
FT                   tartrate/fumarate subfamily, alpha subunit; TIGRFAM:
FT                   hydro-lyase, Fe-S type, tartrate/fumarate subfamily, alpha
FT                   subunit; PFAM: Fe-S type hydro-lyase tartrate/fumarate
FT                   alpha region"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40398"
FT                   /db_xref="GOA:A9KPP7"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPP7"
FT                   /protein_id="ABX40398.1"
FT                   /translation="MRIVHTNAITKAIKEMCIEANLHLTEDVTNRLKKASLMENSDLGK
FT                   KILGQLKENLEIAQKDLIPICQDTGMAVVFISIGQDVHLEGDYLETAINEGIRQGYEEG
FT                   YLRKSVVNDPLLRENTKDNTPGIIHYSIIPGEDIEITVAPKGFGSENMSRVVMLKPSDG
FT                   EEGIKKAVLETVKLAGPNACPPMVIGVGIGGTFEKCAILAKKALTRNLEESSKEEHIKR
FT                   LEQELLKEINQTGIGPGGLGGNTTALGVNIEIYPTHIAGLPLAINICCHVNRHVKRVL"
FT   gene            10807..11355
FT                   /locus_tag="Cphy_0008"
FT   CDS_pept        10807..11355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0008"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate beta region; KEGG: amt:Amet_3412
FT                   hydro-lyase, Fe-S type, tartrate/fumarate subfamily, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40399"
FT                   /db_xref="GOA:A9KPP8"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPP8"
FT                   /protein_id="ABX40399.1"
FT                   /translation="MDKYITTPIDSSKVVGLKAGDYVYLSGKIYTARDAAHKRMFEALQ
FT                   QNKELPFDMTNQVIYYLGPTPAREGQVIGSAGPTTSSRMDKYTPTLLDLGLKGMIGKGK
FT                   RNEDVIASMVRNKAVYFAAVGGAGALLSKCIKSSKVIAYEDLGTEAIRELWVENLPVIV
FT                   VIDSNGNNFYELQMNSINS"
FT   gene            11434..11871
FT                   /locus_tag="Cphy_0009"
FT   CDS_pept        11434..11871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0009"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   csc:Csac_2255 transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40400"
FT                   /db_xref="GOA:A9KPP9"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPP9"
FT                   /protein_id="ABX40400.1"
FT                   /translation="MKISTKGRYALRLMLDLAINNTGEFITIKSIAGRQEISDKYLEQI
FT                   ITLLSRAGYVKSSRGAQGGYRLTKEPKEYTVGMILKLIEGSLAPVSCVEEEDNDCNRYG
FT                   SCATLFVYQKINEAVNNVVDNITLEDLVERHRELGENNYVI"
FT   gene            12344..13630
FT                   /locus_tag="Cphy_0010"
FT   CDS_pept        12344..13630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0010"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /note="KEGG: cbe:Cbei_0766
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; TIGRFAM:
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40401"
FT                   /db_xref="GOA:A9KPQ0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPQ0"
FT                   /protein_id="ABX40401.1"
FT                   /translation="MSEQKRNLKFETLQLHVGQENADIATDARAVPIYQTTSYVFHNAD
FT                   HATARFNLTDAGNIYGRLTNPTQDVFEKRISALEGGVAALAVASGAAAITYTIMNLAQS
FT                   GDHIVASKDIYGGSYNLLAHTLKEYGITTTFVDASDVENVKYAIKDNTKGVFIESLGNP
FT                   NSNVLDIEAIAKIAHENKIPLVIDNTFATPYLLRPIEYGADIVVHSATKFIGGHGTSIG
FT                   GVIIDSGKFDWEASGKFSSLTEPNPSYHGISFTKAVGEAAFVTKIRAILLRDTGAALSP
FT                   FHAFMFLQGLETLSLRVERHVENALKVVEFLNKHPNIEKVNHPSLKESESHELYQKYFK
FT                   KGAGSIFTIEIKGGEKEAKEFIDKLQIFSLLANVADVKSLVIHPASTTHSQMNEEELKN
FT                   SGIKPNTVRLSIGTEHIDDILYDLEKALD"
FT   gene            13672..14604
FT                   /locus_tag="Cphy_0011"
FT   CDS_pept        13672..14604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0011"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthase; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: cbe:Cbei_4356 cysteine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40402"
FT                   /db_xref="GOA:A9KPQ1"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPQ1"
FT                   /protein_id="ABX40402.1"
FT                   /translation="MKIAKSLTDLIGNTPLLELSSFVKQQDLKANIIGKLEYFNPAGSV
FT                   KDRVAKAMIEDAEERGLIKKGAVIIEPTSGNTGIGLASVATARGYRIILTMPETMSVER
FT                   RNLLKAYGAELVLTDGSLGMKGAIAKAEELAKETPNSFIPGQFINPANPEVHRKTTGPE
FT                   IWKDTDGKVDILVSGIGTGGTITGAGEYLKTQNPNIKVVAVEPASSPVLSKGVAGPHKI
FT                   QGIGAGFIPDTLNTKVYDEIITVENEDAFTTGREIAKTEGLLVGISSGAAVYAAVQLAK
FT                   RPENAGKNIVVILPDTGERYLSTPLFSEQ"
FT   gene            15146..15233
FT                   /locus_tag="Cphy_R0001"
FT                   /note="tRNA-Ser1"
FT   tRNA            15146..15233
FT                   /locus_tag="Cphy_R0001"
FT                   /product="tRNA-Ser"
FT   gene            15754..17276
FT                   /locus_tag="Cphy_R0002"
FT   rRNA            15754..17276
FT                   /locus_tag="Cphy_R0002"
FT                   /product="16S ribosomal RNA"
FT   gene            17450..17566
FT                   /locus_tag="Cphy_R0003"
FT   rRNA            17450..17566
FT                   /locus_tag="Cphy_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            17924..20823
FT                   /locus_tag="Cphy_R0004"
FT   rRNA            17924..20823
FT                   /locus_tag="Cphy_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            20955..21031
FT                   /locus_tag="Cphy_R0005"
FT                   /note="tRNA-Asp1"
FT   tRNA            20955..21031
FT                   /locus_tag="Cphy_R0005"
FT                   /product="tRNA-Asp"
FT   gene            21063..21135
FT                   /locus_tag="Cphy_R0006"
FT                   /note="tRNA-Val1"
FT   tRNA            21063..21135
FT                   /locus_tag="Cphy_R0006"
FT                   /product="tRNA-Val"
FT   gene            21189..21261
FT                   /locus_tag="Cphy_R0007"
FT                   /note="tRNA-Thr1"
FT   tRNA            21189..21261
FT                   /locus_tag="Cphy_R0007"
FT                   /product="tRNA-Thr"
FT   gene            21271..21352
FT                   /locus_tag="Cphy_R0008"
FT                   /note="tRNA-Tyr1"
FT   tRNA            21271..21352
FT                   /locus_tag="Cphy_R0008"
FT                   /product="tRNA-Tyr"
FT   gene            21414..21487
FT                   /locus_tag="Cphy_R0009"
FT                   /note="tRNA-Met1"
FT   tRNA            21414..21487
FT                   /locus_tag="Cphy_R0009"
FT                   /product="tRNA-Met"
FT   gene            21533..21605
FT                   /locus_tag="Cphy_R0010"
FT                   /note="tRNA-Phe1"
FT   tRNA            21533..21605
FT                   /locus_tag="Cphy_R0010"
FT                   /product="tRNA-Phe"
FT   gene            21653..21728
FT                   /locus_tag="Cphy_R0011"
FT                   /note="tRNA-Lys1"
FT   tRNA            21653..21728
FT                   /locus_tag="Cphy_R0011"
FT                   /product="tRNA-Lys"
FT   gene            22337..23074
FT                   /locus_tag="Cphy_0012"
FT   CDS_pept        22337..23074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0012"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: cno:NT01CX_0771 transcriptional regulator, Sir2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40403"
FT                   /db_xref="GOA:A9KPQ2"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPQ2"
FT                   /protein_id="ABX40403.1"
FT                   /translation="MTKETEQLIEIVKESNNIVFFGGAGVSTESGIPDFRSENGLYTTG
FT                   QGKKYSPEQLLSHSFFMRHTHDFFAYYKSHMIYKEAKPNPAHLALAKLEELGKLSAVIT
FT                   QNIDSLHQVAGSQTVYELHGSSNRNYCMKCRKSFSLDQIMKMDTVPICTNCGGVVKPDV
FT                   VLYEEELKQATIQKAIDAILKADTMIVGGTSLVVWPAASLIEYFQGKNLVLINKSETTY
FT                   DTMASLVIHDSIGEVLDSVIRTL"
FT   gene            23329..23982
FT                   /locus_tag="Cphy_0013"
FT   CDS_pept        23329..23982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0013"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: cbe:Cbei_4645 putative transaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40404"
FT                   /db_xref="GOA:A9KPQ3"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KPQ3"
FT                   /protein_id="ABX40404.1"
FT                   /translation="MKFFIDTANVEEIKKANDMGVICGVTTNPSLIAKEGRDFKEVITE
FT                   ITNIVDGPISGEVKATTEDAESMIKEGREIAKIHPNMVVKIPMTVEGLKATKVLSQEGI
FT                   KTNVTLVFSANQALLAARAGATYVSPFLGRLDDISTPGIDLIRTISDIFEIYNLPTEII
FT                   AASVRNPVHITDCALAGAHIATVPYSVIVQCTKHPLTDAGIEKFKADYRAVFGE"
FT   gene            24186..26168
FT                   /locus_tag="Cphy_0014"
FT   CDS_pept        24186..26168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0014"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase central region; KEGG: ctc:CTC01332
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40405"
FT                   /db_xref="GOA:A9KPQ4"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPQ4"
FT                   /protein_id="ABX40405.1"
FT                   /translation="MNNIDTMSINAIRVLAADAVQKAKSGHPGLPLGCAAIAYDIWANE
FT                   MKHNPANPDWANRDRFILSGGHGSTLLYSLLHLFGYGLTKEDMMQFRQLDSLTPGHPEY
FT                   RHTKGVEATTGPLGAGMAMAVGMAMSEEHLAAKFNKENYPVVDHYTYVLGGDGCMMEGI
FT                   SYEAFSLAGTLGLSKLIVFYDSNKISIEGDTDIAFTEDVLKRFEAFHFQTIVVEDGNNI
FT                   EEISNAVKAAKADTNRPSLILCKTQIGYGCPAKQGKASAHGEPLGDDNVVALKENIGWP
FT                   STEPFFVPEEVYAHYNEIAAKKAEDETAWNKMFAEYCSAYPEMKEAWEKEFDLDVAKEL
FT                   IDNEEFWSFEDKPEATRNLSGVILNKLKNYVPSLIGGAADLAPSTKTYLNNEGDFSKDN
FT                   RLGRNLHFGVRELAMAAIGNGMVLHGLRAYVSTFFVFSDYMKPMARLSSLMRIPTTFVW
FT                   THDSIGVGEDGPTHEPIEQLAMYRAMPNFHIFRPADATETIAAWYSAVTSKETPTALVL
FT                   TRQNLPQLAGSSKEALKGAYVLEDSNKETPDAIIIATGSEVELAVAAKAELLKEGVDVR
FT                   VVSMPCMDIFEEQSKEYKESILPSAVRKRVAVEALIGYGWEKYVGLDGTIVSMNGFGAS
FT                   APAGTLFKKFGFTTENVVASVKSIL"
FT   gene            26532..27218
FT                   /locus_tag="Cphy_0015"
FT   CDS_pept        26532..27218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0015"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: amt:Amet_1506 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40406"
FT                   /db_xref="GOA:A9KPQ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPQ5"
FT                   /protein_id="ABX40406.1"
FT                   /translation="MAKILIVEDEVKIARFVELELKYEGYTVDIANDGRSGLEKALKSD
FT                   IDLVLLDVMLPGLSGIEVCRRIRMESQVPIIMLTAKDDVTDKVAGLDMGADDYMTKPFA
FT                   IEELLARIRVALSRHSKSSAEAKQDVLTHGELKLNLTSHSANYGEEDLTLTKKEYELLE
FT                   YLMRNKNIALTREQLLNNVWDYEYFGDTNVVDVYIRYLRQKIDDKYGVHLISTVRGVGY
FT                   IIRDEK"
FT   gene            27208..28647
FT                   /locus_tag="Cphy_0016"
FT   CDS_pept        27208..28647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0016"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: amt:Amet_1507
FT                   integral membrane sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40407"
FT                   /db_xref="GOA:A9KPQ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPQ6"
FT                   /protein_id="ABX40407.1"
FT                   /translation="MKNRAVEKIRSVLRKVILPYRKKKEAMLGGIRLSITNRIAMNYMK
FT                   LLIINGFLFFFVFSILYLNIEKGRYEDLAEEIVVNLENDGDAFLTVVNPYSKLGVNMIL
FT                   YEVDTGREVYNDVTYDVKNYRRIFRSIHYTKSSDTHRLILDDDMEFVQGGTLYRAQFFY
FT                   NMTKDYNRMWSLLWNMLILYVIIVFFIIQEGKKNNIKLLEPIQSMSATVNRLTVSNLHS
FT                   ERLNVAGTKNELKDLAIVFNNMLDRLETSYDRQKQFVSDASHELRTPIAVIQGYINMLS
FT                   RWGSKDQEILEESIEAIKNEAKAMQDLVEKLLFLSRHDKKTLKLEKKIFNMRPIVEEMV
FT                   KETKLVTANRVIEAPYLEDVNVYGDKQALKQAIRVFIDNAVKYTQDGDTIRIYCRNIRG
FT                   DCMIGVEDTGIGMTRKDMDNIFNRFYRSDHVRDRKIEGHGLGLSIAKLIIMAHTGRIKV
FT                   RSQFTKGTSFIVTIPRIRYDS"
FT   gene            complement(29061..30842)
FT                   /locus_tag="Cphy_0017"
FT   CDS_pept        complement(29061..30842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0017"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: cpe:CPE1525
FT                   probable ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40408"
FT                   /db_xref="GOA:A9KPQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPQ7"
FT                   /protein_id="ABX40408.1"
FT                   /translation="MAVNAIKEDESLHVASKKNTLLRLYRYLLAYKKSIAVVLLIMCGT
FT                   ITISLINPIIIEKAIDKYIKGGNINGLIKLGIFALVLNITLVILVKLRMYIMSKLSNSV
FT                   LVTIRQELYTHIQTLSFKFFDSRPTGKILARIMGDVNSLKDVLSNSVTTLIPDFITICS
FT                   VVIIMFVKNYKLALASLCSFPLMAFGVWFVQTRAHKRWQIHKKKSSNVNAFIHEDVSGM
FT                   RIIQSFGAEDETEEEFDELLKEHRDSFMSAVRFADAFGPIVDICWALATLFLFLVGVNL
FT                   IGKDPSVEVGTIVAFGSYISMFWHPLLNLSNFYNQLITNITGAERIFEILDTKPDVNDA
FT                   KDVHTLPNVRGEVDFKHVSFSYDEDTNVLRDVSFHVKPGETIALVGPTGAGKTTIINLI
FT                   SRFYDIQKGTITIDGYDLTKVSIESLREQMGVMTQDNFLFTGTIKENISYGKLDATDEE
FT                   IITAAKAVNAHEFIMKMEKGYDTELKERGAGLSIGQKQLLAFARTMVSKPKILILDEAT
FT                   SSIDTHTELLVQKGIEALLKGRTSFVIAHRLSTIQKADRIFVIDNGGIIESGSAAELLE
FT                   RKGAYYNLYMAQFKNIA"
FT   gene            complement(30987..32732)
FT                   /locus_tag="Cphy_0018"
FT   CDS_pept        complement(30987..32732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0018"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: cbe:Cbei_2793
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40409"
FT                   /db_xref="GOA:A9KQA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQA0"
FT                   /protein_id="ABX40409.1"
FT                   /translation="MKISHYLKKYWYRYAFAIFCIFVTVGLDMLNPQVTMRIIDNVIGE
FT                   GQRDQLAPLLVVVLLIGVGRCIFGYLKEYNFDSVSSKISADLRSKLFRHIQTLSVDFFD
FT                   KNNTGELMSRVKDDVDRIWDAFNYVSMLLIEVVIHTSIILYCMFHLNKKLFLVPVIAMP
FT                   LVAILAVLLERKLGGIYEEISEQNATLNTIAQENLAGVRTVKAFAREKFEIQKFLSHNK
FT                   RYYDLNMSQSKVLTRYQPLFQLITRALPLIIVIYGGYLTIQGEITLGVLAAFVEYSNNI
FT                   TWPMEMIGWLTNAAASAVASNKKIKKIFAENPSIQNPEKPVILDEITGNIEFRNVDFEI
FT                   DGKEILHNINFHLPAGKTIGIMGATGAGKTSIINVLQRFYDVKEGEVLLDGVNIKELNL
FT                   TQLRKSVSLVMQDVFLFSDTINENVKLGKKTSIEDDEVIHALKHAQASDFIEQMEEQYD
FT                   TIIGERGVGLSGGQKQRISIGRAIAKKAPILVLDDSTSALDMETEHQIQETLNSLNGTT
FT                   KIIIAHRISAVRNADEIIFLENGTIAERGTHNDLLKKEGLYYETYMAQYGDYLETSKEV
FT                   IACNY"
FT   gene            33488..33748
FT                   /locus_tag="Cphy_0019"
FT   CDS_pept        33488..33748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40410"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQA1"
FT                   /protein_id="ABX40410.1"
FT                   /translation="MTVQNAPFIRRPYGKLLISYIIETKSVSIIEGIIETKSRKHVSII
FT                   IGIIETKSRKHVSIIIGIIETKSRKHVSIIEGIIEMESMVQ"
FT   gene            33777..34718
FT                   /locus_tag="Cphy_0020"
FT   CDS_pept        33777..34718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0020"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: lin:lin0794
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40411"
FT                   /db_xref="GOA:A9KQA2"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQA2"
FT                   /protein_id="ABX40411.1"
FT                   /translation="MELPMFYDQTEEWNRALLIYDAALKEVNTKLEILNNEFKLAHQYN
FT                   PIEHITSRVKTPQSIAKKIRHNNMELTVENIVKYINDVAGIRIICSFTSDIYRIADLIR
FT                   KQSDVKVLKIKDYITNPKPNGYMSYHMIVTVPIFLSQEVIETKVEIQIRTIAMDFWASL
FT                   EHKMYYKFEGNAPSHITRELKECADIVSFLDQKMLAINEEIRTYSDDPMDHYREIVSGM
FT                   FHSKIKDSYGSIVEDNISEEEVVKESVSENVKAIEQKEELIIDNEAEANVYSEMVSALQ
FT                   EKALKTKTSDKVPFSLFGGSKRKKQEMKANAQ"
FT   gene            complement(34946..35857)
FT                   /locus_tag="Cphy_0021"
FT   CDS_pept        complement(34946..35857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0021"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   cno:NT01CX_1373 RpsA"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40412"
FT                   /db_xref="GOA:A9KQA3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQA3"
FT                   /protein_id="ABX40412.1"
FT                   /translation="MDETNLTMDDFKTELEHSLKRLTEGDLVKGTVIGISDTEVTVDLS
FT                   YSSEGIIKLEELSNDPRFSIKADVTIGEEITAMILSEDKEGNLLLSKKKADDILSWDKL
FT                   KTMMTERTVTTVKVSNAVNGGVVTYLEGIRAFIPASMLSLSYVEDVSTFVGKVLKVIVI
FT                   TADKEANKLVLSAKEVLREEEAKEKSHKISQVQKGIVTTGIVDKLMPFGAFVSIGEGLS
FT                   GLVHISQICGKRIKSPAEVLKEGQEVKVKVLDVKDGKISLSIKAVSDAEEVHEDAVDIP
FT                   AEYSTGEQVTTGLGDLLKNFKF"
FT   gene            36006..36809
FT                   /locus_tag="Cphy_0022"
FT   CDS_pept        36006..36809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0022"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: cth:Cthe_3126 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40413"
FT                   /db_xref="GOA:A9KQA4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQA4"
FT                   /protein_id="ABX40413.1"
FT                   /translation="MMGDKFKIGAVLQRIIPKIREEMRETMRAFVSDINKFLGNGKCNE
FT                   EGKSLEKFLTEYDPNKYQNPSVTADFLVFQKPENSYDLQKDLKLLLIQRKNHPCIGWWA
FT                   LPGGFVEIHEDIDKAAARELLEETGLSDIPMEQIYTFGKQDRDPRTRIVTVAYLALLES
FT                   NQKVEAGDDAAEAEWFSLSIEKEYEELLEEGNAILKHKRKRERYHIRVTCEKNQDIKAE
FT                   ATVDYFCNIDTLLLQEDYEVICSNGISFDHPAFILRAYQLLRKRM"
FT   gene            complement(36983..37717)
FT                   /locus_tag="Cphy_0023"
FT   CDS_pept        complement(36983..37717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rci:RCIX1087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40414"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQA5"
FT                   /protein_id="ABX40414.1"
FT                   /translation="MNQELFQISCSQVIDQALQENGIGTLSEKTIHSVLKHYYSPDTAC
FT                   HEQKVKNFVADILIENHIIEIQTRQFHKLRRKLEVYLPEYEVTIVYPVAHTKWLSWVNE
FT                   ETGEVSKPRKSPKTGVAYQIFPELYQIKDYLKDPNLHLNIISMDVEEYRLLNGWSKDKK
FT                   KGSTRNDGIPVALFDEMVIVTKDDYNKLLPANLPKQFTTKDYKKAAGVPQRIATTALNI
FT                   LYHMNTIDRVGKQGNSFLYEVI"
FT   gene            38095..39390
FT                   /locus_tag="Cphy_0024"
FT   CDS_pept        38095..39390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0024"
FT                   /product="Aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.21"
FT                   /note="PFAM: peptidase M18 aminopeptidase I; KEGG:
FT                   ckl:CKL_0085 ApeB"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40415"
FT                   /db_xref="GOA:A9KQA6"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQA6"
FT                   /protein_id="ABX40415.1"
FT                   /translation="MREKEIAGELLSYIKKSASPYHAVLEGITMLDEAGFIELDFRKTF
FT                   CLKAGGKYYTKPFGTTLFAFTIGNQVTNTQQFRLASAHTDHPCLHVKPTAELTSKGYLR
FT                   VNTEIYGGPILNTWLDRPLSIAGRVALKSENPFAPETRVIRVDKPFLTIPNLAIHMNKE
FT                   VNKGVELMRQTDMLPLMGVLNETLNEKSYFIEFLAKELSVEVSDILDFDLYVFCAEDGL
FT                   LLGMNEEFIQSPRLDNLTSCHALLRGIIDGNREDGINVIGLFDNEEIGSETKQGADSAL
FT                   FSMFLEKIYQALGYDRAALNDSILSSFLISMDVAHALHPSKIDKYDPVNYALMNDGVVF
FT                   KISGNQRYTFDTEAIASMVMLCDKYNIPYKKFVNHSDVIGGGTMGPIISSWLPMKTVDI
FT                   GIPMLAMHSARELMGTKDQKALVDLATAFFME"
FT   gene            40543..42537
FT                   /locus_tag="Cphy_0025"
FT   CDS_pept        40543..42537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0025"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: t-RNA-binding domain
FT                   protein; tRNA synthetase class I (M); KEGG: cno:NT01CX_0697
FT                   methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40416"
FT                   /db_xref="GOA:A9KQA7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQA7"
FT                   /protein_id="ABX40416.1"
FT                   /translation="MSKKPYYITTAIAYTSGKPHIGNTYEIVLADSIARFKRLEGYEVF
FT                   FQTGTDEHGQKIEEKAAEVGVSPKEFVDKVAGGIKDIWDLMNSSYDKFIRTTDVDHEKQ
FT                   VQKIFKKLYDQGDIYKGNYEGMYCTPCESFFTASQLVNGKCPDCGRECQPAKEEAYFLK
FT                   LSNYTGRLIDHINTHPEFIQPESRKNEMMNNFLLPGLQDLCVSRTSFKWGIPVDFDPKH
FT                   VIYVWIDALSNYITGIGYDCDGNSTEQFNKFWPADLHLIGKDILRFHTIYWPIMLMALD
FT                   LPLPKQVFGHPWLLQTDPNAKDGSGVKMSKSRGNVLYADDLVEFFGVDAVRYFVLHEMP
FT                   FDNDGVINWELMVDRMNSDLANTLGNLVNRTISMSNKYFEGVVNKTDVTEPVDADLIEV
FT                   VTKTRDKVVAKMANLRVADAISEIFTLFKRCNKYIDETMPWALAKEEEKKARLENVLYN
FT                   LVESICIGANLLEPFLPESAEKILAQLNAKKRNIEELATFGLYDNGTKVTDQPQILFAR
FT                   LDLKEVLAKVEEKHASEVEETAKVEEVKQEETVIEIPAKDEITYDDFAKLQFQVGEIIA
FT                   CEEVKKSKKLLCSQVKIGNQVKQIVSGIKAHYTAEEMVGKKVMVLVNLKPATLAGIVSE
FT                   GMLLCAEDENGVLALMTPEKPMPSGAEIC"
FT   gene            complement(42711..42926)
FT                   /locus_tag="Cphy_0026"
FT   CDS_pept        complement(42711..42926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40417"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQA8"
FT                   /protein_id="ABX40417.1"
FT                   /translation="MKLFKKNQDEFNKELLKEIANTQKELESAYSNFENVVDPDLIDSC
FT                   IYQVNAIQHRYKFLLKQVKNSAPYSV"
FT   gene            43272..43535
FT                   /locus_tag="Cphy_0027"
FT   CDS_pept        43272..43535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ckl:CKL_3823 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40418"
FT                   /db_xref="GOA:A9KQA9"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQA9"
FT                   /protein_id="ABX40418.1"
FT                   /translation="MKQYISYLLFALAGMLFAWYLYVNHKKWIGTVIVRAVLSIVVIYL
FT                   INTVALNFGIVTLVGVNIVSIGVTAFLGVPGLLLLYGASLFF"
FT   sig_peptide     43272..43328
FT                   /locus_tag="Cphy_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.678) with cleavage site probability 0.516 at
FT                   residue 19"
FT   gene            43750..44175
FT                   /pseudo
FT                   /locus_tag="Cphy_0028"
FT   gene            44224..44937
FT                   /locus_tag="Cphy_0029"
FT   CDS_pept        44224..44937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0029"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: btl:BALH_3033 possible UbiE/COQ5
FT                   methyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40419"
FT                   /db_xref="GOA:A9KQB0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQB0"
FT                   /protein_id="ABX40419.1"
FT                   /translation="MNGSFWDTKGNEVIGTTALPLYGAFVSEEKCRLFGNVSGKKLLEI
FT                   CCGTGHSLQYHGDRNASELWGIDISEKQIEKAKQHLSSKGYLAKLFCSPMEEDCGIPVD
FT                   YFDYVYSIYGVGWSTDLAGTFCRIASYLKKDGVFIFSWSHPIHKCVAFENDSLSFKKCY
FT                   FDESWYSVSLDGGAISLSDRKLSTYINALTKAGFIIDEMIEESDDEIIQLKKDSDFAKK
FT                   AKMLPVTFVIKARKL"
FT   gene            44956..45768
FT                   /locus_tag="Cphy_0030"
FT   CDS_pept        44956..45768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40420"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQB1"
FT                   /protein_id="ABX40420.1"
FT                   /translation="MDFLHRVNELIRKSDHMEILDSESYFRKIYYDNHNEVILEHTVYK
FT                   EDLYTSYQMYQLTYDTHNNIVCKESIYILRELERSHGFTYYEYEYDENGNVLSKVTLND
FT                   NHKRNELINYYYRNNLLIKKEIWEKKLQRYLTDPITDEVLCYYIHTYHYGEDMKLLLET
FT                   VTFPTGEVCYYVDYHDNEIYPDGKIINPAKSEYAWMVLSKDVYIEITEKYYTPEVLKEI
FT                   VEYVRATYESTSVILWVRGIWEDCYSNPLYELYRYYLDNLDISINYTY"
FT   gene            46157..47131
FT                   /locus_tag="Cphy_0031"
FT   CDS_pept        46157..47131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40421"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQB2"
FT                   /protein_id="ABX40421.1"
FT                   /translation="MKITVAILDRQEDYARLLMEFMNQQADYGFFTVAFTEEELYRDFE
FT                   KDHKVDILLYAEEFREGMITNLSKVSYCLCEDTSFSNESIFKYQSASNIMNLLLERYID
FT                   LGYTWKPVTKNTGKQKVIGVFSPCYEIRQSHIAIILAKYLATKEKCVYLCLQPIFPSEI
FT                   LGYGEHSSLSDVIYLLKQDGANKSVKIKQCLEQVGELNCILGTYYFAEIYELTFDEIIN
FT                   LITELKENLLYETIVIDFSLYTSLALDLLKVCDVLLMPQLAGEARQCFSIAFEEQLKRT
FT                   GQDQLLEKLVQIVIPYEEQKQKSIRLDKQKEAEYQQILKELQF"
FT   gene            47419..48633
FT                   /locus_tag="Cphy_0032"
FT   CDS_pept        47419..48633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0032"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   cth:Cthe_1339 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40422"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQB3"
FT                   /protein_id="ABX40422.1"
FT                   /translation="MEQRKQELQEQILAGIDMTRELTEEELFDHIDEAIKVRGKEEYIS
FT                   ITEKQRLRIEIFNSIRRLDVLQELVEDTSITEIMINGAKEIFVERDGKLMKWEKEFESD
FT                   RKLEDVIQTIVAGANRIINEASPIVDARLKDGSRVNIVLPPIAIGGPTVTIRKFPKETM
FT                   TMEKLVTIGSLTEEAAEFLKKLVIAGYNIFVSGGTGSGKTTFLNALSNYVPSEERIITI
FT                   EDSAELQIRNIPNLVRLEVRNANVEGKNEISIRDLIKSSLRMRPDRIIVGEVRDASSID
FT                   MLQALNTGHNGMSTGHSNSPTDMLSRLETMVLLGADIPLLAVRKQIASAIDIVIHLGRL
FT                   RDKTRKVLEVVEVLECVDGEIEVNPLFLFSEEGETKEGKVLGELKKTDNSLLHVQKLLR
FT                   AGLSL"
FT   gene            48724..49467
FT                   /locus_tag="Cphy_0033"
FT   CDS_pept        48724..49467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0033"
FT                   /product="Flp pilus assembly protein TadB-like protein"
FT                   /note="KEGG: cth:Cthe_1338 Flp pilus assembly protein
FT                   TadB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40423"
FT                   /db_xref="GOA:A9KQB4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQB4"
FT                   /protein_id="ABX40423.1"
FT                   /translation="MVEDYDIYHMNKKEFLVCLFKGFLLCLIVSFLFYQNIFLCLLLSP
FT                   YLYFFYKKEQRKMAEDRKKKLNTEFLDGIHSLSVALEAGYSVENAFKAAIKDLGLMYSK
FT                   EALIMKEFQCIVSQINHNIPIENAIGEFANRSKLEDVECFSEVFKTAKRTGGDLVAIIK
FT                   MTGKTIGEKVEVMREIETLITAKKMEANIMKLVPFGILGYMLLGSPQFLKPLYHNLFGI
FT                   IFMTILLGIYLFLTKLVDKIIAIRV"
FT   gene            49484..50941
FT                   /locus_tag="Cphy_0034"
FT   CDS_pept        49484..50941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1337 type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40424"
FT                   /db_xref="GOA:A9KQB5"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQB5"
FT                   /protein_id="ABX40424.1"
FT                   /translation="MTYAILFVLILILVLFFLSKSYDKEFIDGLDSKEHPLKRLYSFVG
FT                   FCWFQIIHRPQKSNRKETASLYQKGALMTFVFLLFLIILLINEQKAPKEILQDGYKIER
FT                   PEVGEGSKTYHLGYQLGAEEEDLTFEITEKQVKKEDRKKMFQAAEAALYKIILNKNIDF
FT                   NQVTSDLKFPKQFGSPALSVSYKTGQSDYLWEDGSIRGEGAPKEGIPTSINVTLRYFED
FT                   TYEFQINITILPPIEPELSIKEIMELEVKRREEENREEEMVTLPSVVLGDQVLWKPIKN
FT                   NSSIPLLLIGILVMVCIPFFIEQKKREREQQKQEQLLLDYPEIMMKYTLLLSAGMTTYG
FT                   AWERIVKDYNTRRERELGGTRRNKKKLSKSKSMKSMRYAYEEMIITKNEIDLGVSESVA
FT                   YERFGRRCKLLSYLRFSTIIVQNMKKGNKGMIPMLEAESVQALLDRKEQAKRLGERAST
FT                   KMLMPMMGMLCIVIAILMVPAMMSMGM"
FT   sig_peptide     49484..49549
FT                   /locus_tag="Cphy_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.630) with cleavage site probability 0.626 at
FT                   residue 22"
FT   gene            51057..51260
FT                   /locus_tag="Cphy_0035"
FT   CDS_pept        51057..51260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40425"
FT                   /db_xref="GOA:A9KQB6"
FT                   /db_xref="InterPro:IPR031564"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQB6"
FT                   /protein_id="ABX40425.1"
FT                   /translation="MRKVKSKDKNILRNNQGFGVVEVILIIVVVIALIIIFQEQITSIF
FT                   NRAMGALKASTDSYFNNITPAP"
FT   gene            51273..53756
FT                   /locus_tag="Cphy_0036"
FT   CDS_pept        51273..53756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1829 chromosome segregation
FT                   ATPases-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40426"
FT                   /db_xref="GOA:A9KQB7"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQB7"
FT                   /protein_id="ABX40426.1"
FT                   /translation="MRKQKASGVITIYLTLTLSIMITLIVTTIEMARVSAAKAYSERVL
FT                   QTAMESTLCDYYLPLFERYHVFGLDIGYGSSIADSNLLVDEIRKGIEVSFLPTKDDPLS
FT                   NLLLQNKTYLICNPMLEELSVENIHYITDLDGEFFRKQATSYMKYQAAADGLEYLLDSA
FT                   HALEKTEKANLKFEEKMKVEQEFMLIDKDILKLMELIDGIKIKDNQIECKKGKPKTLDS
FT                   FTKKLLSTEPTMENTLINHSTIFDSLKGNYLNYPNQLNSLKDSAQDVMERYRTAYENAV
FT                   RQREEALLSLRAERADMIKESKDKPCDTTKIDARITSLEQSPITIDIYVLDSLMASCNS
FT                   INQKMNSFLNTLKEVKEKANQALSLVQKIKEARYKAQDSKNSFLDGLNKAREEIGDALY
FT                   EELSKSSEEMERYSNPEEKGIGIIKDIVSMEETLKQDIKVLDEVERYLLPNMTYTEEGY
FT                   AAWLSKVNLIHTSLDHFKLDGLAFDYSGVNFSEEKNSILKAGKSLISDGLLNLVLEDVN
FT                   SISKAELYQLELPSFTAKKSPEKSSQAENNIKNIMNTEDREDITTTGIGSYGTDALGSF
FT                   ANSLVEELLFQAYENEHCTYYLSEGYKPGQVLQYELEYLLYGNMSDKENVSSFINRLIL
FT                   IRTIGNMISVLTDANKVREASEFAALVVGFSGLPFLISVVKYVVLFIWALEQSLVETAA
FT                   MLLGKNVPIFSMKDDFVVEFKDLANFNKDGITKKAKDYKTKEGILSVGYKGYLQISLFF
FT                   SNKNNQYYRMMDLIQENFRYEYEDTFRIRNCVVSYRAVAKVSMPEQFFSLPFAIHREAL
FT                   SIHGYLYLAQKAVSY"
FT   sig_peptide     51273..51383
FT                   /locus_tag="Cphy_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.746) with cleavage site probability 0.291 at
FT                   residue 37"
FT   gene            53921..54835
FT                   /locus_tag="Cphy_0037"
FT   CDS_pept        53921..54835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40427"
FT                   /db_xref="GOA:A9KQB8"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQB8"
FT                   /protein_id="ABX40427.1"
FT                   /translation="MLKKREKGLLTLEASLALPIFAFAVYALVFFFQVIAAQDCLHYYA
FT                   TKVASNISSYGMITNYVMNFSEDEDSSAEIKENLNEDDETIFSGLFDTSDITNILTSAA
FT                   SGIMLKESIKPYVKDHHAITNCIQGGYAGISFLGSSLFDEEECIQVVMQYKIQLPIWKD
FT                   ILPVFPVVQRIRIRMFNGHAVPSSLKTDEGDNEDGEYVYITPNGTVYHTNANCSHIKIN
FT                   VQAVDSTRISFIYNSNHSTYRACELCFQKNSTLPSTVYITEYGDCYHSSRTCSGIKRTV
FT                   IKVLLTEVGARGECSRCKTYKKE"
FT   sig_peptide     53921..54031
FT                   /locus_tag="Cphy_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.494 at
FT                   residue 37"
FT   gene            54915..55349
FT                   /locus_tag="Cphy_0038"
FT   CDS_pept        54915..55349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0038"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   cth:Cthe_1335 peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40428"
FT                   /db_xref="GOA:A9KQB9"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQB9"
FT                   /protein_id="ABX40428.1"
FT                   /translation="MSIFKLCGVIWIGVILFILGIQDIKRKEISCWWLISLLPLIVFEL
FT                   AMPSEITLIERIFGILLGLFFVILSKVTRGQIGIGDGYILCAMGVILGIGKSTILLSYA
FT                   FLLTSAVSIVLLVFFRCNRKKTIPFVPFLFLGYLGCILIK"
FT   gene            55496..56068
FT                   /locus_tag="Cphy_0039"
FT   CDS_pept        55496..56068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40429"
FT                   /db_xref="GOA:A9KQC0"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQC0"
FT                   /protein_id="ABX40429.1"
FT                   /translation="MIKKAFFTVEAAFVLPLVFYTILFLLNYSFYSHDRTKLQALGEEV
FT                   ALKAASYISYQVDMDWTVLREEDYLSKSILYPFGVGREKDERKVLSYVNETLTNGYWVC
FT                   EIRDLQVQTTLSKVKITGKLKAVFPSAKLFGILKKDSFTVPFCFEESIFSREEKTRLFE
FT                   VSINLGKKIKGVDKAVQKLKELVGKMK"
FT   gene            56324..58066
FT                   /locus_tag="Cphy_0040"
FT   CDS_pept        56324..58066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0040"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   cth:Cthe_1334 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40430"
FT                   /db_xref="GOA:A9KQC1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQC1"
FT                   /protein_id="ABX40430.1"
FT                   /translation="MGKEDIRSEWKRDMYHNYLIFNGRGEERASFQEKMLEHNKIEGIL
FT                   SFQVHSIDNHKQFHYEVTGYQAISCISEKVPLRLSQVTMLLNHLLAVLKDAKSYLLDTK
FT                   DFVLLPEYTFIHLPDYKLGLCYYPGYHVPLQEQLVAFLEFLMGSVDYQDKEAVLFVYSL
FT                   YMKSKEDSITIQELKSFMEELEVKDKSDTLYMENGLESQGKLDKVKEPQSNREPYQSKN
FT                   TIKQPSNFNKHNEEKKNQKLKESLANPSRRNLLQYKVTSLLADTKERILGKENENGASK
FT                   KYGNQKKETKKEHKYPFVKEKLEQEEEILYYPFFCYALFAVLFIVCIGIFLYTYQKGFL
FT                   YQSLKKKIDGLKLISLLSVMGVILGYGYLKIFAKERKLSRIITRTTYQMPDKEDLFSNS
FT                   VSSEDNSLIENSYRIHKQDNNLNFNNLSNFTWENNESPMIYGEDSSSDYSGESYGSGEA
FT                   YHSGESYDEEECTILLTCPDKEYDTLIPLESTKYDTIEIKEYPFYIGTAKNNLGYSLIN
FT                   TAVSRYHAKLEKDESRFILTDLDSTNGTFVNGRKLMPNENFEIKQGDTVSFANIGFIFH
FT                   CLNK"
FT   gene            58361..59860
FT                   /locus_tag="Cphy_0041"
FT   CDS_pept        58361..59860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0041"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: cbf:CLI_2834 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40431"
FT                   /db_xref="GOA:A9KQC2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KQC2"
FT                   /protein_id="ABX40431.1"
FT                   /translation="MEKYIMALDQGTTSSRCILFNQRGEVCSVAQKEFTQVYPRTGWVE
FT                   HRPMDIWSSQISVAAEAMAAIGAKAEDIDSIGITNQRETTIVWDKNTGEPVYNAIVWQC
FT                   HRTADMIEQLKKDGFDSVIRKKTGLIPDAYFSATKIKWILDNVDGVRERAEAGSLLFGT
FT                   VDTWIIWNLTKGRVHVTDYTNASRTMLFDIHNLCWDDEILTYFKIPKSMLPKVQASSSI
FT                   FGHTEEGLLGGEILISGAAGDQQAALFGQCCFEPGEVKNTYGTGCFLLMNTGDTAIESQ
FT                   NGLLTTIAAGDAGHIEYALEGSVFVAGAAIQWLRDEQRMIKKASQSEEYAKEVEDTNGV
FT                   YVVPAFTGLGAPYWNPYARGTIVGITRGFSKEHMIRATLESLAYQTVNVLHAMEQDSNI
FT                   SLKSLRVDGGASANNFLMQFQADVLNTLVYRPQCIETTALGAAYLAGLATGYFKDRNEI
FT                   KDNWTLGGTFSPQMDEQKRKELLKGWKRAVRCALAWAEDIE"
FT   gene            59873..61063
FT                   /locus_tag="Cphy_0042"
FT   CDS_pept        59873..61063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0042"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: ctc:CTC00530
FT                   conserved membrane protein (rhomboid family)"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40432"
FT                   /db_xref="GOA:A9KQC3"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQC3"
FT                   /protein_id="ABX40432.1"
FT                   /translation="MELYNKILEYFLTKGCQRLQVNASGMDVFYQTNLEQCTVYWLIEI
FT                   YNGTEILNDQYQNIKRQIETAFFSKGYQKVLVYAILCTKNTEEALKICRMSESACIVDM
FT                   LQYRLMLFEGQARDENGVFRGLEQLISEYGRLYFATHGGQDYSSQNTDSQGNNENSWGG
FT                   YGSDYENQRSQGTHQQGSYQQGYGDYQSGKAYQRKNGFFSGVGIVTLVLIALNAVVFFY
FT                   TDLSGNYNKIISEGCIFWPLIKFNNEYYRLLTYQFLHANISHLVNNMLILAIMGSTLER
FT                   HVGKFKYLLIYFLSGIVAGIASMSYNMWKGLFSNSIGASGAVFGVIGAIALIVVVNKGR
FT                   LETIGTRQIIIFIALSLYGGFTSQGVDNAAHVGGLLAGFFIAMLVYRKKRGRIRED"
FT   gene            61053..62057
FT                   /locus_tag="Cphy_0043"
FT   CDS_pept        61053..62057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40433"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQC4"
FT                   /protein_id="ABX40433.1"
FT                   /translation="MKINIYYGGRGLIEDPTICVMNKMTEVLEELRVEVTRYNLYEQKN
FT                   SISMLPGTLKEADGIILAVNVEWMGIGGFMQQFLDACWLYGDKQKMQTLSMFPIVTANT
FT                   YGEREAELHLKRSWEVLGGTSLDGIIAYVENSIDFEVNTSYAGIFERKAESLYRFINQK
FT                   SVTFSSSSHAVMKNTLTTTPIELTPQESEQLSMYVSDDTYVKKQKEDIEELAQMFRGML
FT                   EKSGSEKNQDFIKNFKDNFKPQEDNFQATFSITMTDTDKTLLLLVAGKQLKCSYEDNIE
FT                   ADVIAKTTKEMVNRLVNGRTTFQGAFMSGELTAKGDFKILRRFDQLFNFSALS"
FT   gene            62196..62465
FT                   /locus_tag="Cphy_0044"
FT   CDS_pept        62196..62465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40434"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQC5"
FT                   /protein_id="ABX40434.1"
FT                   /translation="MFRIWAKMIKDNHLLRDIVIEDDSTERTRTKKIFHALDEVCHEFD
FT                   LSKPLWLEVTIKDFKKHDKTRFFQDNFIEQIEFDYLEIHVIEED"
FT   gene            62635..63609
FT                   /locus_tag="Cphy_0045"
FT   CDS_pept        62635..63609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_1444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40435"
FT                   /db_xref="GOA:A9KQC6"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQC6"
FT                   /protein_id="ABX40435.1"
FT                   /translation="MIKFYQKPFKMFVVGTMILSLTACNETQDGTKVEVKSNYVVKEVL
FT                   TSGKTEGNEKLQENNQIGIDETKSTDNSMNGSEMDIELFESSLDDLGSVLKPDSSEVVD
FT                   MDTVKAINSMPAKSIVKVYTANAATLAECFYAEEISPSLFERMENKSFSEGCTISIDTL
FT                   SYVRVLHFGFDGEIHIGELIVNKLIKEDVIDIFKELFDERYPIEQMVLIDEFDADDNES
FT                   MAANNTSSFNYRMVEGTTTLSKHAYGLAIDINPKYNPYVRTINGETIIVPENGAEYEDR
FT                   TLENEYYIMKDDVCQKAFAKRGFTWGGDWQTSKDYQHFQKVFQ"
FT   sig_peptide     62635..62712
FT                   /locus_tag="Cphy_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.746 at
FT                   residue 26"
FT   gene            63796..65364
FT                   /locus_tag="Cphy_0046"
FT   CDS_pept        63796..65364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0046"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: cth:Cthe_2144 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40436"
FT                   /db_xref="GOA:A9KQC7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQC7"
FT                   /protein_id="ABX40436.1"
FT                   /translation="MSYMALYRKFRPDTFEDVKGQDHIVTTLKNQIKAKRIGHAYLFCG
FT                   TRGTGKTTVAKILAKTVNCEHPIDGNPCNECAMCKAIQSQSSMNVIEIDAASNNGVDNI
FT                   REIVEEVKYSPTEGNYKVYIIDEVHMLSAGAFNALLKTLEEPPSYVIFILATTEVHKIP
FT                   ITILSRCQRYDFRRVTIDEITKRLRVITEKEGIEAEEKALRYVARAADGSFRDALSLLD
FT                   QCIAFYFGQSLTYDNVLDALGTVDIEVFARLLRYIRKGSVTDCVAILEELIIQGRELTQ
FT                   FTIDFTWYLRNLLLAKTSEDMEEILEMSSDQLQLLKQEAQSCDTELLIRFIRIFSELSN
FT                   QVKYATQKRVMIEVALVKLCKPAMETDYASLIHRIQVLENRLEEGVFVTSKDEIEGAVP
FT                   VVEKAKKASVPVELPKAVSADLQEVARNWNSILRSLPPLVRTVLISARVVPGEGNTIIL
FT                   VFEKEVDEGVINQESHLEEIKTAIADTIGKEVLVQTKVIKDGEALEAYPDLTKIMKKVP
FT                   IEYVD"
FT   gene            65391..65750
FT                   /locus_tag="Cphy_0047"
FT   CDS_pept        65391..65750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cbe:Cbei_4950 conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40437"
FT                   /db_xref="GOA:A9KQC8"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KQC8"
FT                   /protein_id="ABX40437.1"
FT                   /translation="MAKRGGFPGGNMPGNMNNLMKQAQRMQKQMEDKTKEMEEKQWEAT
FT                   AGGGAVTVTVSGKKEVVSVKLSKEVVDPDDIEMLEDLIVAATNEALRKMEEESASAMNS
FT                   IAGGLGNFGGLGGLF"
FT   gene            66208..66804
FT                   /locus_tag="Cphy_0048"
FT   CDS_pept        66208..66804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0048"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: cth:Cthe_2142 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40438"
FT                   /db_xref="GOA:A9KQC9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KQC9"
FT                   /protein_id="ABX40438.1"
FT                   /translation="MDYYSTQISKLIEELGRLPGIGAKSAQRLAFHIINMPKEQVEHLA
FT                   KTMLDARSNVKYCKVCQTLTDKEICPICSSEKRDQKVIMVVENTRDLAAYEKTGKFDGV
FT                   YHVLHGAISPMLGIGPQDIKLKELMLRLQGDVDEVIIATNSSLEGEATAMYISKLIKPA
FT                   GIKVSRIASGVPVGGDLEYIDEVTLLRALDGRIQL"
FT   gene            66922..68031
FT                   /locus_tag="Cphy_0049"
FT   CDS_pept        66922..68031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cho:Chro.30409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40439"
FT                   /db_xref="GOA:A9KQD0"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD0"
FT                   /protein_id="ABX40439.1"
FT                   /translation="MEHENVLSGGVETLYTMKENLSELEGYKGSSKEWSFKEEQAEEQL
FT                   EERQKAITDEVGAVLRKRRQEVEASFEEQMNETKTRLKKVKSKKEKQLGKKVSERIEEE
FT                   TADLTKEGVRLKQDLKAIFQKNHISRVFNHKWFHAVFMPCSLKDFSILLITVLILFLAI
FT                   PVGIYQFLLPAKTLYLVLDYFVTILVFGGLYILINKKIKENHTEAIIDMKAIRQKMAKN
FT                   HKKIRAMAKGIRKDKDESVYGLDEITGEIRQLEDELNHLMEEKKNALVEFESTTKAAVS
FT                   EEVKSRYEEEMKGLQSKVKEAHEEQRKAAEKVKEFSLEITNRYESYLGKDMLTNVAIDR
FT                   LIEIMKEQNVTNIAEALNIYRADLNKPME"
FT   gene            complement(68096..68689)
FT                   /locus_tag="Cphy_0050"
FT   CDS_pept        complement(68096..68689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0050"
FT                   /product="sporulation protein YyaC"
FT                   /note="TIGRFAM: sporulation protein YyaC; PFAM: protein of
FT                   unknown function DUF1256; KEGG: cth:Cthe_2165 protein of
FT                   unknown function DUF1256"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40440"
FT                   /db_xref="InterPro:IPR009665"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD1"
FT                   /protein_id="ABX40440.1"
FT                   /translation="MKQFVEKNKKIFYFDSKERYSPYDFGNTLLNLLEVNSYKNKTIVF
FT                   LCIGSDRATGDCLGPLLGYKLSHLPSKNYVVYGTLEEPVHAKNLKETVSRIYSENNNPF
FT                   IIAIDASLGKASHVGYYTLGEGPLKPGAGVDKDLPYVGDLFVTGIVNLSGLFDQMLLQT
FT                   TRLGTVMTLVDYICQGISHCMYLMRGRVMEKTNP"
FT   gene            69062..70372
FT                   /locus_tag="Cphy_0051"
FT   CDS_pept        69062..70372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0051"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   rca:Rcas_0063 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40441"
FT                   /db_xref="GOA:A9KQD2"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD2"
FT                   /protein_id="ABX40441.1"
FT                   /translation="MNDTKFGYKSNQTAATMEKTASKIKIPKNVRQIGKIGDQLKIYME
FT                   DYVKTYTRQLAESDYASRCMAVLVGEYRHEEDNRNVFIYGAILVENCFEDGKIVLKEDS
FT                   WAMIYEKIKQYFSEAEIVGWYYGGTGFGTDEITSLREFHIDNFAGRDKVLLTYDVLEKE
FT                   DNFYIYDGYDLKQQPGYYIYYEKNLEMQNYMVDHKKVKHEELEINDRAMKEIRTILKEK
FT                   KQPLDSDKEQRNMLRLGYAAGGLMTVVALVVGITVMNNTDRMKQLEQQVSSISKDIFDK
FT                   DTNKNKDTSKEVAAITPIHDQDLVDEPNVDVSKGDNVDSVETSGNKTTPMPTKGTDEVT
FT                   ITPTIIPTLEPTKSPTVTPTATQAPAETPIPTKGADQTTSNIDVTKLKTYQVKSGDTLA
FT                   GICMRLYGNYNMQKTIKELNQLVDENVIFEGQELLVP"
FT   gene            70537..71733
FT                   /locus_tag="Cphy_0052"
FT   CDS_pept        70537..71733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40442"
FT                   /db_xref="GOA:A9KQD3"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD3"
FT                   /protein_id="ABX40442.1"
FT                   /translation="MERLKRSLRADELNLKKKKKRRLILSLGVIGILIILGIAIVLHRK
FT                   TAVYTSYKVVGSTELTNAKESSYLKYKNGVIKYNRDGAEAIGADGTVLWNVSYSMKKPI
FT                   INVRGSYAAIADMGSYDLVIVNGSGTTNALTMKEPIAAVKIASQGVTAVLTGNGTTDYI
FT                   YFYDMNSENGKSILDVKTMVTTDGFPTDIGISEDGTKLVTSYLAVDDDNDGVVSKVTFY
FT                   NFGEYGKNQVDNLVGFYSDYRGEVIPKVEFLNNEIVAAFRDTGITLYSIKEVPREIMRQ
FT                   TYTEKIHSICYNDMYVGVILDGTNNTQERKVLLYDFSGKKILEKEVNFTFQNVTLIENQ
FT                   IIFYSSTECNIMNIDGSMKFSSQFHTNVTSLYQTSSMNEYLLVTDVGLDKIQLNKSEE"
FT   gene            71737..72438
FT                   /locus_tag="Cphy_0053"
FT   CDS_pept        71737..72438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2712 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40443"
FT                   /db_xref="GOA:A9KQD4"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD4"
FT                   /protein_id="ABX40443.1"
FT                   /translation="MNALVLIVVGILILCAFLGMRKGFIKTVFSIFSMVVALIFTLILS
FT                   PYLGKSLQQNEKLVTYLSEKSAEVLKLDDIDDKINQTVEDSVIGKLPLPESLKNTLQKN
FT                   NNSDTYDALGVKDFKGYVSHAVASIVINAISFAITYVVLIVLLRILSTVLNIISKLPIL
FT                   NQINKLVGLLAGGIHGLIIVWLLFILLTIFSGTKLGRECFTMMNESVFLSALYDNNLIM
FT                   KFVMNLSGILG"
FT   gene            72635..73597
FT                   /locus_tag="Cphy_0054"
FT   CDS_pept        72635..73597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0054"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; KEGG: tde:TDE0157 KHG/KDPG family
FT                   aldolase/carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40444"
FT                   /db_xref="GOA:A9KQD5"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD5"
FT                   /protein_id="ABX40444.1"
FT                   /translation="MNEVLKRFEQLGIIPVVKIDDAKDAAPLAKALCEGGLPVAEVTFR
FT                   TAAAEEAIRNMVEACPDMFVGAGTVLTTEQVDRAIAAGCKFIVSPGLNPKIVKYCIEKG
FT                   IPITPGTSSPTDIEQAIELGLEAVKFFPAEASGGLAKIKAMAAPYVNMRFMPTGGISEK
FT                   NLTSYLDFPKILACGGSWMVSEALINGGKFDEIKKLTREAVNTMLGFELKHVGINATSE
FT                   EEADGVATSFEKLFGFTKNVGSSSIFAGSAIEVMKTPYLGAHGHIAIQTNYIERAIYHM
FT                   ELQGFEFDMDTAKYNGGKMVAVYLKGELGGFAVHLLQKK"
FT   gene            73980..75317
FT                   /locus_tag="Cphy_0055"
FT   CDS_pept        73980..75317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40445"
FT                   /db_xref="GOA:A9KQD6"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD6"
FT                   /protein_id="ABX40445.1"
FT                   /translation="MKRLQKLFVAICVMFAIMLTQVVTVSAAQTMTFDDLYMTLEISDD
FT                   FIVLTPDTPKNDGRWAAAGIIQIDSKLKEFNDMGVKVLFYDKKSNTSVTMMVKDSSKTR
FT                   EIVNLVSMTDTELQEYFDSLVGKDSDTFVSTVEEYTHKQTPYFKLRLQSKEGESPVSEV
FT                   VYGTIMNGKSIGFDIYKEGSYIQDKEEELVRSLVDNVSFTKILDASEITKESEIGIKDF
FT                   ITPILFILIIGVILFIFNKKNKKASQIKKKISQDMQEYRLNRRKLEEAGELTKEEALFT
FT                   NSTEYHDQAIKTYCMYNQFFKRIGFWIYVIVLYLIILGYSLFFGTSIWMTIIVTIAGIV
FT                   YGYYQGIAVEKMSEAMKKKYEGSRSKNAITKFYDDYFTVSGIQYISDFPYVQVTEVRKS
FT                   KNYIYLYLGSEIAYFVDVTTFNKLEEENFMIFLKQRMGDKLKFKIR"
FT   sig_peptide     73980..74063
FT                   /locus_tag="Cphy_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.775 at
FT                   residue 28"
FT   gene            76019..77542
FT                   /locus_tag="Cphy_R0013"
FT   rRNA            76019..77542
FT                   /locus_tag="Cphy_R0013"
FT                   /product="16S ribosomal RNA"
FT   gene            77715..77831
FT                   /locus_tag="Cphy_R0014"
FT   rRNA            77715..77831
FT                   /locus_tag="Cphy_R0014"
FT                   /product="5S ribosomal RNA"
FT   gene            77838..77911
FT                   /locus_tag="Cphy_R0015"
FT                   /note="tRNA-Ile1"
FT   tRNA            77838..77911
FT                   /locus_tag="Cphy_R0015"
FT                   /product="tRNA-Ile"
FT   gene            77967..78039
FT                   /locus_tag="Cphy_R0016"
FT                   /note="tRNA-Ala1"
FT   tRNA            77967..78039
FT                   /locus_tag="Cphy_R0016"
FT                   /product="tRNA-Ala"
FT   gene            78327..81226
FT                   /locus_tag="Cphy_R0017"
FT   rRNA            78327..81226
FT                   /locus_tag="Cphy_R0017"
FT                   /product="23S ribosomal RNA"
FT   gene            81292..81363
FT                   /locus_tag="Cphy_R0018"
FT                   /note="tRNA-Asn1"
FT   tRNA            81292..81363
FT                   /locus_tag="Cphy_R0018"
FT                   /product="tRNA-Asn"
FT   gene            81410..81480
FT                   /locus_tag="Cphy_R0019"
FT                   /note="tRNA-Cys1"
FT   tRNA            81410..81480
FT                   /locus_tag="Cphy_R0019"
FT                   /product="tRNA-Cys"
FT   gene            81998..82324
FT                   /locus_tag="Cphy_0056"
FT   CDS_pept        81998..82324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40446"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD7"
FT                   /protein_id="ABX40446.1"
FT                   /translation="MIKKQIVYTIIFLVVLFTSGCEKKQDYLNGTVSEVFDTYIIVTPK
FT                   DDELLKEKAEKIVVTKTIALATGFPDLDVGDEIRVVYSGIKKEDDLMILDSVFAVYKSN
FT                   ELKY"
FT   gene            complement(82305..82850)
FT                   /locus_tag="Cphy_0057"
FT   CDS_pept        complement(82305..82850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40447"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD8"
FT                   /protein_id="ABX40447.1"
FT                   /translation="MNIKKRILSILISCTLLAGLFNSITTLAAETDRYSLMKNKAILSL
FT                   LENLNETGDFSAVLSLKDYDNSERYFYLPFLTGGYLIYDKKLDIIHEYSTTESNKYIND
FT                   QNDLYYLGALSYYQKQNDMYIEIPTGNPIDNTTFSEIAMDLNSNLSMRSISPSTHYNLQ
FT                   NKSNTIRGIAIYISILIH"
FT   sig_peptide     complement(82764..82850)
FT                   /locus_tag="Cphy_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 29"
FT   gene            83519..85855
FT                   /locus_tag="Cphy_0058"
FT   CDS_pept        83519..85855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0058"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: cbh:CLC_2728 xanthine
FT                   dehydrogenase family protein, molybdopterin-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40448"
FT                   /db_xref="GOA:A9KQD9"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD9"
FT                   /protein_id="ABX40448.1"
FT                   /translation="MRTTIDENIHRKEAWDKVTGKAQYTDDKPVTGYLHARILTSPYAH
FT                   AKIKFIDYSKAIQLQGVKAIITGSDFPVLSGVLIEDRPPLAKDVVRYAGEAIAVVAATT
FT                   EAIALKAVRMIEVEYEVLEAVFSPMEALKKDAPLLHPNLGYYKKKMADIHPVDQSNIAS
FT                   KFQVRKGDTKEGFAESDIIIERSYKLPPSDHLAMEVRAVRAEISADGKVKIETSSQAPY
FT                   TVIKQISTCFQIPAGNIEVQVPFVGGAFGGKAPVTLEFLAYMICVKVNGAPVRLTVPRE
FT                   EDMTTAPCRLGLEADLKIGAKSDGTITAARFVFYLDTGAYADIGPYMAKSIVADCTGPY
FT                   RIENLSCDSYCIYTNHTYSTSYRGFGHLCYTFCVERAMDDLAKRCGIDPLEFRKINAIK
FT                   PGDLTPTQVVSTYSNTGNTELCLKKLKKLIHWNGESVKKIDENTVSATGISCLWKAADT
FT                   RTNAISGSIITFNYDGSLNLNTGVVEMGSGGQTYLAQILADKLKMDVKDIHVSLSVNTR
FT                   LNPEHYKTVASMTNYMAGNAVMKAADDVIEQLKAMGSQIYSCNPGEIEVAESKVFKKAQ
FT                   PDDYTLFKDIVLGYKAKNGASIGEPVIAKGGFMLKGLSLLDPNTGKGKTGPAWTVGAQA
FT                   VEIEFNLTDFTYKIIKATTVMDVGKVINPNGMKEMIYGGMAMGLSMSSREVYHYNKEGR
FT                   VKTPNLRTYKLLHIGQDPKFKVEFVETPQDDSPFGSRSISEHGIIGIPAALGNALAAAS
FT                   GVSIDELPMTPEYLWRRRKLSHDSK"
FT   gene            85842..86678
FT                   /locus_tag="Cphy_0059"
FT   CDS_pept        85842..86678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0059"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   cbf:CLI_2901 xanthine dehydrogenase family protein,
FT                   FAD-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40449"
FT                   /db_xref="GOA:A9KQE0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQE0"
FT                   /protein_id="ABX40449.1"
FT                   /translation="MIANDFIYCKPENRIEAIKAYKTLSKEKKVFYYGGGSEIITMARA
FT                   GSRMPDAVIDLKGIKECNQLELTDENLVIGGAVSLNAIEESGLFPLLGTTGSRIADHTN
FT                   QCRITLGGNISGTIIYKETVLPLLLTDARIILYGPRGFRRITFKNAFDQEIKLRNGEFI
FT                   YQIKIKKEMLSLPFTHVKKTAIEKIDYPLVTVCSITYENRLRFAISGLCPFPFRSLEIE
FT                   KILNNEQLSLEEKLKKTHGILPESPITDYEGTGEYRLFVFDNIIKSILERRNDEVL"
FT   gene            86662..87135
FT                   /locus_tag="Cphy_0060"
FT   CDS_pept        86662..87135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0060"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: cbf:CLI_0333 xanthine dehydrogenase family protein,
FT                   iron-sulfur-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40450"
FT                   /db_xref="GOA:A9KQE1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQE1"
FT                   /protein_id="ABX40450.1"
FT                   /translation="MMKYYENDCVIELDVNNEIRKAAIRPSDVLLDVLREQLGLTGAKP
FT                   GCKNGDCGTCTVLMDGLPAKSCLVLAIEAVGHKILTVEGLGGHAPIQEAFVQYNAFQCG
FT                   YCTSGFLMVCHALSEKKPGADEFEMEKWLQSNICRCTSYQEIREAVKSVLKQV"
FT   gene            87449..87607
FT                   /locus_tag="Cphy_0061"
FT   CDS_pept        87449..87607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40451"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQE2"
FT                   /protein_id="ABX40451.1"
FT                   /translation="MLNIPGTCVKCGNHIELERHDNLAGAAYCPSCDFVLELTKEEFDQ
FT                   VSLLIEE"
FT   gene            complement(87739..88626)
FT                   /locus_tag="Cphy_0062"
FT   CDS_pept        complement(87739..88626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0062"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: ctc:CTC00251 prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40452"
FT                   /db_xref="GOA:A9KQE3"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQE3"
FT                   /protein_id="ABX40452.1"
FT                   /translation="MKNELIAIGPIKVYGYGLMIAIAILSAYSLTEYRAKKLKLEHEKV
FT                   FSLVIWCATGGLLGAKLLYYITQIPEIINDPSILWKVTDGFVVYGGIIGGIFAGFLFCI
FT                   KHKLNFLTYFDLAMPSIALAQGFGRIGCFLSGCCYGVETNCALGIVFHNSEYAPNGIRL
FT                   VPTQLISSGMDFLHCFLLLFYAKRKKANGQVAALYLICYSIGRFVLEYFRGDLVRGNVG
FT                   RFSTSQFISIFLLIIGIVFFVVLSLTAKKEVLNDSDEMVANVTEDQTNITNNSEELDSY
FT                   SLTEDEEKSKDETL"
FT   gene            89122..89832
FT                   /locus_tag="Cphy_0063"
FT   CDS_pept        89122..89832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0063"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: bvu:BVU_1472 histidinol phosphatase
FT                   and related hydrolase of the PHP family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40453"
FT                   /db_xref="GOA:A9KQE4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQE4"
FT                   /protein_id="ABX40453.1"
FT                   /translation="MDKLVADIHTHTIASGHAYGTIREMAQAAAEKHLRILGISEHAPG
FT                   IPGTVDPFYFRNLEIVPRDLYGVHIIHGCEINVLNDGTLSLQQEYIDMLDYAIVGIHCQ
FT                   CYEDQGREKNTENLIKCMQNEKVHFISHPDDDHTPLNYKELVQAAKETHVALEVNNSSL
FT                   IKKDRRLNCIENYKTMLHYCKQYHVPIIISSDAHDPSYVGRFNLAVDLIESQNFNKDLV
FT                   LNVDSKKLISFIYD"
FT   gene            complement(89917..90717)
FT                   /locus_tag="Cphy_0064"
FT   CDS_pept        complement(89917..90717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0064"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   cbe:Cbei_3749 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40454"
FT                   /db_xref="GOA:A9KQE5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQE5"
FT                   /protein_id="ABX40454.1"
FT                   /translation="MDYQRFAAKLLKQRQQLQLTQEELALRVGVTPQAISKWERGISLP
FT                   DIELLYQLSKVLSLSMDELLDLPTSLTESDNDKDKERLFRAILSEPITLKVGCGFVDYL
FT                   MKENQQGFPKLQQVRINMAKESGYLLPTVRILDDITLDNHCFQILFYDKVVYEQNNLNP
FT                   SSSEYPEIFEQLNLTCTAHYEKLLHRQIVKDLIDNLSKLYPVLVDGYIPDKLSYAQIQF
FT                   VLKSLIEHKKSIRNLCEIIEYLEDNLVLGKDLVSISNELIQLSY"
FT   gene            complement(90930..91751)
FT                   /locus_tag="Cphy_0065"
FT   CDS_pept        complement(90930..91751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0065"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   cpe:CPE0727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40455"
FT                   /db_xref="GOA:A9KQE6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQE6"
FT                   /protein_id="ABX40455.1"
FT                   /translation="MKFCDKLIELRRERGLSQEQLADQLDVSRQSVSKWESDQTMPELS
FT                   KLITLSEIFEVSLDYLMRDYIMDRSGTREKKDNTVDDKDIPNRENRYSSLETQINEIND
FT                   YIKRPRGFEYKSKKTLFGLPLIHICFLYSRHRIKVARGIIAIGAISVGVFSIGVLSLGL
FT                   FALGALALGLLSFGAISLGAIAVGSIAIGYISIGALSIGVYSLGSLAVAKEIAVGAMAS
FT                   GNLAIGDESYGTYCYSIDAIQTKAMAKDIILTHYPSIPKFLLKIFTLFFHP"
FT   gene            complement(92474..93670)
FT                   /locus_tag="Cphy_0066"
FT   CDS_pept        complement(92474..93670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40456"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQE7"
FT                   /protein_id="ABX40456.1"
FT                   /translation="MNTKNKKLFLAPILIAFGLLLLIPIAKISAAEAKPVSIGKIDYDT
FT                   LTMYVYTNNNTVVYYSTDKTTWYEVEGNKTTENDAFLMDISWVNSSDDITLYFKGENDK
FT                   TIQNVTLPAKDTSLKVILDKTDNTFTFENCDAATHFEWKKANDYVWNKVPLDMKSASYQ
FT                   SFLKTIEGLLVKGAKVSFRIPQTVGTNEKNVGARPSKEVNITLAKRANAPSVKVNANKL
FT                   MLNTTLSMEYFSDRKNVWIECDKNMTIEDIAPTTLFRNGSKSVTLKIRTAATTNKAYSK
FT                   TAFLKINGQAGAPTIGDNSKDVSYYYQNGKLMLQFNNASKTDVYSYAIVKPGSTFNETT
FT                   TAFTMMNTNKAKVITATTAPEGSTIYIRKQGINENTTKGIELELASEVNSFKVTYPKQ"
FT   sig_peptide     complement(93578..93670)
FT                   /locus_tag="Cphy_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.744 at
FT                   residue 31"
FT   gene            complement(93690..96077)
FT                   /locus_tag="Cphy_0067"
FT   CDS_pept        complement(93690..96077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_032240 flocculin, putative PROSITE:
FT                   SER_RICH THR_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40457"
FT                   /db_xref="GOA:A9KQE8"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQE8"
FT                   /protein_id="ABX40457.1"
FT                   /translation="MQTGTIAVKTTAKCSRNTYLCIIASIFFMLTMALGVFSPKTAYAA
FT                   GASISIQEINYDNSTITVKVNSGDTVVYFSDENMKTWETIPTDIGTDRLVTLDISWITP
FT                   TNKYVLTFKGDASTEAVKVTIPKQVTNFKASYNKVRGIVTFTNDYDRTIQWRKKDSYIW
FT                   NTVNTDNFASQLEMLCTQGATVYLRLAPTNSYLVNGTLTEGERPSKEISLVIAKKIAAP
FT                   NIVINGSKFSIQADKNLAYRTVGSDGTIGEWKNITTTTSLWLKDIAGSALYTNAGTTQC
FT                   EVTLQFRKNPTSTSQVSHISTVTVPVQEAPPSDSDHGIEINYTSSTTFTLQVKAASETK
FT                   PFEYTIVKPDNTLDYVTASWTSITSNAEITIKSDKAPVGSHVYVRKKSVPASGDIKFSL
FT                   ASKELDITGSKGVQYPSPAQATTLETLITTASVCNSENSAGNLTFTLYSPTKATVSSIS
FT                   FRDQYGNTKGTVSVKSSVSTNTASRFITDQYIITTKITSTESLDNLTETKLYAYITLSN
FT                   NDVIESTTDSGVLLYIYPSSKINNKENKEYTSAFERLYGSTEAKDKSSFTFQIDLGTEK
FT                   VPDTSAIGNFTTQDTEINSIKYDGYTLAPTTDYNVVYGSYTNDNGKKIRTATVTVNVNK
FT                   FETISTITTKGKAVPLLIALNNGEEIDNKVTIKLVDTATLLDAPIAWSIMEGSLKETET
FT                   KVTTNEDGSKTTETVEAITYELKLKLHDSSYAVGISDVTWGGTSILRSATVSGGTATVY
FT                   LSNAKINKLTSSSSTTNNLVITLSNGFVIKSGCKLTIINAGK"
FT   sig_peptide     complement(95943..96077)
FT                   /locus_tag="Cphy_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.973 at
FT                   residue 45"
FT   gene            96504..98186
FT                   /locus_tag="Cphy_0068"
FT   CDS_pept        96504..98186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0068"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: Peptidoglycan-binding LysM; cell wall
FT                   hydrolase/autolysin; KEGG: syn:slr0891
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40458"
FT                   /db_xref="GOA:A9KQE9"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQE9"
FT                   /protein_id="ABX40458.1"
FT                   /translation="MLLFKKKVKSIVSFSIIFMLSIVFFSQPNFTAYASNEMPGYENPQ
FT                   DIIIASPKNNYTTTGSKVSILGACDYEYPLYMNGEEIETSEYGFFTVYVELEVGKNEFE
FT                   FENNGVINTLTITRNKVTTSSGNNSTSGGNTTPKVTYKEYKNDVYGVITSSYAMPRSKI
FT                   SESNVNLMPLTLGTTSRLLGEDGSFYKLADGTYVSKSSIKRYDKTLEPNKVTKASVSKD
FT                   TVANQLVIELSMNVNALYSVSFEGQNIYLKLYDTIAAAKPITTGNGIIEKVTVNTDSKN
FT                   KTKTYCFTMFDNASIYGYDVTFKNGVMRFELKLPVILKDSKSLVGATVLLDAGHGDYDN
FT                   GTVGAMGVYGPVEKDINLNITLYTKQYLEALGAKVVLIREDDTFYSLSDRVETIRKVKP
FT                   DISVSIHGNSLDYASDYSKSSGFLTYYSYNLFGNFPNLMNNSITNELGLKKRDPRQSSL
FT                   SLTRLTTCPSVLLETSFLSNPYDYEYLIQSKNQKDFGIAIGKAIQGYLQGIAKQNDQVY
FT                   VVKKGDTLASIALKYGAPIKRLAEYNSIKDIDYIIVGQKILIP"
FT   sig_peptide     96504..96608
FT                   /locus_tag="Cphy_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.870 at
FT                   residue 35"
FT   gene            98284..98904
FT                   /locus_tag="Cphy_0069"
FT   CDS_pept        98284..98904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40459"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF0"
FT                   /protein_id="ABX40459.1"
FT                   /translation="MVVSYDPALAVAYAVQFGDQEQNGIFKRMSEDCTNFISQCIWAGY
FT                   GGTEGYSLTSEADILALRERVAKNYRQTSIWYGRNYASPSPIASGAFIRVEELWNYVTT
FT                   NRGPGPKAIGYNNRQYWGYAPVDLALGDVLQFYHSNLGRYGHTVMVTATTENPQPIESA
FT                   LGNVYVAQHTADYSYRPFSDVLDTNGGIEGAWMRVLKFTDTYF"
FT   gene            99198..100577
FT                   /locus_tag="Cphy_0070"
FT   CDS_pept        99198..100577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0070"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   cbe:Cbei_0369 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40460"
FT                   /db_xref="GOA:A9KQF1"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF1"
FT                   /protein_id="ABX40460.1"
FT                   /translation="MISKSILNAVLAKALSTGADFAEVFAERTLSKNISMIDSKVSEIT
FT                   DSLLSGVGIRILMGTRSVYASTTDLSYSGLINCAAQVASALSGVPNGKSIHLTERIFGD
FT                   IHPIRIVPSSVSNAQKIDLLKEGYFSAKNYHKEIAQVMGNILDVDHNIMIANSDGLYTE
FT                   DRQVRTRMVISAIASKDGENQTGSFAPGRRMGLEMFDMISPKSIGEKAAKQAITMLHAD
FT                   YCPAGNYPVAIENGFGGVIFHEACGHSLESSSVALGQSVFSNKLGKQIANPKVTAIDDG
FT                   TISNAWGSINVDDEGNSSRRNVLIENGILKSYMIDKLGGRRMGMEATGNCRRQSYAWEP
FT                   TSRMTNTMILAGQDKNEDIISSMEYGLYAADMGGGSVNPITGEFNFSVREGYMVRDGKI
FT                   CEPVRGASLIGKGSEILMNIDMVGTNLATGQGMCGSSSGSIPTDVGQPLLRVSSITVGG
FT                   R"
FT   gene            100774..102117
FT                   /locus_tag="Cphy_0071"
FT   CDS_pept        100774..102117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0071"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   cbe:Cbei_0370 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40461"
FT                   /db_xref="GOA:A9KQF2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF2"
FT                   /protein_id="ABX40461.1"
FT                   /translation="MNYNEFKQAVIEAAKEAGLTEYELYYSMTSSIDTEIHKEDVKSFS
FT                   SSKNGGACFRCIINGKMGYAATEKYDEEEARNIIIRAMDNASSIESEDEVVLYGERDTY
FT                   EQVTKKAETLPSADLLIEKAIACNKATYEQDSRVIDATESGAFASTVSVSIYNSKGLDL
FT                   NHEVSLSAVYSVAVIEEKEEMLDSFDFQLGNMEAVNVNKVAKKAVEGAVEQIGAVKAAS
FT                   GKTRVVFSEKMMATMLSTFAEIFSAENAQKGLSLLQSKENTAIASDVVTIVDDPFYLGS
FT                   TLQMPFDAEGVATFTKEIVKDGRLNTLLYNLKTAKKAGIKSTGNASKSTYSSSVSTLPY
FT                   YFYIKPSSKTKEELFTIAGDGLYITELQGMHAGANPTTGDFSLGASGFIIKDGKKGSCV
FT                   KGFTVAGNFYKLLHSIEAISNELEFILPKGLSSFGAPCVLVSELSIAG"
FT   gene            102256..103299
FT                   /locus_tag="Cphy_0072"
FT   CDS_pept        102256..103299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH2880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40462"
FT                   /db_xref="GOA:A9KQF3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF3"
FT                   /protein_id="ABX40462.1"
FT                   /translation="MRITRGKKEKSAEIIGWRKKLLFGCVFLLATLVLAVVFAPFILVY
FT                   YITRGPVLYQVEASFDHPLQEVYKASDFLLEDKMLPIRTQDGFSLWASEIEVENPKAIV
FT                   IYLTDLKQPSITYFYGHAKWMKDNGYASILLETRGHGESDGDVIGLGYTEVNDVKAVVE
FT                   YIQKQECYRDVPIVLQGFSMGGAVAINAFGQIPEIDALIAMSAYTSTEDAMIDSMRDHG
FT                   VPEFLCKIERPLIKFALSIVFGRDAVETLKPIEQIKNANDRPVFFISSKEDLKVSLENI
FT                   RRFREVNPEAEYWVRDSAAHLDIDDNDFTNVEKDTEYCNRILDFLDKVKKAKQNVLSMT
FT                   KKAYFLL"
FT   sig_peptide     102256..102363
FT                   /locus_tag="Cphy_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.996 at
FT                   residue 36"
FT   gene            103427..103810
FT                   /locus_tag="Cphy_0073"
FT   CDS_pept        103427..103810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0073"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG: cac:CAC0599
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40463"
FT                   /db_xref="GOA:A9KQF4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF4"
FT                   /protein_id="ABX40463.1"
FT                   /translation="MLLALDFSSDVPIYLQIRNQIVLGISQGKLLPGEKLPTIRCLANE
FT                   IGVNTMTVNKAYQVLKQEGYITADRRSGAMVKVRESDTLGWKEKQIEDLRLVISEIKLC
FT                   GIEKEELLKKCDLFYEEVSRHDR"
FT   gene            103800..104237
FT                   /locus_tag="Cphy_0074"
FT   CDS_pept        103800..104237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40464"
FT                   /db_xref="GOA:A9KQF5"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF5"
FT                   /protein_id="ABX40464.1"
FT                   /translation="MIVNIIMLISMLPILPIIYYLMINEAEPKKNIVLGVTLPAEQLDN
FT                   STVLQIIARYKKELRIWTVCLLPVLILPFFIKSFAIGFSIQMLWVLIVAMLSFYPFAKY
FT                   NMQLSKLKKDREWGVTYTNTVVVDMKAAREIQVRGLTIWYL"
FT   gene            104245..105003
FT                   /locus_tag="Cphy_0075"
FT   CDS_pept        104245..105003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EF0300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40465"
FT                   /db_xref="GOA:A9KQF6"
FT                   /db_xref="InterPro:IPR027783"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF6"
FT                   /protein_id="ABX40465.1"
FT                   /translation="MTRIRRKAWNDCFLSLAVCNTVYVVITYFYLNNKMISTMSFMLST
FT                   MIYSVVIVFISIYSELKVRKLQRKYSMDQPMDVVVDDDSNWIFGMLYYNPRDKHTLIAK
FT                   RVGMGTTCNLATKAGKVLAGFVIIALLSIPLSCVWIFFEEFTPISLQVENHELIATHLK
FT                   EEYKIPLDEIIEIEYLTSLPRTSKNVGTGLDNLYKGDFSVKGYGSCEVFLNPETEAFLV
FT                   LHTKEETYIFSDETTEKTIEVYKKLKEVVQ"
FT   gene            105399..106172
FT                   /locus_tag="Cphy_0076"
FT   CDS_pept        105399..106172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0076"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bay:RBAM_030540 putative multidrug ABC transporter,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40466"
FT                   /db_xref="GOA:A9KQF7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF7"
FT                   /protein_id="ABX40466.1"
FT                   /translation="MDEIIVKLEGLAKRFDTKVAVDFVNLEIKKGEIFGLLGPNGAGKS
FT                   TTMNMICTLVKPTSGQIELFGSDIKKEERKSLSRIGYVPQDLAIHEALRAWENVELFAS
FT                   LYGIKGEELKKAVDNSLDFVGLSEHRKGLPKNFSSGMKRRLNIACALGHHPELLILDEP
FT                   TVGIDPQSRNFILEKIKYLNKMGVTVLYTSHYMEEIEAICTRLAIMDNGKVIACGTKEE
FT                   LVQLVSDDPMSEISLEQIFLTLTGKKLRDYAEGEM"
FT   gene            106174..107232
FT                   /locus_tag="Cphy_0077"
FT   CDS_pept        106174..107232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0077"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: spa:M6_Spy0585
FT                   SagH"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40467"
FT                   /db_xref="GOA:A9KQF8"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF8"
FT                   /protein_id="ABX40467.1"
FT                   /translation="MLTYLVKNNMKLILRGKLIFIMMILMPVFLITLLSSTFDSMLNVN
FT                   YSLKEYEVGYAVSEDSYIHPMLETMKTVGAKSKLKLIPYTKEVGLEKVNDQTLDLYVEF
FT                   GTKEYVIYQTEETKAATMILKSVMSSLMQKDSIQEAVYRVEDIPANPIPAAKNYYGIVE
FT                   IVYFMWCGILSISAVINSERKGQIRSRMKMSPTSTASLYLGKFIPCVMVLCIQMGIAMI
FT                   ITFFTLGIDWGEKIYLSLGILFLQSMAVSAFSIMLYHIFQNVAAAIVSCFIIVFGWGLF
FT                   GGSFQTYMFTTTSDTMAAISPIYYLNRTLVEYSTRGSSEYALPCVFILLTMILIGSTVS
FT                   ILLCKFGKGERV"
FT   sig_peptide     106174..106287
FT                   /locus_tag="Cphy_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.798) with cleavage site probability 0.394 at
FT                   residue 38"
FT   gene            107229..108488
FT                   /locus_tag="Cphy_0078"
FT   CDS_pept        107229..108488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0078"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tte:TTE2529
FT                   ABC-type multidrug transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40468"
FT                   /db_xref="GOA:A9KQF9"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF9"
FT                   /protein_id="ABX40468.1"
FT                   /translation="MTGFFTMFKANVRLLLRNKGFVCCIFFLPLLTLLWLAMPLKYPIE
FT                   SEGINIIEVEAGERILLSMVDIELSIKVYDASDSKSSQYLLDGLLDTGGYSVYREKVTD
FT                   KTIAQIKEEATLTANRSNLGIQLYLPKDFEERILSGEYKEAILVLKSNEDERIPLLYEN
FT                   LNRLVGDMVELSHIEPPTKEDSIRSYHELLEAKDGSIENRVETVSTKNSRVITAKERHQ
FT                   KENFGYTISFLSLSSLLIGVFITGIFLKEKEYQVLKRITLTQTKIAGYGLAKIILIIPT
FT                   TMLQTGIYLLGLNTFVKADIGVNNSEFTLMAFGIGFTFQLLSITLGTLFDNILTVSYVA
FT                   FFAWVFTSTLSGLYFPVEKASSLIKSLSYLMPQSWTIRFFDGIKGANTGIYSMFILIML
FT                   AFCIVFLSIGVFGLKITEKE"
FT   gene            108728..109885
FT                   /locus_tag="Cphy_0079"
FT   CDS_pept        108728..109885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0079"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: bld:BLi04006 YxjM"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40469"
FT                   /db_xref="GOA:A9KQG0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG0"
FT                   /protein_id="ABX40469.1"
FT                   /translation="MNENIIRYQFVLIKGLLLGAVFLYHVMEQQNKLLSQYGVWVIYAL
FT                   LFAALIAQGITKRHKALLLLIQTGLVIVMISWFGREYALVLPVIFLSIAGSLKIRYPYY
FT                   ATAILGAFVYSGNIAVYLLFTFVCILLFIQNDVIIDKYKNLLQSYEQNEQRLKHSMDNQ
FT                   SHIYKKELIENSLFFENKLLEEKGRLSQALHDKLGHSINGSIYQLEATKVLLTSEPEQA
FT                   NGILQAVIDNLRISMDEIRQLLRGEKPDKRKMALLQLMTLCDECKKKYNIEAEVIMSGD
FT                   NKSVPEYIWEVILDNSFEAVSNALKYSKCKHITIQIVILNKLVRCTIEDDGVGCMQINE
FT                   GMGIAGMRKRVRAINGVLDVTAQIGFCINMILPISTLYNNARSEK"
FT   gene            109893..110531
FT                   /locus_tag="Cphy_0080"
FT   CDS_pept        109893..110531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0080"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: bca:BCE_1863 DNA-binding response
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40470"
FT                   /db_xref="GOA:A9KQG1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG1"
FT                   /protein_id="ABX40470.1"
FT                   /translation="MEPIKVIIADDSDFVRDGMRIILSVDPDFEVVGCAKNGKEAVELA
FT                   SKSSVDVILMDIEMPVMNGIEATKEIVLHNLGKVLILTTFDDDELVEQSIQNGAKGYLI
FT                   KNHTPEKLKQMIKSIYNGVNVLDEKVFEKFTSRSIHTNTGFDPNGYTTRELDIIASVAE
FT                   GLSNKEIAKKLFISEGTVKNHISTILEKGGFSHRTQLAVYYLTGKKQGE"
FT   gene            110768..111313
FT                   /locus_tag="Cphy_0081"
FT   CDS_pept        110768..111313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0081"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4
FT                   protein; KEGG: cbe:Cbei_2490 rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40471"
FT                   /db_xref="GOA:A9KQG2"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG2"
FT                   /protein_id="ABX40471.1"
FT                   /translation="MKKFVCSVCGYVHEGDSAPDKCPICNADSSKFIEKSGELQWADEH
FT                   VIGISSDANDEILEGLRANFMGECTEVGMYIAMSRQADREGYPEVAEAYKRIEYEEADH
FT                   ASRFAEMLGEVVKASTSDNLAARVDAEYGACEGKKKLATLAKSMNLDAIHDSVHEMAKD
FT                   EARHGCAFKGLLDRYFGK"
FT   gene            111417..111740
FT                   /locus_tag="Cphy_0082"
FT   CDS_pept        111417..111740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0082"
FT                   /product="protein of unknown function DUF1540"
FT                   /note="PFAM: protein of unknown function DUF1540; KEGG:
FT                   cbe:Cbei_2324 protein of unknown function DUF1540"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40472"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG3"
FT                   /protein_id="ABX40472.1"
FT                   /translation="MSNVMCGATNCSYNQGHVCCANTIKVGGKAATSEESTCCASFLNR
FT                   AVYSNLAEYTSMRGTSKEILCNVATCNYNSADHCSLDEIEVGGSSQTSFYTETDCLSFD
FT                   KLS"
FT   gene            111752..112369
FT                   /locus_tag="Cphy_0083"
FT   CDS_pept        111752..112369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0083"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   Rubredoxin-type Fe(Cys)4 protein; KEGG: sat:SYN_02123
FT                   ferric-chelate reductase / rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40473"
FT                   /db_xref="GOA:A9KQG4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG4"
FT                   /protein_id="ABX40473.1"
FT                   /translation="MDPKAFHKISYGVFIVSAEGSDHKAGCVINTLTQVTSSPMKLSIA
FT                   LNKNNDTLEVIKEAGTFSAVVLKEDVDLGLIKIFGFFSSRDKNKFESISYKFDDNNNPY
FT                   PAGGIVAQFSCRLCDSLDVGSHVICIGEVTDANLVSEDPPLTYADYHSKKGGATPKNSP
FT                   SYQEGTTGYQCTVCGYIEETDDLPDDFICPVCGKDASYFRKL"
FT   gene            112892..113914
FT                   /locus_tag="Cphy_0084"
FT   CDS_pept        112892..113914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0084"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: ppe:PEPE_1302 D-alanine-D-alanine ligase
FT                   related ATP-grasp enzyme; TIGRFAM: D-alanine--D-alanine
FT                   ligase; PFAM: phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   D-alanine--D-alanine ligase domain protein; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40474"
FT                   /db_xref="GOA:A9KQG5"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG5"
FT                   /protein_id="ABX40474.1"
FT                   /translation="MKVVVLAGGLSPEREVSLSSGSKIANALMEKGYEVLLLDLYLGIK
FT                   DVTNIDSLFRKMEDQNPYQYQVPKEEPNLTKLKEDSGNGGILIGENVLLLCQYADKVFL
FT                   ALHGSIGENGQLQAMFDIYGISYTGSGYIGSLLAMDKGLSKVIMQKHGIETPDYIVADL
FT                   TEEQELEKTLMLPCVIKPLSCGSSVGVSIVRSQEELGKALDYAKKYENKVLIEELIVGR
FT                   EFSVGILNHHALPLIEIIPKTGFYDYTNKYQAGMATEVCPAQLEDEISIKMQEAALKVH
FT                   EVLQLGFYSRVDFLLKEDGSFYCLEANTLPGMTPTSLLPQEAAAIGISYSKLCELILLG
FT                   "
FT   gene            114069..115049
FT                   /locus_tag="Cphy_0085"
FT   CDS_pept        114069..115049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40475"
FT                   /db_xref="GOA:A9KQG6"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG6"
FT                   /protein_id="ABX40475.1"
FT                   /translation="MRKNKILILFLVIFTLTTTNIVTLLYLNHIIHSNSEQLVFAYDAI
FT                   MVRDNEISRLEGLENENNRLTLENQTLNTTNENLTSQKEQLSREQSSLKQQVSEQSEEI
FT                   VVLTNQNLNMNRVLEKYSYFLDYEPEILNEYQTYIKELEQKVESSGSFDIYEVPKRKKV
FT                   YEGYTIWLEDGASERWADQAMDYLKLVPAKALEVLNKDKWYLIITPRSLEEVYHSGVEN
FT                   TIGLTIYYRKRIYIKNNEFSIDSCTLHEIGHALDALNSYQSFTEGFNDIFNEESAASGL
FT                   SKYFTSSPTEYFAETFQNYFISPELTKRNAPKSYAFIEKFLEKYE"
FT   sig_peptide     114069..114140
FT                   /locus_tag="Cphy_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.645) with cleavage site probability 0.163 at
FT                   residue 24"
FT   gene            complement(115163..115348)
FT                   /locus_tag="Cphy_0086"
FT   CDS_pept        complement(115163..115348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbf:CLI_1824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40476"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG7"
FT                   /protein_id="ABX40476.1"
FT                   /translation="MQQLMEEDSYGSQIELKSVFCLGHCQSGVSVQIDDEPTIYSVSKD
FT                   SVKDFYYNTVIPKLKG"
FT   gene            complement(115437..117140)
FT                   /locus_tag="Cphy_0087"
FT   CDS_pept        complement(115437..117140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0087"
FT                   /product="hydrogenase, Fe-only"
FT                   /note="TIGRFAM: hydrogenase, Fe-only; PFAM: ferredoxin;
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; iron
FT                   hydrogenase small subunit; hydrogenase large subunit domain
FT                   protein; KEGG: cbe:Cbei_4110 hydrogenase, Fe-only"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40477"
FT                   /db_xref="GOA:A9KQG8"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG8"
FT                   /protein_id="ABX40477.1"
FT                   /translation="MAKYMIIDGNRVEFNDEPNILALVRKAGIDLPTFCYYSDLSIYGA
FT                   CRMCVVEDQWGGIIASCSTPPKDKMEVKTNTPKLHQHRKMILELLLAAHCRDCTVCDKN
FT                   GKCRLQELAHRFGIKSVRFENKTEEMELDTSSASIIRDPGKCILCGDCVRMCNEIQNVG
FT                   AIDFAHRGAKMIVSPAFNKKIAETNCVNCGQCAAVCPTAAITVKSDLKDVWKAIYNPKK
FT                   RVVVQVAPAVRVALGEEFHMKAGENVIGKIVAALRRLGFDAIFDTSVGADLTIMEESKE
FT                   LLKKLEAGENKYPLFTSCCPGWIRYAETKHKELLPYISTCKSPMEMFGAVIKEHFKGLD
FT                   STEGVETVSVAIMPCSAKKYEASREEFKRNDIPDVDYVITTIELVKMIKEIGIQFEEIE
FT                   PEAPDMPFSLYSGAGVIFGVTGGVTEAAVRRVVADKSPKALKDIEFLGLRGMEGVKVCE
FT                   LQVEENSIVRIGVVSGLANAEALIEKIESGEEHFDFVEVMACPGGCIAGAGQPFSHKEE
FT                   KNARALGMYKADKVSQIKRCEENPLMLSLYNGMLKHRTHELLHVSYRKED"
FT   gene            complement(117158..119044)
FT                   /locus_tag="Cphy_0088"
FT   CDS_pept        complement(117158..119044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0088"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.11"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Respiratory-chain NADH dehydrogenase domain 51 kDa
FT                   subunit; KEGG: cbe:Cbei_4111 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40478"
FT                   /db_xref="GOA:A9KQG9"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG9"
FT                   /protein_id="ABX40478.1"
FT                   /translation="MLIRSREELDALKVRYQKSFKSQYKQILICGGTGCVAGGSLNIYA
FT                   RLKELIEESGLDVSVSLEDEPHEAVGIKKSGCHGFCEMGPLLRIEPAGVLYIKVKVEDC
FT                   EEIVEQSIIKDGVVERLLYKDSEGNSYNKQEDIPFYKQQTRVALEHCGHINAESINEYI
FT                   AMGGYQAVAKALFDMTSESIVDEISDSYLRGRGGGGFPTGKKWAQVLRQTEETKYVVCN
FT                   GDEGDPGAFMDRSMMEGDPHRMIEGMIIAGIATKAHYGYIYVRAEYPLAVHRLETAIEQ
FT                   ARSLGLLGCNILGSGFSFALKISQGAGAFVCGEGSALTASIEGNRGMPRVKPPRTVEKG
FT                   LFEKPTVLNNVETFCNVPSIILKGADWYKTYGLEKNYGTKAFALTGNVMNTGLIEVPMG
FT                   TTLRKVIYDIGGGVKGGEFKAVQIGGPSGGCLVLNAENDHLDMPLDFDSLKKVGAMIGS
FT                   GGLVVMNDKSCMVEVARFFMNFTQNESCGKCVPCREGTKRMLELLTDIVEGRGTLEHLD
FT                   LLEELAETISATALCGLGKTAASPVVSTIKYFRDEYIAHVVDKKCPAGQCKALMTLKII
FT                   PELCKGCTKCARLCPVSAISGEVKKLHSIDTKKCIKCGACKDSCGFKAIIEE"
FT   gene            complement(119038..119523)
FT                   /locus_tag="Cphy_0089"
FT   CDS_pept        complement(119038..119523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0089"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; KEGG: cbe:Cbei_4112 NADH dehydrogenase
FT                   (ubiquinone), 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40479"
FT                   /db_xref="GOA:A9KQH0"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH0"
FT                   /protein_id="ABX40479.1"
FT                   /translation="MLGQDEKGLIDNILTAHDYNKSHVIAIMQEVQKVYRYLPEEVLCY
FT                   IAEKLKLSEAKIYGVATFYENFSLEPKGKYVIKICDGTACHVRKSIPILEEFRKVLGVT
FT                   EKNPTTDDMIFTVETVSCLGACGLAPVCTVNDVVHAAMTPEKAKALIEQLREEAFQC"
FT   gene            complement(120033..121487)
FT                   /locus_tag="Cphy_0090"
FT   CDS_pept        complement(120033..121487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0090"
FT                   /product="Ferredoxin hydrogenase"
FT                   /EC_number="1.12.7.2"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; hydrogenase large subunit domain protein; KEGG:
FT                   cbe:Cbei_0327 ferredoxin hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40480"
FT                   /db_xref="GOA:A9KQH1"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027631"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH1"
FT                   /protein_id="ABX40480.1"
FT                   /translation="MLQTDNDIGTIKHEVLFEVAKLAFKNQLADKEDVLPYEMIPGPQA
FT                   NFRCCVYKEREIIRQRIRLAQGKSPSLSHDSSNIVQVISSACEECPITRFLVTDNCQKC
FT                   MGKRCQKACNFQAISMSHDRAHIDPAKCKECGMCASACPYNAIADLKRPCKKSCPVDAI
FT                   SMDENNIVVIDEEKCINCGQCINNCPFGAISDRSFMVDVINLLSIDKPIYAMIAPAIEG
FT                   QFGATATTGVMTEALKQLGFTGVYEVALGADLVAASEAEEWAEAYKEGMKKTTSCCPAF
FT                   VKMIKNHYPSLVEHISSTISPMQATAKYIKAIHEDAITVFIGPCIAKKGEVLDHIAEGG
FT                   ADYALTFDELYAMLRAKDINLETIGENIQQGSIFAKNFAVAGGVTASVVEALKEKGIDA
FT                   PITVAGCNGAAECKKALTLLKVGKFPEDFMEGMCCEGGCVNGPGSILTGRFAAKNRAKL
FT                   LSSADDRKIYDTVDSCQDLNIQMHRH"
FT   gene            complement(121534..122706)
FT                   /locus_tag="Cphy_0091"
FT   CDS_pept        complement(121534..122706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0091"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; KEGG:
FT                   cth:Cthe_0427 serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40481"
FT                   /db_xref="GOA:A9KQH2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH2"
FT                   /protein_id="ABX40481.1"
FT                   /translation="MSVTIDVSYKSLNKNNEELCGDKVEILKTKDSNIIILADGMGSGV
FT                   KANILATLTSKILGTMFLNGAGIEECVQTIVKTLPVCQVRQVAYSTFSILQIFKTGDAY
FT                   LVEFDNPACVFIRDGALLTVPYKERMIEGKCIREYRFEVALNDCFILMSDGVIHAGVGK
FT                   ALNFGWTWTNMAEYSVQATNSTLSASRLVSILSKACDDLYMQSPGDDTTVAVARVIDSK
FT                   PVHLFTGPPLNPVDDTTAVYAFLEGTATRIVSGGTSANIVARVLNRPIHTSLNYTDPNM
FT                   PPIAYIEGIDLVTEGVLTLTRALKLMREYVEKEVNEDFFLELDKDNGGSKIAKIIIEEC
FT                   TELHLFVGRTMNEAHQNPSLPFDLSIRMNLVTQIIDIVHKMGKEAIVKYY"
FT   gene            complement(122755..124488)
FT                   /locus_tag="Cphy_0092"
FT   CDS_pept        complement(122755..124488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0092"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; hydrogenase large subunit domain protein; Fe-S
FT                   cluster domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; KEGG: tte:TTE0697 ferredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40482"
FT                   /db_xref="GOA:A9KQH3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH3"
FT                   /protein_id="ABX40482.1"
FT                   /translation="MNVIGFKEAKCKNCYKCVRNCDVKAITVKDAQAYIMNDKCILCGH
FT                   CLEVCPQNAKTLISDLERVKGYLREGYQTVVSLAPAYLGVLHYNTPGQVISALLKLGFT
FT                   AVRETAEGAAYVTREYDNLIAAGEMENIITTCCPSLNDLVEIYYPSLTKYLAPVVSPMI
FT                   AHGKIIREQYGPNVKVVFLGPCISKKREAESDPRTVGIIDAVINFKELEEWLLEEGIDI
FT                   FKQPDTPPDNPNPLVNRLYPISSGVLSSVVASKNTSDHYRKFYVHGINNCIDLLESMNR
FT                   GEITGCFIEANICNGGCIKGPAIDRTRISRFKVKLDMEESIPKAPITEEDFFTKSPIHF
FT                   DKFFLGRSPKDPVPTEKEVMQILAKIGKTKPEDMLNCGACGYATCRDKANAVYQGKAEL
FT                   NMCIPYMHERAQSMANFVLDTTPNIIIIVDAEMKIMEFSAAAEKYFRTPRSVAKEMYLY
FT                   EFIDHSNFQAVLETQKDIIGKRVIYEDRNLATLQTIVYSKEQNCVLGIFQDISHQEELD
FT                   RKAYKVKVETIEMAQRVIDKQMKVAQEIAGLLGETTAETKVTLTKLRDTILNDGKPYDI
FT                   F"
FT   gene            complement(124488..124730)
FT                   /locus_tag="Cphy_0093"
FT   CDS_pept        complement(124488..124730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40483"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH4"
FT                   /protein_id="ABX40483.1"
FT                   /translation="MVVTICVGSSCHLKGSREIITRLETLITENKLKSKVELNGAFCMG
FT                   QCVKGVCIKLDGEPFSLTPKDTDSFFHGEILRRLT"
FT   gene            complement(124837..125703)
FT                   /locus_tag="Cphy_0094"
FT   CDS_pept        complement(124837..125703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0094"
FT                   /product="DegV family protein"
FT                   /note="PFAM: DegV family protein; KEGG: oih:OB2518
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40484"
FT                   /db_xref="GOA:A9KQH5"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH5"
FT                   /protein_id="ABX40484.1"
FT                   /translation="MNPTHRKELMIRIISDTSTLYSVSEAEEKGIYVSPLAVTINDTTY
FT                   EEFNDIQTEEFVDLIHQGHIPLSSQPAIGRVVDLYNRFPEDEILNITMADGLSGTYQSA
FT                   ILAKDMAKDSERITVLNSKTLCGPHRTLVEHAKHLADQNHTISEIVSKLEKMIASSRSF
FT                   LIPQDFDYLRRGGRLSHLAAFVGKTIHLVPVMTLTKDCKQLCNFSIKRNFKKAIHEIIR
FT                   SLEDDNIGEHHKLYVSHSLAESLAITASELLKEAFPHSDVIIYKLSPAFTTQGGPGCIA
FT                   IQSLSME"
FT   gene            126311..127729
FT                   /locus_tag="Cphy_0095"
FT   CDS_pept        126311..127729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0095"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /note="TIGRFAM: asparaginyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: cth:Cthe_0070
FT                   asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40485"
FT                   /db_xref="GOA:A9KQH6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH6"
FT                   /protein_id="ABX40485.1"
FT                   /translation="MGYRKGEIGMELVQVRELFRNKEQYLGKKITVGGWVRSVRDTKTF
FT                   GFIVMSDGTFFETLQIVYTDKLSNFAEISKFNVGSAVVVTGTLVATPDAKQPFEIQAEE
FT                   VLLEGASTSDYPLQKKRHSLEFLRAMTHLRPRTNTFQAVFRVRSLVAYAIHKFFQERDF
FT                   VYVHTPLITGSDCEGAGEMFQVTTLDLNNIPKTKEGQVDFDQDFFNKPTNLTVSGQLNG
FT                   ETYAMAFKNIYTFGPTFRAENSNTTRHAAEFWMIEPEIAFADLKDDMILAESMLKYVIK
FT                   YVLEHAPEEMEFFNSFVDQGLLERLQHVANSDFGHVTYTEAIEILEKNNDKFEYKVSWG
FT                   CDLQTEHERFLTEQIFKKPVFVTDYPKEIKAFYMKLNEDNKTVAAMDLLVPGIGEIIGG
FT                   SQREDDYDKLVAKMKESDLNEEDYDFYLDLRKYGSARHAGFGLGFERCVMYLTGMGNIR
FT                   DVIPFPRTVNNCDL"
FT   gene            complement(127890..128408)
FT                   /locus_tag="Cphy_0096"
FT   CDS_pept        complement(127890..128408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0096"
FT                   /product="protein of unknown function DUF988"
FT                   /note="PFAM: protein of unknown function DUF988; KEGG:
FT                   cbf:CLI_3316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40486"
FT                   /db_xref="GOA:A9KQH7"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH7"
FT                   /protein_id="ABX40486.1"
FT                   /translation="MKDKTLYFLLHSAMIAAIYVVLVVLFQPISVSYIQVRFAEALTIL
FT                   PFFTPAAIPGVAIGCLLGNVIAGCDMLDIVFGTLATLLGAIGSYSLRRYKFLVPIPPIV
FT                   ANTVIIPWVLRFAYGEAMSIPFMMLTVGIGEVISCGIIGIILLYCLKPYKKIFYIPGFA
FT                   KSKDKYDIV"
FT   gene            129389..129880
FT                   /locus_tag="Cphy_0097"
FT   CDS_pept        129389..129880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0097"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   lsl:LSL_1338 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40487"
FT                   /db_xref="GOA:A9KQH8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH8"
FT                   /protein_id="ABX40487.1"
FT                   /translation="MDTEKIGKFIADRRKVRGLTQQQLADDLGLTNKAISKWETGQGMP
FT                   DITTLPILAEMLGITVNELLKGELNQSIDKKENGIETNYSVHKSVYWFKAMACLSIFIA
FT                   LMGNIVPLFMLRETSTIAAFLFGCWFEVCSLAVFVVFYLRMKGEIEFNSKTSVLKMNSL
FT                   "
FT   gene            complement(130233..131072)
FT                   /locus_tag="Cphy_0098"
FT   CDS_pept        complement(130233..131072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0098"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: cdf:CD1016
FT                   MerR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40488"
FT                   /db_xref="GOA:A9KQH9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH9"
FT                   /protein_id="ABX40488.1"
FT                   /translation="MSENKNEYLTTGEFAKICGIPKHILFHYDQIKLFQPEIIKENGYR
FT                   YYSFRQFDTFSIISALKMLGMPLKEIKQYMDERNPAKLIELLEQKSNEAAKEIIKLKNT
FT                   KREIDALKDLTKNALSVEYNIIEPAYHKSMKALCSTLMDNSNDNSYSNFLTELIAFRNN
FT                   SNASMIDFLGASLTIDNIREKRFDSFSYLYTKSNNADKKNNTLVRKEGWYLQVYYKGSY
FT                   RNISEMYTKIMQYAKEHKIKLGENAYEDYLIFEIGTRDRDDYVTLILVEIEDEPQAL"
FT   gene            131424..133151
FT                   /locus_tag="Cphy_0099"
FT   CDS_pept        131424..133151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0099"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: cdf:CD2818
FT                   ABC transporter, ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40489"
FT                   /db_xref="GOA:A9KQI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQI0"
FT                   /protein_id="ABX40489.1"
FT                   /translation="MKLMLKYLKRYPKLILLNILGIFSFVAVQLGIPTVMAWMIDNGIG
FT                   NSDIAYIKKMGGIMLIVCVLGGAGTILLTYASSRISTNMIRDIRNDVFIQSQNFSHTEY
FT                   NKFGVSSMITRTTNDAFQLMLFSNMLFRTALLAPVMIFISVFMTIKTSVSLSLVIGGSF
FT                   PFIVAGVIIIAKLTNPLSKKQQKGMDQLNRISRENLTGVRVIRAFRKSEYESERFAETN
FT                   DNYASNSKKLFKIMSFTQPAFFFLLHLAMMAVFWISSLMIDKGTLQVGQLVAFLEYQFH
FT                   AMFSIMLFSMVFVMYPRAQVSANRIQELLDEEPLVKTPTNGITAENKGVVEFDHVTFQY
FT                   PDGELPVIKDVSFTANKGETVAFIGSTGSGKSTLINLIPRFYDVTSGSIKIDGVDTQNY
FT                   DLKALRQKIGFIPQKAFLFKGTIEDNLRFGNPNATPEEINHAIEVAQAKEFIENKPKKL
FT                   QEYISEGAKNVSGGQKQRISIARALVRKPEIYIFDDSFSALDYKTDATLRAALKKETKE
FT                   SIVFIVAQRISTIMNADKIIVLNEGEVVGMGTHKELLKSCNIYYEIADSQLTKEELER"
FT   sig_peptide     131424..131537
FT                   /locus_tag="Cphy_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.552 at
FT                   residue 38"
FT   gene            133148..134902
FT                   /locus_tag="Cphy_0100"
FT   CDS_pept        133148..134902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0100"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: cdf:CD2817
FT                   ABC transporter, ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40490"
FT                   /db_xref="GOA:A9KQI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQI1"
FT                   /protein_id="ABX40490.1"
FT                   /translation="MKKLYPYIKPYLKFFIVAILLTIGYAGFLSAAPMVEGFITTRLKD
FT                   DVVNIANKVPGAAISFSYIIKILKLLLVIYIGNVLCSYGSQYFLTTGIQNTMRDLRNDV
FT                   QRKIAKLPISYFDKRTVGDILSIISNDIDTMSNALQQSLSRILSAFLSITLAIILMFYI
FT                   NPIMGAVAVLLIPGSAFIMKFIMKRSSVMFKKQQVALGNLNGYIQERYTGLTEIKLYGK
FT                   QEDSIEQFKEINNNLCENGFRAQFISGLMSPLISFLTYIAIVAVTILGATFTITGAITV
FT                   GQLQAFIRYMWQLNEPLEQVTQLSSAIQSAMAASARVFEFLSETEEVPEAENPVKINDL
FT                   KGNVTFENVSFGYNKDKMLIEHLNVNVKSGQMVAIVGPTGAGKTTLINLLMRFYDVNNG
FT                   AIKVDGVNIKDMKRDDLRSIFGMVLQDTWLFNGTIADNIKYGKEDATRQEIENAAKTAN
FT                   VNHFIKTQPDGYNMILNEESSNVSVGEKQLLTIARAFLADPAILILDEATSSVDTRLEL
FT                   MLQTAMKNIMKDRTSFVIAHRLSTIRNADLILVMKSGTIIEQGTHDELMKKKGFYEKLY
FT                   MSQFQNQA"
FT   sig_peptide     133148..133243
FT                   /locus_tag="Cphy_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 32"
FT   gene            complement(135190..136272)
FT                   /locus_tag="Cphy_0101"
FT   CDS_pept        complement(135190..136272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0101"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: cbe:Cbei_4185 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40491"
FT                   /db_xref="GOA:A9KQI2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQI2"
FT                   /protein_id="ABX40491.1"
FT                   /translation="MNVVNIPVAQVVSGMIVAEDVYNSGNERILSRNTMVTTKSITKLK
FT                   LHAIKEIFVYIPNTLVKKQTTKPSEHITALKNSEEFKKFKKFYLGSILTLKDSFSSLTG
FT                   TSSLPYDENKLLDSVEQLLKECRSSLRTFDMLQCIRDLDDQIYVHSLNVALICFSFATW
FT                   LNFNAHDAEQLMLAGLLHDIGKLKLPKDIIQKPAALNKKELEHVHQHPVTGYDLVKDRK
FT                   IDPRVKKAILMHHERCDGSGYPNKLSSKDISPFGKILAIADVYDAMTAKRVYRKEICPF
FT                   DVVENFEKEGFQKYDAAYLLPFLEGLAQCYINASVRLSNSLVGEVVMINKNKLSRPVVK
FT                   VDEQFIDLSKHKELRISSIL"
FT   gene            136465..137550
FT                   /locus_tag="Cphy_0102"
FT   CDS_pept        136465..137550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0102"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cth:Cthe_2411
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40492"
FT                   /db_xref="GOA:A9KQI3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQI3"
FT                   /protein_id="ABX40492.1"
FT                   /translation="MNFIHVADVHLGATPESDRGWDINREKEIYDSFRRVTTECEEKKI
FT                   DLLLISGDLFHKQPLLRELKEVNYIFSKLTHTKVVLIAGNHDYIGPRSNYQNFNWCDCV
FT                   TMLSGGEMDSIYFEELNTEVYGLSYVSREIFEPKYDAIIPGVEERINILLAHGGNENNI
FT                   PINYKKVEEAGFDYVALGHFHKPQLITDRMAYVGSLEPLSKGEPLPHGYYYGEITKEKR
FT                   KTEERYESNLSLTFVPIACREYMTKEIEVTPDMFGTGIVDFARNIINENGSRNFYQFLL
FT                   VGKTDPSILLDIEDFYRLGYVTEVLNHTLPDYDFGSLYGENKDNLIGSYIRRIRESDAN
FT                   EDLVDKALYYGIEALLNTKER"
FT   gene            137559..139694
FT                   /locus_tag="Cphy_0103"
FT   CDS_pept        137559..139694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lga:LGAS_1449 DNA repair ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40493"
FT                   /db_xref="GOA:A9KQI4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQI4"
FT                   /protein_id="ABX40493.1"
FT                   /translation="MIIKELNPGHFGKFHNVNVELTPGINVIYGKNEAGKSTLHAFVKG
FT                   MLFGIERLRGRAGKEDLYVKYQPWDTPGAYQGSMVLSVDGEDYRIIRSFYKKERSIKII
FT                   RESTGRELTDAELGVSAIIPKLTESIYRNTISIEQLRAKTEYELAEELKNYITNLSMSK
FT                   SKEVDVNGAISYLLEKKKKLEKRLPDDRLATLTSELKELQDTLKKLDDLSGELAELKKR
FT                   SEYLENKQKEYNRSTNQERMKKVAYYPAILEKFNRFLEMKQSAKNAEEKVEGLGEKTKK
FT                   QASELDSSNTIGEHLKELGELRQRKQELEEELKEKRQEIEPHLKQGSISGRVIGVIIVV
FT                   LGLAISSIPFPFPFMTILIRCIIGIAFLVAGISKYILTATKEEKTKQKLEDMKTECERQ
FT                   IFYLHSKWHDILLSHRVSNESQLMVKYNDVLKNEVEREQALERKIEYQAAAKQFHNKAD
FT                   ELEYEIIDYMKHFLGNPEASKECMQELWQEIEEFKEEIINEMSANEEEHTNIRSQMERI
FT                   RWTLESNVECEVKLDQKQTEQEELCELRKELLEEIEAITLGIQTLKELSTDIHDSFGST
FT                   LNQMLSEIVSSISQGEYTSIIVDEKLNVSVLHLGQYVSLDKLSAGTMDQIYLALRLSVA
FT                   SLLFPEENMPILLDDTFALYDEERTKAALKLLAKETNRQVIIFTCHRREKELLEECKVP
FT                   YHYVDLNEIGKKPFEYA"
FT   gene            complement(139859..141028)
FT                   /locus_tag="Cphy_0104"
FT   CDS_pept        complement(139859..141028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0104"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: cpr:CPR_1519 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40494"
FT                   /db_xref="GOA:A9KQI5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQI5"
FT                   /protein_id="ABX40494.1"
FT                   /translation="MSQDNFKETLPVGTLGIIALESSQALGQKVNDYIVEWRKKRTGEH
FT                   TTTMQFAGYQRDSYLIKHQCPRFGSGEAKGLIKESVRGDDLYLLVDVCNYSLTYSLCGH
FT                   TNHMSPDDHYQDLKRIIAAVGGKARRITVIMPFLYESRQHKRSSRESLDCALALQELTN
FT                   MGVESIITFDAHDPRVQNAIPLKSFETVMPSYQFIKNLLKNVPDLVVDAKHMMVISPDE
FT                   GAMGRAVYFANVLGLDMGMFYKRRDYTTIVNGRNPIVAHEFLGADVEGKDVLILDDMIS
FT                   SGESMLDVAKELKKRKAKRIFVCATFGLFTNGLDKFDEAYEQGLIDFVMTTNLVYQTEE
FT                   LLSRPYYINADMSKYVALLIDALNHDASISEFLSPTERIQSVLNKYNNK"
FT   gene            complement(141256..142260)
FT                   /locus_tag="Cphy_0105"
FT   CDS_pept        complement(141256..142260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0105"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: cno:NT01CX_0917 DNA
FT                   replication protein DnaC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40495"
FT                   /db_xref="GOA:A9KQI6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQI6"
FT                   /protein_id="ABX40495.1"
FT                   /translation="MALKNYQYNTILREYDNRRLQNQYELKKRKEEVYAKIPELTLIDE
FT                   EIINGSIQSAKLSLSGNETALNHLKERNETLSLKKQELLRKAGYPNHYLTMWYTCPDCM
FT                   DTGYIENEKCHCFKQAIVDILYHQSNVRDSVQYENFSIFSYDYYADDYYDETTKLTPLE
FT                   NIKRVVTETKKFINQFDTSYQNLLIYGNTGVGKTFLTNCIAKELMDHAHTVIYLTSFQL
FT                   FEILEKYKFNSAEDMDDIRNQFDYILDCDLLIIDDIGTEMNNTFINSQLYQCINERHLR
FT                   QNSTVISTNLSFDQLKTNYSERIFSRISSNYLLLKIVGDDIRLQKLLKKHSKS"
FT   gene            complement(142366..143478)
FT                   /locus_tag="Cphy_0106"
FT   CDS_pept        complement(142366..143478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0106"
FT                   /product="primosome, DnaD subunit"
FT                   /note="TIGRFAM: primosome, DnaD subunit; PFAM: DnaD and
FT                   phage-associated region; KEGG: tte:TTE2692 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40496"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR017019"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQI7"
FT                   /protein_id="ABX40496.1"
FT                   /translation="MSKISFFSTTDAGITVISNRFLDEYMPRANGTFVKIYLYLLRCFQ
FT                   DPSLETSLSYLAEKLDETEKDIERAIRYWEKEQLLIITRAANRQITAITFTFPSNDNLN
FT                   TEETLPSITQEVMEQTAVTEAAAKEQDNSKATTIHKPNYSEAQIKALTEMEEVKWIMNT
FT                   VERLLERLLKSTDVQLILFLYESVGFSAELIFYLYEYCVSKNKRSASYIETVAISWAEE
FT                   GIDTVEKADAATLSYNNNYNSINKAFGLNRAPGTIEKKFMHRWFHEFCFDINIIEEACN
FT                   RTMLATGKPDFKYADKILENWYKKGVTCDADIVKLDEAHAKQSALSAANKQAASTKQPT
FT                   ANNRFNAFPQRKYSEEDFLSMEQRLLNNRS"
FT   gene            complement(143877..145286)
FT                   /locus_tag="Cphy_0107"
FT   CDS_pept        complement(143877..145286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0107"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: ckl:CKL_0143 MurC"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40497"
FT                   /db_xref="GOA:A9KQI8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KQI8"
FT                   /protein_id="ABX40497.1"
FT                   /translation="MYHIDFTKPIHVHFIGIGGISMSGLAELLHTKGFTVSGSDAKDSK
FT                   IVDRLRHLGITIFIGQKAENITEDIDLVVYTAAVKSDNVEYQAVQKHNIPMLDRADFLG
FT                   QVMLQYKNAIGVSGTHGKTTTTSMVSLMMLEGNFDPTISVGGILDNIEGNIRIGHSENF
FT                   IVESCEYKNSFLSFNPAHAIILNIEAEHLDFFKDIEDIRTSFHTFAKKLPDYGNLVVWG
FT                   GIDRYEELIEDLSCNVITYGMFSSEEEREQNKDRYDYAACNVTSDDFGLRSYDLYKHGK
FT                   FVDRINLAVIGDHNVLNSLAAISLVDTLGGTMSAIKKALLAYKGTERRFERKGVLNGIT
FT                   IVDDYAHHPSEIKATLIAAASYPHKDIWCVFQPHTYTRTKSFFHDFTTALALADKIVLA
FT                   DIYAAREENPGDISSKDIQNELLKIGKEAYYISDFAEIEKFLLEHCTNGDLLITMGAGD
FT                   VVSIGESLLQK"
FT   gene            145977..146375
FT                   /pseudo
FT                   /locus_tag="Cphy_0108"
FT   gene            146427..146708
FT                   /locus_tag="Cphy_0109"
FT   CDS_pept        146427..146708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0109"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: cbf:CLI_3766 stage
FT                   V sporulation protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40498"
FT                   /db_xref="GOA:A9KR30"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KR30"
FT                   /protein_id="ABX40498.1"
FT                   /translation="MQITDVRVRRVSKEGKMKAVVSITLDNEFVVHDIKVIEGEKGLFI
FT                   AMPSRKAGDGEYRDIAHPINSITRDKIQSIILEKYELAALEGNIEEAE"
FT   gene            147354..148388
FT                   /locus_tag="Cphy_0110"
FT   CDS_pept        147354..148388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0110"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: lwe:lwe0378
FT                   polysaccharide deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40499"
FT                   /db_xref="GOA:A9KR31"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR31"
FT                   /protein_id="ABX40499.1"
FT                   /translation="MRRRRRRNRKLLYALQISWIVLAITATIVIITQSSKWFGNGDNAE
FT                   VNAAGTIDNNGEPNGPTDQDSSGDIHTGTPTPEVTITPTVSPEGSGNQAEGDGTGQVTP
FT                   SITPGVGDNDETTNQGETTTPVDNDDSSASTSNSDRVIDPDKPMVALTFDDGPYPPVTK
FT                   RILETLEKNDARATFFVMGNRVDTYGDTLKLVHDAGNQIGNHSYSHKDLTKLDQKGIEH
FT                   EVDYSNELINEKANVGDAYLRPPYGAKSEKVSQYVKVPMIAWCVDTLDWQSRDKNKVFE
FT                   EVKRSVSDGAIVLMHDLYPSTADAIELIVPWLVKQGYQVVTVEEMFKAKGIELEPGKIY
FT                   YNAK"
FT   sig_peptide     147354..147425
FT                   /locus_tag="Cphy_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.378 at
FT                   residue 24"
FT   gene            148828..149403
FT                   /locus_tag="Cphy_0111"
FT   CDS_pept        148828..149403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0111"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG: cac:CAC3217
FT                   stage V sporulation protein C, peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40500"
FT                   /db_xref="GOA:A9KR32"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KR32"
FT                   /protein_id="ABX40500.1"
FT                   /translation="MYIIIGLGNPTREYEATRHNIGFDAITRLADDNNISLDTKKHKAI
FT                   CGKGMIGGEKVILAKPQTYMNLSGESVRELIDFYKVTKEEIIVIYDDISLDVGQLRIRT
FT                   KGSAGGHNGIKNIIAHLGSDEFCRIKIGVGDKPKNWDLADYVLARFPKEEEPAIREALE
FT                   KVSKACETILRDGAKVAMNLFNKKEINT"
FT   gene            149444..152983
FT                   /locus_tag="Cphy_0112"
FT   CDS_pept        149444..152983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0112"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: tte:TTE2565 Transcription-repair coupling
FT                   factor - superfamily II helicase; TIGRFAM:
FT                   transcription-repair coupling factor; PFAM: helicase domain
FT                   protein; transcription factor CarD; TRCF domain protein;
FT                   type III restriction protein res subunit; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40501"
FT                   /db_xref="GOA:A9KR33"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR33"
FT                   /protein_id="ABX40501.1"
FT                   /translation="MKTFTAPLQEYREFQVIEQSIQKNQFPLLITGCIDSQKCHLIHAL
FT                   SEGIVCKLVITYNDIKAKEIYEDLKLYDRNVYLYPAKDIIFYSADIHGNAIVRERMRIL
FT                   KNLLERKPMTVVATIDGGMDKLLPLDYLSDKIICIKEDSTIEIECLSEKLIHLGYERQG
FT                   QVENPGEFAIRGGIIDIYPLTEEAPYRIELWGDEVDSIRTFDVGSQRSIERVSTAVIYP
FT                   ASEIILEPEALKNGLHKLNIEQKEYVGKLRGELKTEEAARIHQIVEEFKENLECLQGSL
FT                   NLDSYIRFFYDKTCSFFDYFANDSSIIFADEPNRLAEKGEAVFTEFSESMVGRIEKGYI
FT                   LPSQMDVIYDYKELLANLSRRNSVLISTMDHKVMQLAAKKKVDITVKSVNPYNNNFEIL
FT                   IKDLQNWKRNGYRVILLSGSRTRAARLAQDLRDNELPAIYSEDVDRIPVKGEIVVMHGS
FT                   VHRGFEYPLIKLVIISESDIFGAEKKKKKKKPSYEGKQIQSFTDLNIGDYVVHENHGLG
FT                   IYRGIEKIEVDKVSKDYIKLEYGGGGVLYILATGLDVIQKYAGADARKPKLNKLNSVEW
FT                   KNTKAKVKGAVKEIAKELVELYATRQAKAGHSFCEDTVWQREFEEMFPYEETDDQLRAI
FT                   DDTKRDMESKKIMDRLICGDVGYGKTEIAIRAAFKAISDGKQVVFLVPTTILAQQHYNT
FT                   FSQRMMNFPISVDMLCRFKTPAQQKKTLENLKKGQLDILIGTHRVLSKDIQFKNLGLLI
FT                   IDEEQRFGVTHKEKIKQMKGDIDVLTLTATPIPRTLHMSLVGIRDMSVLEEPPVDRLPI
FT                   QTFVLEHNDEIIREAINRELARGGQVYYVHNRVNGLDEITNTIARLVPDANVAFAHGQM
FT                   HEHQLEKIMFEFINGEIDVLVSTTIIETGLDISNVNTMIIDNADQLGLSQLYQLRGRVG
FT                   RSNRTSFAFLMYKRDKLLKEVAEKRLQAIKEFTELGSGFKIAMRDLEIRGAGNLLGAQQ
FT                   SGHMEAVGYDLYCKMLNDAVKGLKGEISDEDTFDTSIDMDMDAFIPSTYIKNEMQKLDM
FT                   YKRIAGIENEEEFMDMQEEMLDRFGDIPTSVNNLLNIALLKSMAHQVYVSNLVQKGTEV
FT                   KLSMYPKAKIKVEMIPELLLKVGNNLKMIPGATPFFTYHMANVIKNPKVGTIDTLAVFE
FT                   SVKNLLLEFQILV"
FT   gene            153051..154184
FT                   /locus_tag="Cphy_0113"
FT   CDS_pept        153051..154184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdf:CD3500 putative foldase lipoprotein (late
FT                   stage protein export lipoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40502"
FT                   /db_xref="GOA:A9KR34"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR34"
FT                   /protein_id="ABX40502.1"
FT                   /translation="MKLSTAVFYKLDETSFKCAKACAGMEDKMKKIKRIGTIVLALTLA
FT                   TSLWACSKNKGSDVTNEDGITVVPEVPAQEKQGKTVLTVNNLTVSYEEAVLYLQSRKEE
FT                   IEELYGKDVWSLVVDEDGTTYEQLLKDSVYEEIEYLMLVCSKAEELGITLSEDELLDAD
FT                   EFTADFTSNFSPEALDYYNVNKGVVNKIYRDNMLANKIYESLTLNVDTEVSDELARQAV
FT                   FQYILVGKYGYDANGNRIEYTKEQLEESKTRAYKLREEALDAKNFYDFAAANSDDENEV
FT                   EITVGKGDMKENLEKVAFALDEGEISDVIDTADGYFIFRCVSLLDRNATDSKKEDIIIK
FT                   RQEEAFDVEYNKWQGEKEVKLNKEIWNSIDITGELVK"
FT   gene            154273..155049
FT                   /locus_tag="Cphy_0114"
FT   CDS_pept        154273..155049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0114"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tte:TTE0410 ABC-type multidrug transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40503"
FT                   /db_xref="GOA:A9KR35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR35"
FT                   /protein_id="ABX40503.1"
FT                   /translation="MIEINHLTKIYKLTKRQMRQLKTKENLKCAVDNVSLTAKQGEIYG
FT                   LLGPNGAGKTTTLRCVATLLKPTKGFIKVNGFDTITQSKNVRESISFLTNEIKLDPQFS
FT                   AKYMFHFFANLHGVPEKESIERREKLFHYFGITPFQDKKIEELSTGMKQKAAIAVSLAH
FT                   DPKIIIFDEPTTGLDIVTARSVTDYLKELKNEGKLIIISTHIMSEAEKLCDRIGIIIQG
FT                   RKVMEGTLSEILKETKTNDLEDAFFQLYQTYIKEEA"
FT   gene            155051..156268
FT                   /locus_tag="Cphy_0115"
FT   CDS_pept        155051..156268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0115"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tte:TTE0411
FT                   ABC-type Na+ efflux pump, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40504"
FT                   /db_xref="GOA:A9KR36"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR36"
FT                   /protein_id="ABX40504.1"
FT                   /translation="MKGANIIFKKEMKRIFQDKKMIFSLFILPAIIIIGMYSLIGVMMN
FT                   RMVDDIKKHESIVYIQNMPKEYESLLKTSGFLEVAKVTYLTKESSVKEYENKILKESID
FT                   LLVSFENNFNNSVASYEKSGDVIPKVTLFYNTTGKYSTEAESNFRTLVLEPLQQQLLAK
FT                   RLGNLEVLQVFQIAEKVIVDADKQNGQFLAMLLPYMITFMLFVGAMSLGVDAITGEKER
FT                   QTMAKLLLTPINRSEIVLGKLSSLAVLSSISAVVYAISMIIAMPMMEGNMGSQGGAISV
FT                   RFGVTQVVALFITMIVMVYLYVGLVALVSVFAKTAKEASSYISPLYIVIIVAGMLTMFQ
FT                   GGIEKPLYHYAIPVYGNSLAIQNIMTNELTLAQFLISSCSTLILAILVTIAIAKAFNNE
FT                   KIMFNA"
FT   gene            156368..156760
FT                   /locus_tag="Cphy_0116"
FT   CDS_pept        156368..156760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0116"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: fno:Fnod_1613
FT                   regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40505"
FT                   /db_xref="GOA:A9KR37"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR37"
FT                   /protein_id="ABX40505.1"
FT                   /translation="MLEKKETSMPLEQSQLHNHDGSLTKLLHDIPQEHEFLMAAEVFNQ
FT                   LSDGTRLRILWLLCHSEECVNDIAAAVRMTAPAVSHHLKTLKQNGIIKSRRLGKEVLYT
FT                   LEDTPKAILIHKMVDSIFEINCHTSR"
FT   gene            156810..157454
FT                   /locus_tag="Cphy_0117"
FT   CDS_pept        156810..157454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0117"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; TrkA-C domain
FT                   protein; KEGG: cbe:Cbei_2872 TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40506"
FT                   /db_xref="GOA:A9KR38"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR38"
FT                   /protein_id="ABX40506.1"
FT                   /translation="MEEQRKNKNAIPRYQQIAVEIASRIASEEYKVGDKIYARSSIAGQ
FT                   YGVSPETARRAICVLCDLEIVTSEKGSGVTIKSTENAIKFIKQYNKRQTIDTIKDNIQQ
FT                   SIIRQRTEMEVMNQHLTELISASEHFRSLNPFMPFEILITKECVFLGKTVAELQFWQHT
FT                   GATVIAIRRGDETMVSPGPYTHIKEHDILYFITQDDAPYRVKIFLYPNTTE"
FT   gene            158002..159138
FT                   /locus_tag="Cphy_0118"
FT   CDS_pept        158002..159138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0118"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: cbe:Cbei_2871 glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; TIGRFAM: glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; PFAM:
FT                   CBS domain containing protein; ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40507"
FT                   /db_xref="GOA:A9KR39"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR39"
FT                   /protein_id="ABX40507.1"
FT                   /translation="MIKFTNITKSFKSNKILKDVTFNIDTGNLVAIIGESGCGKTTLLK
FT                   MINRLIKPTSGSISIDGEDILSLDEVSLRRKIGYVIQQTGLFPHMTIKENIEIIPKILK
FT                   VDSAEIMENTKKLMNMVGLDYENFIDRYPSELSGGQQQRVGVARAFANNPDIILMDEPF
FT                   SALDPMTRSDLQDELVELQSKLKKTIVFVTHDMDEAIKIADKICIMREGRVLQYDTPEN
FT                   ILKNPVDDYVSNFVGKNRIWSSPEFIKVHDFMMNKPVTATKDLSILKCIDKMRQKKVDS
FT                   LLIINPDNHHLHGILKASQIRSIGDRTQSAENFMVTDFPTLNPDNTIVDALKLVTEQKV
FT                   STIPVTKEDGYLVGLVTRGNLVTTLSQQYYNGDEEVDV"
FT   gene            159135..160706
FT                   /locus_tag="Cphy_0119"
FT   CDS_pept        159135..160706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0119"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; Substrate-binding region of
FT                   ABC-type glycine betaine transport system; KEGG:
FT                   cbe:Cbei_2870 substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40508"
FT                   /db_xref="GOA:A9KR40"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR40"
FT                   /protein_id="ABX40508.1"
FT                   /translation="MNFIEYITNNYEQILRLLLEHIKLTAISVGFAILIGVPLGILISY
FT                   AKRVSKPILMVANIIQAIPSMALLGFMIPFLGIGMVPAIVAVILYSLLPIIKNTYTGID
FT                   NINPQTLEAAKGIGLTPFQVLTKVQIPLALPVIMAGVRIASVTAVGLMTMAAFIGAGGL
FT                   GHLVFSGIRTVNNNQILAGAIPACLLALLVDFLLGLVEQLVAPISLQKGENNVKKKKRG
FT                   IQKGILAGAVFAIIAIFVFTAKGTNANNQKVITIGSKDFTEQAILGNLVADLIEGNTDI
FT                   KVNRKLDLGGTQVCFSALNKGEIDMYVEYSGTAYLSALGHTEKKDKDQVFDIVKDEFKS
FT                   KYNIDVLKQMNFNNTYALAVTKEAAAKYQLKNISDLAKIAQTMKSGTTFEFLNREDGLP
FT                   GLQKEYGFTIGETVAIDGAPRYTALVNKDVDIIDAFTTDGLLKKFGLAVLEDDKAFFPP
FT                   YYAMPIVRSESLEQHPEIIPLLEELGDVLTNDIMLELNYQVDELQKSPEAVAKEFLKNQ
FT                   NLIPSK"
FT   gene            161160..161375
FT                   /locus_tag="Cphy_0120"
FT   CDS_pept        161160..161375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0120"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: fnu:FN0259 zinc-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40509"
FT                   /db_xref="GOA:A9KR41"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR41"
FT                   /protein_id="ABX40509.1"
FT                   /translation="MKKVVKLENLDCANCAAKMEDGISKIAGVEKVTVSFLMQKMTIVA
FT                   SEEQMEDILNQAEKIIHKLEPDVVIK"
FT   gene            161468..163318
FT                   /locus_tag="Cphy_0121"
FT   CDS_pept        161468..163318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0121"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: btk:BT9727_0506
FT                   cation-transporting ATPase, P-type"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40510"
FT                   /db_xref="GOA:A9KR42"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR42"
FT                   /protein_id="ABX40510.1"
FT                   /translation="MKKHKKNLIRIIISTAIFLLAILLPLPKIVTLILYIAAYLLIGYD
FT                   VLWNAFRNVIRGHVLDENFLMSIATIGAFAIAKYDESIFVMLFYQVGELFQSYAVAQSR
FT                   KSITALMDIRPDYANLVKDGEIQVVDPEEVMPGDHILIKPGEKIPLDGKIVVGQTSINT
FT                   SALTGESLPRESSVGDEVISGCINLNGTIEVEVTKEFEESTVSKILELVESASDRKAKS
FT                   EAFITKFAKYYTPTVVIFAVLLAVIPPIFVPGALFSDWLYRALIFLVVSCPCALVISIP
FT                   LGFFGGIGGASKKGILIKGSNYLESLSKVTAIAFDKTGTLTKGNFVVHDIVTDSLSKDE
FT                   LLEVAALAESHSSHPIATSIREAFGKELSMDRIREVQEVAGFGISAIVDGKQVFAGNRK
FT                   MMAEQNIEVKQLSENIPIGTTIHIAIDGNYAGYLEIRDEIKSTSKAAIEDLRHSGVHSL
FT                   VMLTGDAKVVGEAIAKELNLDHAYTELLPADKVEKFEEMLAKRGEKDQLAFVGDGINDA
FT                   PVLARADIGIAMGGLGSDAAIEAADVVIMDDDPEKLVTAIRIARKTLRIVKQNIIFALA
FT                   VKGIILILGAAGLSNMWEAVFADVGVSVIAILNSIRALKE"
FT   gene            163702..164154
FT                   /locus_tag="Cphy_0122"
FT   CDS_pept        163702..164154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0122"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sgo:SGO_0168 hydrolase,
FT                   NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40511"
FT                   /db_xref="GOA:A9KR43"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR43"
FT                   /protein_id="ABX40511.1"
FT                   /translation="MSRSEKAVFTNLCMITNGDEILVQERKNRDWPGVTFPGGHVEENE
FT                   SFVKSVIREVKEETGLSIKNPILCGIKQFQTRKKERYVVLFYKTDQFEGKLTSSDEGEV
FT                   FFIPRTDLNKYVLAEDFDLMLKVFESEDLSECIYQKSGDEWVLELL"
FT   gene            164245..165132
FT                   /locus_tag="Cphy_0123"
FT   CDS_pept        164245..165132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0123"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: lac:LBA1598 glycolate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40512"
FT                   /db_xref="GOA:A9KR44"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR44"
FT                   /protein_id="ABX40512.1"
FT                   /translation="MENLRTGDSNQITRDYFDSLLVEMRHIDSVIPSTTLELYGERFDT
FT                   PVMMAALSHLNKVRENGMVEMARGAYLANAVNWAGMGEEEELEAITATGAKTIKIIKPY
FT                   ADNKIIFRKIKHAQKCGALAVGMDVDHSFSGNGKYDNVLGHPMTSKSLDEIKEFVKSTD
FT                   LPFIIKGVLSEQDALKCLEAGVKGIVVSHHHGIMNYAIPPLKILPRIAAIVNKQIPIFV
FT                   DCGVASGMDVFKALALGATAVSAGRIIMDPLSKDGANGVKDTIIRMTEELAGVMARTCS
FT                   CDMKHIDPSVIHNK"
FT   gene            165343..166179
FT                   /locus_tag="Cphy_0124"
FT   CDS_pept        165343..166179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0124"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_5936 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40513"
FT                   /db_xref="GOA:A9KR45"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR45"
FT                   /protein_id="ABX40513.1"
FT                   /translation="MRIGGGLEKPYSNPEEWYQLVKELGYRAVLSPIDYRASQDEKKAY
FT                   QQCVKEHDLIIGEVGAWKNAIAFDELERKEALTFCKNQLALAEELGANCCVNISGSRGE
FT                   LWDGCYKENYQSDTYALAVDSIREIIDAVKPTRTFYTIEPMPWMVPDSPDEYLKLIDDV
FT                   DRKAFGVHLDFVNMINCPKRYVYHEEFIKECFEKLGPMIKSIHGKDVWMENKYTTLIHE
FT                   TMPGKGILNYQLITRLCEQLGPDTTLFVEHLPDFDSYKQAAGYVRQQAVLAGVSLP"
FT   gene            complement(166419..168566)
FT                   /locus_tag="Cphy_0125"
FT   CDS_pept        complement(166419..168566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0125"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: cpf:CPF_1807 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40514"
FT                   /db_xref="GOA:A9KR46"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR46"
FT                   /protein_id="ABX40514.1"
FT                   /translation="MKFIPQKAKSILDSVKTKCKKPFLQCVLLALALNIFVEIMSRRSV
FT                   FKAIAYLFTSPHVFIYNTFIILVTLSIALFFKRRWFVYYLVSLSWVAIGVTDFILLKFR
FT                   TTPFTAVDITLMKSATQIWQYYLKWFHLVFIAIGLALTVFSCVIVWKKVKRYDNRLPLL
FT                   KITIFFATTLISSTLLTKLGLKTNVLAGNFGNLANAYHQYGLPYCFVNSVINTGINKPN
FT                   IYTTDVVNTIVEGVEQGKIVSSSDILPTEVPEPSETPSPIPTLTPTPPVDLSTSTSDTV
FT                   ASKETPNIIFLQLESFFDPTHIKGVTFTEDPIPNYRALKEKFSSGYLSVPSVGAGTANT
FT                   EFEVITGMNLDFFGPGEYPYKTILQKTSCESISYNLKSLGYTTHAIHNNVATFYDRVSV
FT                   FSQLGFDTFTSIEYMQDIERNQNNWAKDKVLTPEILQILNTTKNQDLIYAISVQGHGSY
FT                   PDSALIENPRINLTLSEDLSDSLYYPLLYYSNQIKEMDEFIGELIESLSNRKEETILVM
FT                   YGDHLPGFQLEETDLTNGSLFQTEYIVWDNFGMTKQNEDLEAYQLSAHVLDLLDIHNGL
FT                   ITKLHQTQKDSDIYLDELKVLEYDMLYGDLDCFNGVNPYTKTDLQMGTVPIKISEAHFV
FT                   SAPPEGEATGDDSARVIVTGSNFTPFSKISVNDKIYDTKFINRSMISAPINELKSGDVI
FT                   TVIQSGNDNVPLSSTDSYVIP"
FT   gene            169161..169955
FT                   /locus_tag="Cphy_0126"
FT   CDS_pept        169161..169955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0126"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: cno:NT01CX_2290 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40515"
FT                   /db_xref="GOA:A9KR47"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR47"
FT                   /protein_id="ABX40515.1"
FT                   /translation="MPGEMDRKRNIKLIISYDGTNYSGWQRIPKAANGDHSIQGLLEEF
FT                   LSKVLLEPIKLIGSGRTDTGVHALGQVANFYSRSNLDVNIIRQKMNQVLPEDIKILQAN
FT                   EVDLNFHSRFDAVEKIYQYIIDTKERESVFFRKYSYSCGKDLDIEAMRQAAKLLIGTMD
FT                   YKSFCTDRKDGKSTIRTISEITIEELRQNRNQQGIIFTFRGNGFLHHMIRIISGTLLEV
FT                   GTQERSVESVRQAILGKKREYAGITLYPQGLFLKQVIYDKNS"
FT   gene            170160..170705
FT                   /locus_tag="Cphy_0127"
FT   CDS_pept        170160..170705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0127"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   stage V sporulation protein T; PFAM: SpoVT/AbrB domain
FT                   protein; KEGG: cpe:CPE2482 stage V sprulation protein T"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40516"
FT                   /db_xref="GOA:A9KR48"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR48"
FT                   /protein_id="ABX40516.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFTDREGEII
FT                   LKKYSPIGELGQFAKQYADSIGHTTGHIVAITDKDQFIAIAGSAKKDWVTKPISKELEA
FT                   LINDRETVTAAKEEKGFIRVCSDDEDIAYEVISPIICEGDAIGAVLILTRDVKTKLGEV
FT                   ENKLAATAAAFLGRQMEN"
FT   gene            170950..172281
FT                   /locus_tag="Cphy_0128"
FT   CDS_pept        170950..172281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0128"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   sak:SAK_1604 permease, amino acid-polyamine-organocation
FT                   (APC) family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40517"
FT                   /db_xref="GOA:A9KR49"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR49"
FT                   /protein_id="ABX40517.1"
FT                   /translation="MQEKRYGLLTAITMITGIVIGSGIFFKSDDVLRYTNGNMLLGILV
FT                   FLIAALAIVFGSLTISQLASRTDEPGGLISYAEKFVNKRTAGAIGWFQLTMYFAPLVGV
FT                   ITWVSGLYFCQLFGIESTPKNSSLIGFIILCMIFILNILSARLGGAFQNLSMIVKLIPL
FT                   ILIALAGLFFGKAPEIIAKDASVMKEAIASPGWVAAFAPIAFSFDGWSISTTICHEIKN
FT                   SKRNLPLALIFAPLIVLLCYVLYFVGITSLVSVDTVMQQGNESTYLAATKVFGNMGARL
FT                   ILVFVLISVVGTLNGLVLAYIQLPYSLAYRGMLPCSNALKKQSEKLNGIPINSAILAFV
FT                   LSSVWVFINYLTQNANMIGDVSEVPICLSYLMFIILYITVMKLKKQGEIKSIFMGYVAP
FT                   VLAIIGSLIIVTGTLSHPFFWIFAVLGAIVAACGFWYTKKFSVS"
FT   gene            172472..172795
FT                   /locus_tag="Cphy_0129"
FT   CDS_pept        172472..172795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0129"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: cth:Cthe_1854
FT                   methylated-DNA--protein-cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40518"
FT                   /db_xref="GOA:A9KR50"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR50"
FT                   /protein_id="ABX40518.1"
FT                   /translation="MEELTTFQRIYEVVKEIPYGKVATYGQVAALAGNRHLAKVVGYAL
FT                   HVNPNPVIIPCYRVVNAKGEVSKAFAFGGVNRQIELLEKEGVQFLEDGSVDMEVSRWAK
FT                   LVF"
FT   gene            172888..173892
FT                   /locus_tag="Cphy_0130"
FT   CDS_pept        172888..173892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0130"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: aha:AHA_2929 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40519"
FT                   /db_xref="GOA:A9KR51"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR51"
FT                   /protein_id="ABX40519.1"
FT                   /translation="MSKKKVLAIDGGGMKGIVSAVLLRSLEDRLQYHSNNYKARIADYF
FT                   DLIAGTSTGSILTALYLFPNERGESKFSAKEVLESYYEYGEYIFKRQKFYPFWGPKYTN
FT                   KYLEEMLLKYFGDATLGSLRKPCLMTSYDTTTRSAVFFNSVTGRKDENRNYLLRDAILA
FT                   STAAPTYFPPSCFHAKDNCYNCLIDGGVFANNPTLCALIEAMKLPGCDGIGDTICLSVG
FT                   NVKNTKSYTYQKVRRFGLLQWAVPIFDILMDASEQTVDYQLKKIYKSVNHQQYYYRMVL
FT                   NTEEEIPKMDDCSKEAVHKLTLYGEKLANREKYRIDELAKRLVMEKDNDNFVF"
FT   gene            174425..176359
FT                   /locus_tag="Cphy_0131"
FT   CDS_pept        174425..176359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY1218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40520"
FT                   /db_xref="GOA:A9KR52"
FT                   /db_xref="InterPro:IPR025584"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR52"
FT                   /protein_id="ABX40520.1"
FT                   /translation="MKNSHTIYLEISIILVAIFLFGCSNVSSNKSDYEGMAENQKQSSE
FT                   DNISKDILKNTGESLSAANMSGNLIEDGLSFESADYYKDYNERKVNYIQLNDSSIIFSG
FT                   EGAFVSDNKISISKPGTYVIFGTLKDGQIVVEETAGGMVHLILKNASIHCENSAPIYIK
FT                   EAGKVVISIAPGTKNMLTDDLANHDSKLSDPNATIYCTADLTLNGAGSLVINAAYQNAI
FT                   SSKGVLKVVEGDYDIHAVGHGIIGKEAVLIDDSRIKIDSGRDGIRTNNDTEDSKGLIFI
FT                   NRGEFVINSKQDGIQADKRLVIQNGSFQIITGGGSTGSVEKEDKEELLLNDLMEITEYD
FT                   NSMSAKGLKSGEDILIGNGSFTLDSADDTIYSDGNISIENGSFTIASGGDGMHADASLT
FT                   IAKAKIALTSSNYGMEGSKVEIKSGSLNIVSSEDGIHVSGNLNSNKDNGDKEEDTFIEE
FT                   KGILFLSGGNVMISAGGDGINSRGLATMTGGTLIIEGSPSNANGAIVFNGVFDISGGTL
FT                   LAIGSSGTTMAPSITSKQSSILLNLEETVEGETVLCLLEGEDRVPVMAYLPTKSYQSIV
FT                   YSSPLLLEGKSYTLSTGGDTTPKEGMNLYTPKTYEDGIDNANVTINGTVTTYGEVKAPI
FT                   KLPSEGIIE"
FT   sig_peptide     174425..174511
FT                   /locus_tag="Cphy_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.833) with cleavage site probability 0.519 at
FT                   residue 29"
FT   gene            176379..177092
FT                   /locus_tag="Cphy_0132"
FT   CDS_pept        176379..177092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0132"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; KEGG: chy:CHY_0204 tetrapyrrole
FT                   methylase family protein/MazG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40521"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR53"
FT                   /protein_id="ABX40521.1"
FT                   /translation="MKPEYDFEQFCDIIEKLRSENGCPWDREQTHDSLKNCMIEEAYEV
FT                   VDGINQFTKNGDYDNLREELGDVLLQVIMHSQIAKEAGRFTVEDVIDEIAKKMVRRHPH
FT                   VFGDVQVKDSEGVLTNWEEIKKEEKKGKAVESNPLYVPSSFPALLRAQKIVKKSNKFRN
FT                   TVYTKEELFSQMNSEATRLQALCHEGASIEKQEEAYGALLYTMSAIGLAFNMDAESCLT
FT                   EKIKEEISKLESKIG"
FT   gene            177506..177781
FT                   /locus_tag="Cphy_0133"
FT   CDS_pept        177506..177781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0133"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: tte:TTE2453 Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40522"
FT                   /db_xref="GOA:A9KR54"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR54"
FT                   /protein_id="ABX40522.1"
FT                   /translation="MNKAELVAAIAEKTELSKKDSEKALKAFIDVVTEELTKGEKVQLV
FT                   GFGTFEVSARPARTGRNPQTKQTITIAASKAPKFKAGKALKDVINK"
FT   gene            177952..178191
FT                   /locus_tag="Cphy_0134"
FT   CDS_pept        177952..178191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0134"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   cpf:CPF_2801 S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40523"
FT                   /db_xref="GOA:A9KR55"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR55"
FT                   /protein_id="ABX40523.1"
FT                   /translation="MRLDKYLKVSRLIKRRTVANDACDAGRVLINDKPAKASTNVKVGD
FT                   IIEIGFGSKAVRVEVLDVQETTRKDDAKELYKYL"
FT   gene            178292..178576
FT                   /locus_tag="Cphy_0135"
FT   CDS_pept        178292..178576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0135"
FT                   /product="sporulation protein YabP"
FT                   /note="TIGRFAM: sporulation protein YabP; PFAM: YabP family
FT                   protein; KEGG: cth:Cthe_2659 YabP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40524"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR56"
FT                   /protein_id="ABX40524.1"
FT                   /translation="MEDSKQVRKNQLNLNDRKEALITGVRDVRSFDDHEIILETDLGIL
FT                   MIRGSDLHMGRLTLEKGEVDVTGRMDSFVYSELKGFTKSGESVFKRLFK"
FT   gene            178585..179220
FT                   /locus_tag="Cphy_0136"
FT   CDS_pept        178585..179220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_0170 spore cortex biosynthesis
FT                   protein YabQ"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40525"
FT                   /db_xref="GOA:A9KR57"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR57"
FT                   /protein_id="ABX40525.1"
FT                   /translation="MLMNTSIFLELRYLAAASYWGIILFLIYDLLRILRNTFHHGKIVI
FT                   GIQDICFWIVAGILIFRMMYLQNDGMIRWYSTVAMVLSMVLYQKIFSPLIVGGGTKFTL
FT                   FIKNCILRLLKLLVSPIMFIISKIKKLFRFLFGKVRKFGRFLGGKVKKRTNIFKACIRK
FT                   QLKKHLNKVKIKKRKQVEEAPPPKVERPRGVLELITQPQEKGEVSEKE"
FT   gene            179261..179506
FT                   /locus_tag="Cphy_0137"
FT   CDS_pept        179261..179506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0137"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40526"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR58"
FT                   /protein_id="ABX40526.1"
FT                   /translation="MIICFVVLYKSTELKSEANAKVQKKAELEQLISDENDRTKEIEER
FT                   KLYPGTKKYIEDVARSQLGLVYPDEIIFEPEKENKK"
FT   gene            179651..179724
FT                   /locus_tag="Cphy_R0020"
FT                   /note="tRNA-Met2"
FT   tRNA            179651..179724
FT                   /locus_tag="Cphy_R0020"
FT                   /product="tRNA-Met"
FT   gene            180381..181964
FT                   /locus_tag="Cphy_0138"
FT   CDS_pept        180381..181964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0138"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: cth:Cthe_2681 serine phosphatase; PFAM: Stage
FT                   II sporulation E family protein; SMART: protein phosphatase
FT                   2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40527"
FT                   /db_xref="GOA:A9KR59"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR59"
FT                   /protein_id="ABX40527.1"
FT                   /translation="MKKRRSWLLPLAGVVVALVTFFNASPNVVARYLIIATIVIILIGI
FT                   AAVIVGLLQGSGSVDNGESYVKDEFQNTARKKLEGISGSIHKLASSFDYMASPKTVLNT
FT                   EDMQLVLEDISTNLCKNCKKCGVCWERNFNQSYQATWNLLETAKGKGNVTVDDMPDMLR
FT                   LQCIQVPEFVEEANRNLSMARLKMVWHNRIVESREAVAGQLGEIARIVKDFSGNLCDTG
FT                   EVIELKRRKINQKLRVHRIKVQRVLMFERENRGMELHLRARCKNGRCLTTKEAAILIGN
FT                   ALERRFVPREDSRNVIGREYDDYVFCEDANFKVLTGVSRASKKKGELNGDNFSFLYPDS
FT                   QDVVMMLSDGMGSGSEAYEESEMVIELLEQFLEAGFREEPAIKLINSVLVLRTENCMSS
FT                   TVDLCVVNLCAGTCEFVKIGAATTFIKRDHFVETISSNSMPAGILNRVDYDTKSKKLYD
FT                   GDYVIMVSDGVIDCVEEEDKEGYFINFIKNIPFKSPQEIANAILSAALEKHGYVPADDM
FT                   TVLVTGIWKK"
FT   sig_peptide     180381..180473
FT                   /locus_tag="Cphy_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.865 at
FT                   residue 31"
FT   gene            182200..183678
FT                   /locus_tag="Cphy_0139"
FT   CDS_pept        182200..183678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0139"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: ckl:CKL_0170 TilS"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40528"
FT                   /db_xref="GOA:A9KR60"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR60"
FT                   /protein_id="ABX40528.1"
FT                   /translation="MLKKVENFIKDQGMLSPFDTVIVGVSGGADSICLLTCLHRLREQY
FT                   HLNLYAVHVNHMLRGMEADEDEAFVQSMCNSLSIPLHCVREDVKRIAELSGTTIEEAGR
FT                   NLRYLSFEQECERVKAHKIAVAHNRNDNAETVLFHLFRGTGLTGMTGIPKKRGQIIRPL
FT                   LCVTREEIETFLFNEHIFYRIDSTNLSNDYTRNKIRLSILPIATNEINERAVEHITSLS
FT                   DQLLEVANYLDQVTEREFKRIATLSQESVTLDLREFTAIEDLIKREILRKAIKLISGLK
FT                   DIESIHLVDGVNLCKCQVGKEIHLPNHIIVKRGYNTIIVFDSLKHSDKNDMIRNNQLDE
FT                   IPLTIKKEDSVTNLCCHPNSQDCDGMEIFMKNGTVQLVDFLGKRLEIRVFPYENSLTIP
FT                   KNSYTKWYDYDKIRNAVVIRTRREGDFLMIHPQGKTKSLKSLLVDQKIPREERDKIPLV
FT                   TCDSHVLWAVGVRSSEAYRIDKDTNWVLSITTDR"
FT   gene            183710..184234
FT                   /locus_tag="Cphy_0140"
FT   CDS_pept        183710..184234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0140"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: tte:TTE2394 hypoxanthine-guanine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40529"
FT                   /db_xref="GOA:A9KR61"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR61"
FT                   /protein_id="ABX40529.1"
FT                   /translation="MAENIKVLISEEEISKKIKELGEEISKEYAGKTLHLICVLKGGVF
FT                   FMTELSKHITIPVTIDFMSVSSYGDSTVSSGRVRILKDLDESIDGRDVLVVEDIIDSGR
FT                   TLAYLLDLLKNRQPNSLKLCTLLDKPSRREVDVNVDYTGFQIPDDFVVGYGLDYAQIYR
FT                   NLPYIGVVQSE"
FT   gene            184253..186082
FT                   /locus_tag="Cphy_0141"
FT   CDS_pept        184253..186082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0141"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: csc:Csac_1210 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase central domain protein; peptidase
FT                   M41 FtsH extracellular; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40530"
FT                   /db_xref="GOA:A9KR62"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR62"
FT                   /protein_id="ABX40530.1"
FT                   /translation="MKKSMRGYGFYVIILLIIVSAVYLSESFASNSSVKHSYADYIADL
FT                   QSGSVASVDIFQNQEAPTGRVKVNLSDGKNYTIYITSAATAEADAAANGVASYVHDIEK
FT                   PSWFLTSVLPYLIGFVIIILMFSFLTSQVNGGGGGNNKVMNFGKSRAKMTMDEGKNTTF
FT                   KNVAGLAEEKEELKEIVDFLKNPKKFIQVGARIPKGVLLEGPPGTGKTLLAKAVAGEAG
FT                   VPFFSISGSDFVEMFVGVGASRVRDLFSEAKKNNPCIIFIDEIDAVARRRGTGMGGGHD
FT                   EREQTLNQLLVEMDGFGANEGIIVMAATNRVDILDPAILRPGRFDRKVLVGRPDVKGRE
FT                   EILAVHAKNKPLGDDVDLKQVAQTTAGFTGADLENLLNEAAISAAKDDRSFILGEDIKK
FT                   SFIKVGIGTEKKSRVISDKEKKITAYHEAGHAILFHVLPDVGPVYTVSIIPTGGAAGYT
FT                   MPLPEKDEMFNTRGKMRQDIIVSLGGRIAEELIFDDITTGASQDIKVATKTARSMVTRY
FT                   GFTDSIGMVNYENDDEEVFIGRDLAHTKNMSEAVASKIDEEVKKIIDDCYKEAKRILTE
FT                   NMHVLHSCADRLIEKERITREEFESLFEVPEVV"
FT   sig_peptide     184253..184342
FT                   /locus_tag="Cphy_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.733) with cleavage site probability 0.476 at
FT                   residue 30"
FT   gene            186300..186788
FT                   /locus_tag="Cphy_0142"
FT   CDS_pept        186300..186788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0142"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cbh:CLC_1033 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40531"
FT                   /db_xref="GOA:A9KR63"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR63"
FT                   /protein_id="ABX40531.1"
FT                   /translation="MENNIKIQLRPYQTSDCKEMSELFYQTVHNVTVKDYSLEQRMAWA
FT                   NGNVNLMVWDESFQSHYTLVATDGTLVLGFSDIDATGYLDRLYVHKDYQGIGIATMLCD
FT                   ALEAYYFSNGSEKITTHASITAKPFFHKRGYQIVKEQQVIRGGISLTNYVMALEKENF"
FT   gene            187268..187349
FT                   /locus_tag="Cphy_R0021"
FT                   /note="tRNA-Tyr2"
FT   tRNA            187268..187349
FT                   /locus_tag="Cphy_R0021"
FT                   /product="tRNA-Tyr"
FT   gene            187354..187439
FT                   /locus_tag="Cphy_R0022"
FT                   /note="tRNA-Leu1"
FT   tRNA            187354..187439
FT                   /locus_tag="Cphy_R0022"
FT                   /product="tRNA-Leu"
FT   gene            187556..187626
FT                   /locus_tag="Cphy_R0023"
FT                   /note="tRNA-Gly1"
FT   tRNA            187556..187626
FT                   /locus_tag="Cphy_R0023"
FT                   /product="tRNA-Gly"
FT   gene            187663..189414
FT                   /locus_tag="Cphy_0143"
FT   CDS_pept        187663..189414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0143"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: ctc:CTC00992 magnesium-protoporphyrin IX monomethyl
FT                   ester oxidative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40532"
FT                   /db_xref="GOA:A9KR64"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025288"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR64"
FT                   /protein_id="ABX40532.1"
FT                   /translation="MKILLTAINAKYIHSNPAIYYLKSYAKEYRDHIELAEYTINQYTD
FT                   DILQSIYKKRPTMLAFSCYIWNISMVEEVIREYRKLDASVKIWVGGPEVSYDPEECLKR
FT                   LPEIDGVMIGEGEATFTELASYYSSTQSNIIEDARKTLSDISGIAYRKEDGEIIKTRDR
FT                   KPMDFSRLPFLYKEAMELSEFANRIIYYETSRGCPFSCSYCLSSIDKRVRFRDLDLVYQ
FT                   ELGLFLDKKVAQVKFIDRTFNCKKSHAMGIWQFIKEHDNGVTNFHFEIAADILDEEQLS
FT                   LLETLRPGLIQLEIGVQSTNDTTIDAINRRMDLKMVSENVARIKKADNIHQHLDLIAGL
FT                   PFEDYTSFGNSFNDVYAMKPDQLQLGFLKVLKGSYMEEVSKEYGIIYKAKPPYEVLYTK
FT                   WLPYDDVIRLKGVEEMAEVYYNSGQFKETLAFLEHFIESPFHFYEDLAKFYETSGLFGL
FT                   NHNRIRRYEILLEFLIERFDSNIVSVAKQMMIFDLYKRERLKTRPSFAPYPEEYKKIFK
FT                   AYMTSQGTNKKGEQIHLEHFDYDIIEAASTGNIVKKDLFIKFDYQKKTILHGEAEFTIL
FT                   TQKEIEI"
FT   gene            189479..190168
FT                   /locus_tag="Cphy_0144"
FT   CDS_pept        189479..190168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0144"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: cth:Cthe_1283 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: helix-hairpin-helix motif; HhH-GPD
FT                   family protein; SMART: iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40533"
FT                   /db_xref="GOA:A9KR65"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR65"
FT                   /protein_id="ABX40533.1"
FT                   /translation="MAREDEIKKKRLSKAEKERIDAILALLDEHYSTEYKCYLNHETPW
FT                   QLLIATILSAQCTDERVNIVTKDLFVKYKSVEDFANADLSELEKDIHSTGFYRNKAKNI
FT                   IACCQTLLREYHGEVPNDIDALTNLAGVGRKTANVIRGNIFHEPSIVVDTHVKRISKKL
FT                   GFTKEDDPVKVEYDLMKILPREHWILYNIQIITHGRGLCTARSPQCDRCFLSHLCKENM
FT                   KNIRVRK"
FT   gene            190232..190939
FT                   /locus_tag="Cphy_0145"
FT   CDS_pept        190232..190939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0145"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: cth:Cthe_0996 DNA polymerase III, alpha
FT                   subunit; TIGRFAM: DNA polymerase III, epsilon subunit;
FT                   PFAM: Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40534"
FT                   /db_xref="GOA:A9KR66"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR66"
FT                   /protein_id="ABX40534.1"
FT                   /translation="MNFLAIDIESTGLSPEKDRIIEIAAIRYIDGKPKERFEKLINPGC
FT                   PLPERITELTGITEDMLAGAMTEREVIKEFLTFAGEDVLLGHNVSVDFSFIKTAADRLK
FT                   IGYERQGIDTLYLSRTLKSDLEKKNLESMCEHYGIIRECSHRALEDAIAAATLYQKLYE
FT                   EFNNNFEALFLPVELKYKVKKQEPMTEKQKKYLLDLVNYHKIEVPSGFTDFSKSKASRF
FT                   IDKTILHYGRMKK"
FT   gene            complement(190986..191600)
FT                   /locus_tag="Cphy_0146"
FT   CDS_pept        complement(190986..191600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40535"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR67"
FT                   /protein_id="ABX40535.1"
FT                   /translation="MPIILGIIIILGAWIAFQKRKSERGSKKDSKAFWEKENQSNLVRK
FT                   KDLSTLPYITIPYDSLSLKETSDAELAHIQKQLYELREQKIVNLSHITNTELKLEYGTA
FT                   NLNLLSSYDQNFTILIRLLNKWATLLYESGEKQQAVDVLEFALSIGSDISNSYTLLAKL
FT                   YLEFDRKEEISSLITRAKDVQTILKDSILDQLYEMYGKEDV"
FT   gene            191877..192836
FT                   /locus_tag="Cphy_0147"
FT   CDS_pept        191877..192836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0147"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; KEGG: csc:Csac_1552 VanW
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40536"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR68"
FT                   /protein_id="ABX40536.1"
FT                   /translation="MKMKQNVLMTVLLCLMVIICVGCNNEAPPKEQDHSLDGALLDVTP
FT                   SISPESVTATPNADFISEEGKETITENTTPLKPGNVEIDANAILGQFTTHFYNSSKARK
FT                   NNIVNAAKKIHLKVVNPGEVFSTVGAISPITKDNGYDDAGTYQDGRVVNAIGGGVCQVS
FT                   TTLYNAVLGAELKVTERHPHSMTVSYVELGRDAAIAGDYMDFCFQNTLETPIVIEAIAD
FT                   PAGSITVRIRGVETRDKSKRKVSYESVILETIEPGPAVITYDKNQPKNYLKVTQSAHSG
FT                   YKVELYRLIYYQGELIDRILLNTSTYEAAPQYLTIGIK"
FT   sig_peptide     191877..191954
FT                   /locus_tag="Cphy_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.691 at
FT                   residue 26"
FT   gene            193050..194048
FT                   /locus_tag="Cphy_0148"
FT   CDS_pept        193050..194048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0148"
FT                   /product="AIR synthase related protein domain protein"
FT                   /note="PFAM: AIR synthase related protein domain protein;
FT                   KEGG: tte:TTE1537 hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40537"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR69"
FT                   /protein_id="ABX40537.1"
FT                   /translation="MKTGKVSEVILKRSVLKFLGTKQRNTPVISLDAGKIEFDESTDLL
FT                   FATASMQGNQFGLIESVFHRAVNNIYAKGGKPIAVSTSLTLRSHADEQELKLYSKELNR
FT                   LSTLYSIPVLSGETMVGAGATQNTITIHATGKVNKQSNTMDKKQESIEDSAKEYQIVMS
FT                   KYIGLSATKLLIESRKEKLKERLTESFLAGGKKIGELLSIQKEMEVSTDFDILCSHDVS
FT                   EGGIFAALWEVGESLQCGMEVSLDSILLIQETIEVCETLDLNPYLLYSGGCVLFVTKQG
FT                   EALVEKLNNEGIPASVIGKTTNSPDRIVRKEDEIRYLEPFKGDEIYKGLSE"
FT   gene            194082..194564
FT                   /locus_tag="Cphy_0149"
FT   CDS_pept        194082..194564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0149"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   csc:Csac_1961 putative transcriptional regulator, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40538"
FT                   /db_xref="GOA:A9KR70"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR70"
FT                   /protein_id="ABX40538.1"
FT                   /translation="MREKILKAIDKNSKLTAKELAVMLGAEEAAVAATIKELEAESIIC
FT                   GYPTLINWDKTESEKVTALIEVKVTPQRGQGFDRIAERIYKFEEVESVYLMSGGFDLTV
FT                   IIDGKSMREVANFVSSKLAPMEAVLSTATHFVLKKYKEHGMPLVHEVEDERMLITP"
FT   gene            194561..195721
FT                   /locus_tag="Cphy_0150"
FT   CDS_pept        194561..195721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0150"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   cth:Cthe_0363 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40539"
FT                   /db_xref="GOA:A9KR71"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR71"
FT                   /protein_id="ABX40539.1"
FT                   /translation="MRNPLNNKVVNIQPSGIRKFFDIVSEMKDAISLGVGEPDFDTPWH
FT                   IREEGIYSLEKGKTFYTSNSGLVELRKEICNYLYRRCNLTYDYRHDVLVTVGGSEAIDA
FT                   ALRAMIDEGDEVLIPQPSYVSYLPCVLLADGKPVIIELKHENNFKLTKQELLDSITDKT
FT                   KILVLPFPNNPTGAIMTEEELKEIAEVIIEKDLFVLSDEIYSELTYGTKHVSIASLPGM
FT                   KERTIVINGFSKSYAMTGWRLGYAAGPKEIIEQMTKIHQFAIMCAPTTSQYAAVEALRA
FT                   GDPDVEMMRDDYDKRRRYVVNALQEMGLECFEPFGAFYVFPCIKSLGMTSDEFANALLQ
FT                   EEKVAVVPGTAFGDCGEGFLRISYAYSIENLKEALGRMARFVKKHR"
FT   gene            195976..196446
FT                   /locus_tag="Cphy_0151"
FT   CDS_pept        195976..196446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0151"
FT                   /product="CheC domain protein"
FT                   /note="PFAM: CheC domain protein; KEGG: csc:Csac_1295 CheC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40540"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR72"
FT                   /protein_id="ABX40540.1"
FT                   /translation="MAVISADYINPFLIAATKVLKDMVMIDTKVGKPYTKEAVIADQAL
FT                   LIMLGVTGEMSGQVILSFEDKVALDIASKMCMMTLNELDELSKSAICELCNMILGNTAT
FT                   VFSTKGIEVDITPPTMCTGTVKFTNNFAANICIPLIYEDGKTIEINVAIKEK"
FT   gene            196601..197101
FT                   /locus_tag="Cphy_0152"
FT   CDS_pept        196601..197101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0152"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   cth:Cthe_0127 RNA methyltransferase, TrmH family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40541"
FT                   /db_xref="GOA:A9KR73"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR73"
FT                   /protein_id="ABX40541.1"
FT                   /translation="MNIILFEPEIPANTGNIGRTCVATGTKLHLIEPLGFRLDEKEIKR
FT                   AGLDYWKDLDVTVYENYDDFLRRNPNAKIYMATTKARHVYTEVSYEPDCFIMFGKESAG
FT                   IPEEILLENKETSIRIPMIGDIRSLNLSNSVAIVLYEALRQQNFDHMRLLGNLHHHSWE
FT                   EAK"
FT   gene            197521..199911
FT                   /locus_tag="Cphy_0153"
FT   CDS_pept        197521..199911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0153"
FT                   /product="MutS2 family protein"
FT                   /note="KEGG: cth:Cthe_1014 MutS2 family protein; TIGRFAM:
FT                   MutS2 family protein; PFAM: DNA mismatch repair protein
FT                   MutS domain protein; Smr protein/MutS2; SMART: MutS III
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40542"
FT                   /db_xref="GOA:A9KR74"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KR74"
FT                   /protein_id="ABX40542.1"
FT                   /translation="MNEKALRTLEYHKIIEKLSALAGSSLGREKCHQLLPLVKLEDIVQ
FT                   MQQETTDALTRLYAKGTLSFSGIPDIRDTLMRLEIGASLGAGELLKISSVLTATLRAKN
FT                   YGYNQKNNEETEEAAQDTLTERFHLLEPLSPINNEIRRCIISEEEIADDASPGLKSVRR
FT                   QIKITNDKIHESLGSILNSASTKGMLQDAIITMRNGRYCLPIKQEYKNTFQGMMHDQSS
FT                   TGSTAFIEPMAIVKLNNELAELAVREQEEIEKILAELSNLVATEKYNLKYNQTTLAELD
FT                   FIFARAGLSKNMKASQPHFNNRHYINIKKGRHPLIDPKKVVPIDIYFGDKFDLLVITGP
FT                   NTGGKTVSLKTVGLFTLMGQAGLHIPAFDGSELSIFEEVYADIGDEQSIEQSLSTFSSH
FT                   MTNTVSILEHANENSLVLFDELGAGTDPTEGAALAMAILSYLHQRKIRTMATTHYSELK
FT                   IFALSTDGVSNACCEFSVETLQPTYRLLIGIPGKSNAFAISSKLGLSNYIIEKAREFIG
FT                   TKDESFEDVISNLEASRIAMEKDKAEAEQYKKEVEELKRKLAEKNSKIDDAKDRILREA
FT                   NEKARTILQEAKDYADETIRKYNKWGAGGANNKEMENERAALREKLGDTDSSLVSKAKK
FT                   NRKQHKPSDFKVGDSVHVISLNLKGSVSTLPNAKGDLYVQMGILRSLVNISDLELIDEE
FT                   TIVAKALTKTQSGKIRMSKSMSISPELNIIGKRVDEALPLVDKYLDDAYLAHLPQVTII
FT                   HGRGTGALKEAVHAHLKRTNYVKGYRVGGFGEGDHGVTIVEFK"
FT   gene            199945..200661
FT                   /locus_tag="Cphy_0154"
FT   CDS_pept        199945..200661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0154"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cth:Cthe_1288 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40543"
FT                   /db_xref="GOA:A9KR75"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR75"
FT                   /protein_id="ABX40543.1"
FT                   /translation="MATKQKILIVDDDANIAELISLYLMKECFDTKIVYDGEEAITQYR
FT                   EYQPNLILLDLMLPGIDGYEVCREVRKTSTIPIIMLSAKGEIFDKVLGLELGADDYMIK
FT                   PFDTKELVARVKAVLRRVVPSQSTSEQVITQELGDFVSYPDLIINQSNYSVTYFGDSIE
FT                   MPPKELELFYFLASHPNQVFTREQLLDHIWGYEYIGDTRTVDVHIKRLREKIKDHISWR
FT                   LSTVWGIGYKFEVKKN"
FT   gene            200702..202090
FT                   /locus_tag="Cphy_0155"
FT   CDS_pept        200702..202090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0155"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: tte:TTE2569 sensory
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40544"
FT                   /db_xref="GOA:A9KR76"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR76"
FT                   /protein_id="ABX40544.1"
FT                   /translation="MKRTAFVKLILCYCFAAISMFLLLNTFGVKFMEQKLMDRKKDELY
FT                   KEATIIVSDYATKLSHSDMEEQMRVIDKFLGTRIWIVSEAGIVVADTRSNANRMNITNM
FT                   DVNFLEQTFSENVYFKGIFSEPMLSVVVRIPYNYSIKGYVCIHIPMDSIRSESIYYTDL
FT                   VSVCYLVFLIILFLIFMIIYYITVFPVRRITKVCSEYAKGNFDERMEIRTNDEYRELAN
FT                   SVKYMADELKNLDDYQKKFVANISHDFRSPLTSIGGYAEAMRDGTIPYEMQNKYLDIIL
FT                   FETERLTKLTTNLLALNSFENKGTLLDISSFDINAVIRKTAATFEGQCTKKRIVFKLEF
FT                   SAKETFVDADIDKIQQVLYNLIDNAIKFSNVDSTIKVTTEEKGSKVLISVKDHGIGIPK
FT                   DSIKKIWERFYKTDSSRGKDKKGTGLGLSITKEIITSHNENINVVSTEGVGTEFIFSLK
FT                   KTDY"
FT   sig_peptide     200702..200776
FT                   /locus_tag="Cphy_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.504 at
FT                   residue 25"
FT   gene            202257..203633
FT                   /locus_tag="Cphy_0156"
FT   CDS_pept        202257..203633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0156"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="PFAM: PDZ/DHR/GLGF domain protein; KEGG:
FT                   ckl:CKL_2696 predicted protease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40545"
FT                   /db_xref="GOA:A9KR77"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR77"
FT                   /protein_id="ABX40545.1"
FT                   /translation="METKTPEPEKEFRFIQEKVVPRRKHRVKKMAYATAFAVALAIIFG
FT                   LVARYVFIKSDHFWIKVLGIDTTKREPITFPSEGQEDPNGVDGTGENVTITPSISTTPE
FT                   PTVSVTGAPSEGNGDQETVVEKKIEATIEDYERMLFELRKVGTTAMSGLAMVTAIENRV
FT                   DWFDETYETKRTTTGIVIGENSAEILILTSLDKINGASDLEVTFNSGFTASGLTVPGKL
FT                   WSFDKDYNLAVIAVKLKDIPPQQVSSIKTAKLGESHSVTLGTPVIALGKPDGYFGSMMF
FT                   GMISSRGDYYYIMDNRLDVFHTDLNVNSNSDGVIINTNGEIIGIMTQAMKDPANPNVST
FT                   VIGISRLTSIMDKLANKTERVTFGIIGEDIPSDVLQSFNLSGGIYVTEVRSDSPAFNAG
FT                   IKQGDIITQVNEFSISSVTNFNTILNNYKPKETVTVVVQRKVKQELSESSVKVVLELKE
FT                   "
FT   gene            complement(203748..204632)
FT                   /locus_tag="Cphy_0157"
FT   CDS_pept        complement(203748..204632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0157"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cbh:CLC_0312 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40546"
FT                   /db_xref="GOA:A9KR78"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR78"
FT                   /protein_id="ABX40546.1"
FT                   /translation="MEYKVNFQNDTTLRNSFHALTQKVFHFQLGDWYENGYWSESYEPH
FT                   SMIDGNTVVANISVNHMTTTLDGVKKHFLQLGTVMTDPAYRNQGLSRQLMVSILEKYLG
FT                   KVDGIYLFANDSVLEFYPKFGFTKSNEYVYRYHVNSSELKNNLDCKDFEPQKVDITDPN
FT                   QREFLIEAAKQSVPNEAFSMDNFGLMAFCLTGPYSNNIYYLPKLDAYIVATIHEKILFL
FT                   QQIIASKIIEPKDIALFYSDKIETIELGFTPFHTSLYEVSTYHEEDSTLFILGEELLAI
FT                   ERLKLHFQDLSHA"
FT   gene            204918..205865
FT                   /locus_tag="Cphy_0158"
FT   CDS_pept        204918..205865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0158"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: sat:SYN_02192 HD-superfamily hydrolase;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40547"
FT                   /db_xref="GOA:A9KR79"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR79"
FT                   /protein_id="ABX40547.1"
FT                   /translation="MRYLGELRDGEMFKETYLCKQLQILKTKAGKSYYSMLIQDKTGIK
FT                   DAKVWELGPGIEHFDTMDYIHIEGQVTCFQGSLQLNVKRVRKCQEGEYDPADYMPSTDK
FT                   NVEDMYKELLRYVDKIKEPHVKKLAQSFFVEDKDFALRFKRHSAAKSVHHGFMGGLLEH
FT                   TLGVVRLCDYLADQYPLIQRDLLLVSAMFHDLGKLDEISSFPENDYTDEGNLLGHIFIG
FT                   TAKLNERMKTIPGFPKKMASEIMHCILAHHGELEYGSPKKPALMEALALSMADNLDAKL
FT                   QTMKEILTGEEDKNDWLGFQRLFESNVRRTSDYE"
FT   gene            206112..207518
FT                   /locus_tag="Cphy_0159"
FT   CDS_pept        206112..207518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0159"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM;
FT                   (Uracil-5)-methyltransferase; KEGG: amt:Amet_4060 RNA
FT                   methyltransferase, TrmA family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40548"
FT                   /db_xref="GOA:A9KR80"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR80"
FT                   /protein_id="ABX40548.1"
FT                   /translation="MEQVKIPGKNEVVPITIEDIGADGEGIGKVHGFTLFVKDAVVGDE
FT                   LLVKVMKTKKTYGYARIEQIVTPSPYRVNPRCEIASKCGGCQIQQLSYEEQLRYKQNKV
FT                   LNCLKRIGGIENPPMEPIVGMENPYYYRNKAQFPVGKRTDGEVVIGFYAGRTHSIIDTA
FT                   KCHIGDESTEPLIACIRNFLKQENISIYDEESHQGLVRHILLRVGFTTKELMICVVING
FT                   KELPASDKLIKQILACPNLPKDFRVTSICLNKNTKKTNVILGEEIIPLYGPTYITDYIG
FT                   DIKYQISPLSFYQVNPVQTKKLYELALDYTDLTGNELVWDLYCGIGTISLFLAQKAKMV
FT                   YGVEIIPQAIEDAKSNAKLNDINNAEFFVGAAEEVLPKQYQLSGGKIYADVIVVDPPRK
FT                   GCDESLLETIVAMEPKRIVYVSCDPATLARDLKYLIEHGYDLKKVRPVDQFPHSVHVES
FT                   VTLLTRRNEL"
FT   gene            207721..208305
FT                   /locus_tag="Cphy_0160"
FT   CDS_pept        207721..208305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0160"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: cth:Cthe_1389 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40549"
FT                   /db_xref="GOA:A9KR81"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR81"
FT                   /protein_id="ABX40549.1"
FT                   /translation="MTYSVDRENLNNILVSSKDIKEYKDEILRIVPELIICVDCEQNMP
FT                   AHIYNVFDHILETVNKVDSNLILKIAALLHDIGKPYRKTVIDNVDSFKGHEEASEIIAN
FT                   LILTRLGYEEVFKNKICRLIKYHDYYITPTVEGVKEAVDLIGDELMPYLFCFQKADLLA
FT                   HSEQRYKPRLPKLNEANVIYESCIRESCGIK"
FT   gene            208327..208629
FT                   /locus_tag="Cphy_0161"
FT   CDS_pept        208327..208629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0161"
FT                   /product="YkgB"
FT                   /note="KEGG: bld:BLi04142 YkgB"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40550"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR82"
FT                   /protein_id="ABX40550.1"
FT                   /translation="MRVESGHFGDILHQEIQQEGAAALTRVHCVLLNRKEDRLVAVNIA
FT                   LDHIFIYAVNQGYLTLERIIKAPEGSGPRHALFSENESYLYVITEYSNEIKEKAY"
FT   gene            208651..209175
FT                   /locus_tag="Cphy_0162"
FT   CDS_pept        208651..209175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY1015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40551"
FT                   /db_xref="GOA:A9KR83"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR83"
FT                   /protein_id="ABX40551.1"
FT                   /translation="MEGNFKGRKKNALNLKTPSAWIIVAATVFVLIFSIVFATNRANEG
FT                   IGDHDFYNFNVNGFTLGADIDKMDTSALTPTEPLNINNGYDYNFEEVRYSADENTGRLK
FT                   KMFVNVYDGAYIPVVTIHTGEAASYIPNNLTTIEQITTIFGQGKKGWQDREQGLRYMEY
FT                   RQKEGRLSATE"
FT   sig_peptide     208651..208767
FT                   /locus_tag="Cphy_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.884 at
FT                   residue 39"
FT   gene            209338..209613
FT                   /locus_tag="Cphy_0163"
FT   CDS_pept        209338..209613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0163"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="KEGG: cbe:Cbei_2447 GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40552"
FT                   /db_xref="GOA:A9KR84"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR84"
FT                   /protein_id="ABX40552.1"
FT                   /translation="MLEIKKGTKSFYIGDSEENPLAIMTYIFSGENLIIVDHTYVSDEL
FT                   KGQGIGKLLLKELVDWVRKENKKIIPQCSYVKAQLEKNKEYHDILN"
FT   gene            209694..210575
FT                   /locus_tag="Cphy_0164"
FT   CDS_pept        209694..210575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0164"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   cdf:CD1802 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40553"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR85"
FT                   /protein_id="ABX40553.1"
FT                   /translation="MYELIQVGEKTYYINCPAKIGIYRINESDVCLIDSGNDKEAGKKV
FT                   QKILEAHHWKLSMIINTHSHADHIGGNSLLQQRLECPAYSAGIDKSFIQNPVLEPSFLY
FT                   GGYPCKELRNKFLMAQASTISELTEEVLPEGLEMIRLDGHSFSMVGLKTSDDVWFLADC
FT                   LTSSNIIKKYHVSFLYDVNKYLETLVKVENLQGKLFIPAHAEPTDNIKELVDINRNKIF
FT                   EIIELIKKTCKEPKCFEDILKNIFDNFQLTMDFTQYVLVGSTVRSYLSYLHDKGELEVE
FT                   FKDNKLLWLAGS"
FT   gene            210894..211790
FT                   /locus_tag="Cphy_0165"
FT   CDS_pept        210894..211790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0165"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; transcription activator effector binding; KEGG:
FT                   ctc:CTC01432 transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40554"
FT                   /db_xref="GOA:A9KR86"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR86"
FT                   /protein_id="ABX40554.1"
FT                   /translation="MEVLLNYREDIETCVEYIEEHIKENITMEEVASQIGYSLYHFSRV
FT                   FSLCKGISVMEYIRNRRLSLAATQLFQGRKIIDIAFDYEFETPSGFANSFRNAFGYSPT
FT                   QFMKRMAGYAETKTTVEIGGYIMNPAIVKRPEFMVAGYGIKTNITGDAYTKDVASFWSN
FT                   YDGENLESKMYKILNPKKHGEVGLCVPLSEDGNAIYLLGVIVEDFSKVEEDMLTVVVPE
FT                   AVYAVFTTPPVDTTKDMEQKEFAKIIASTWKYIFEEWFKDSGYVYDESKLDFEYYDERC
FT                   HHRQDTVMDIYVPVKVK"
FT   gene            211950..212563
FT                   /pseudo
FT                   /locus_tag="Cphy_0166"
FT                   /note="transcriptional regulator, AraC family"
FT   gene            212694..213392
FT                   /locus_tag="Cphy_0168"
FT   CDS_pept        212694..213392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0168"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   amt:Amet_3922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40555"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR87"
FT                   /protein_id="ABX40555.1"
FT                   /translation="MEKHLKATLLLDYRDKSIQELIRMKNWDQSNEFDKILQTYNYVRD
FT                   EIKFGYNVDDAIPASKVLADGYGQCNTKLILFMALLRALNIPCRVHGFSIDKELQKGAL
FT                   PTYLYKFAPKNIIHSWVEVYYMGKWYNLEGIIIDSQYLLKLQEKFPDCKGRFCGYGVSV
FT                   DNFKNPVIDWSGNDTYIQKESINEDYGTFDNPDALFSNYPQKLSLLKRFLYRHFGRHIM
FT                   NRRVDKIRNL"
FT   gene            complement(213494..213919)
FT                   /locus_tag="Cphy_0169"
FT   CDS_pept        complement(213494..213919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0169"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bay:RBAM_012510 Xre"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40556"
FT                   /db_xref="GOA:A9KR88"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR88"
FT                   /protein_id="ABX40556.1"
FT                   /translation="MNNELIAKRLKELRKSFEYTQEFVASYLNIGRQAYSHYETGRNAP
FT                   TTDTLYKLASLYHIPVNDLLKLLSPHPQETYTTPESNNIASNMLSDFLDYLGNPDNEKK
FT                   LKMLNRKEKELLFCFEKISTKDQDDILEFIKIKARKK"
FT   gene            214132..214602
FT                   /locus_tag="Cphy_0170"
FT   CDS_pept        214132..214602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0170"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: cpr:CPR_2111
FT                   DNA repair protein, RadC family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40557"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR89"
FT                   /protein_id="ABX40557.1"
FT                   /translation="MKINVYNTMLNEETRHNELKIEKSIICEDNNKLESPSEIQKLMKE
FT                   QFQIHKKAEEYVYLVSLDMKCNPLGIFELSHGTVNSSLIMPREIFIRALLSGAVGIIIV
FT                   HNHPSSDITPSKQDLLVTEKIAQAGNMIGVELLDHIIIGGNEYCSLKEMGVL"
FT   gene            complement(214786..216945)
FT                   /locus_tag="Cphy_0171"
FT   CDS_pept        complement(214786..216945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0171"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   GGDEF domain containing protein; KEGG: cbe:Cbei_3076
FT                   diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40558"
FT                   /db_xref="GOA:A9KR90"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR018771"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR90"
FT                   /protein_id="ABX40558.1"
FT                   /translation="MKRQQLNIHQILDIFYKSTGIEAIFFDTELNLIMHRASEKLTTYY
FT                   PFLGISEVMAYLADRFSEQPGTNSAFYTYVLPNNFLCNIAFLTQENSYIGAFLTEPVLL
FT                   KKLNKSDLDKVLNRSELSNQDKKTFENILFKVPVIPYINILPIGTVLYQLSKTYSENMP
FT                   QQIIIEHKARTSALNHNSNKKQNIVITSSVKYTPFSTYLQIIEIIKSGDVVRLRSAMNE
FT                   ISVGEILMNQSNDSDIMRSIKNSFIKTCSMGCYAAIDANASYEKVMDISDDYISKIETN
FT                   DNINDIIALLKEVMISYTKAVAMNRNTIYSKPIRQVMEYIQCHYDEKITLEKLSEYTEL
FT                   STFYLSNLIKKETDLSLPDIVNKVRIEKSKPLLLNMNISILDVAQRVGFNYQNHFASIF
FT                   KKYTDLTPTEYRKTMSYKQNTNSSEFENSLINVVEQINNKISMFSHLFDAARIVDPIRH
FT                   KSMFIKTSDTVFPEETCYHFWYRSESCQNCISMKSYLHNDTFFKIEHRDNDTFLMIATP
FT                   KTVGKDTYIVEIMKDVTKQLSINIKAESPENPTLVIDKKFREEKDELTGLYNRRYISDQ
FT                   LPVSMRHSILERKSLFIVLFVIDELQSIDNYSDYESYDSILKEFTRLITSSLVNKKDWA
FT                   GRYAGSLFLLVLYDTDYESACNTADNIKNNFNQTSFQINGTAVKLTANYGVKLLNEDIS
FT                   DVETLILHAFMNLITNKLRVQNIID"
FT   gene            217242..218183
FT                   /locus_tag="Cphy_0172"
FT   CDS_pept        217242..218183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0172"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   spd:SPD_1745 transcriptional regulator PlcR, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40559"
FT                   /db_xref="GOA:A9KR91"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR91"
FT                   /protein_id="ABX40559.1"
FT                   /translation="MNFIGSIIREYRCKLKMSRTMLAENICSEKYIYLIEKGERTPSAD
FT                   MVRLLSDRMGVDLFDHYQYLDCSNPISVRETLKNFDICQRKSDFITAKSIVDKAMYLAD
FT                   FKNKPWLYELEANRLGYMVFIENKYEEAIMDANKVLEDMEPKYLSSIHVVNLYVLLSTC
FT                   YQIIGDLNNAKSITLAAYNIVRSKYKIEKYDHNIVSVRLNLITLYYLTKDYEKAITEGK
FT                   ELIDYQIEFNSYARIHIAYAFLSFSYFKKDAFKEAFLYFNQTISVLMAFYNPIDLKYIV
FT                   AQDIFQLMVKDERVNHKLVKEFKMKYELSYDK"
FT   gene            218439..219458
FT                   /locus_tag="Cphy_0173"
FT   CDS_pept        218439..219458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0173"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: sun:SUN_0557 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40560"
FT                   /db_xref="GOA:A9KR92"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR92"
FT                   /protein_id="ABX40560.1"
FT                   /translation="MKQKHNGVRRIHQDNMRENNQSRTSILFAIALLIYIVLSIYQLQI
FT                   RNQLVKQILLHFQVILTVSFVISEIKHSYLISILVTLFCFLLSFLSFFTDENEQAIHAM
FT                   IIYGTTIVIISLIHKYRVKLTGNLEHAIRHNKKSDELIKELRKKNKQLSKLNKDMREKE
FT                   KQLNQLAFYDILTKVANRKMLINQMDFLISISKNFSVVFIDLDNFKKINDTMGHQAGDS
FT                   LLKAVTLRIGDYIHPKDMFGRLGGDEFVLIVQRELGNEEILSYVEGLRQQLIRPFRIKK
FT                   AELTITASFGISAFPKDGRTSSELLKFSDIAMYQVKSMGKNDVEFFTMSMKRKKIKKL"
FT   gene            219658..219915
FT                   /locus_tag="Cphy_0174"
FT   CDS_pept        219658..219915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: llc:LACR_1589 peptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40561"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR93"
FT                   /protein_id="ABX40561.1"
FT                   /translation="MQSSILPRFQDLREATIGGLRALEDISFEDSKVKPFYALIDGSYI
FT                   FIGDDCETLYGEAHWIENGTITKICDKGECKQLTLDKGNS"
FT   gene            complement(220274..222049)
FT                   /locus_tag="Cphy_0175"
FT   CDS_pept        complement(220274..222049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0175"
FT                   /product="67 kDa myosin-cross-reactive antigen family
FT                   protein"
FT                   /note="PFAM: 67 kDa myosin-cross-reactive antigen family
FT                   protein; KEGG: smu:SMU.515 putative 67 kDa
FT                   myosin-crossreactive streptococcal antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40562"
FT                   /db_xref="GOA:A9KR94"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR94"
FT                   /protein_id="ABX40562.1"
FT                   /translation="MYYSSGNYEAFARPVKPEGADRKSTYLIGSGLASLSAACFLVRDG
FT                   QLKGERIHILEKDKLPGGACDGYKYSDRGFVMRGGREMDNHFECMWDIMRSIPSIETEG
FT                   VSVLDEYYWLNKSDPNYSLMRATVNRGEDAHTDGKFGLSDKGAMEIMHLFFTPDEELFE
FT                   KRIDELFSKEVLNSNFWMYWRTMFAFENWHSALEMKRYIQRYIHHIGGLPDFKALRFTK
FT                   YNQYESLILPMMKYLEEHNVQFHYDTQVVNVEFDIKKDKKVAKRIVCIHENQEESIDLS
FT                   EDDLIFISNGGCVENSSLGDQNHTAEYNTEIKAGSGWDMWRKIAAQDPSFGNPDKFCGD
FT                   PEKTNWMSATVTTLDDKIPPYVQNICKRDPFSGKVVTGGIVTATDSNWLLSWTFNRQPQ
FT                   FRNQPKNQLVGWIYGLFSDVPGNFVKKTMRECTGKEICMEWLYHMGVPENQIEQLAENS
FT                   ANTVPCMMPYITAFFMPRNTEDRPLVVPEGSVNFAFIGQFAETKRDTIFTTEYSVRTGM
FT                   EAVYTLLDIDRGVPEVWGSVYDVRDLLNASVQLTDGKKITDVDLGFKGKMALKEGLKKL
FT                   KDTEIEKLLKEYNVI"
FT   gene            complement(222247..222819)
FT                   /locus_tag="Cphy_0176"
FT   CDS_pept        complement(222247..222819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0176"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cbf:CLI_2106
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40563"
FT                   /db_xref="GOA:A9KR95"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR95"
FT                   /protein_id="ABX40563.1"
FT                   /translation="MAQQYTRKVIREVFVQMLNERPLSKITVKDIVNECEINRNTFYYY
FT                   YPDLYAILAEIFQTELQTVIEEYNDTLSWEESFLAATKFALENKIAIYHVYNSIQKEEL
FT                   EKYLFNVAGNVMTRYVEDASKDLKASGEDKRLIVSFYQSALTEMLLHWISSGMKEDPPK
FT                   VIHRIGLLFDGNIALSLERSAKLNDSW"
FT   gene            223270..223944
FT                   /locus_tag="Cphy_0177"
FT   CDS_pept        223270..223944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0177"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   cte:CT0872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40564"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR96"
FT                   /protein_id="ABX40564.1"
FT                   /translation="MDRKVSLSEISDGKLYGLNDMVKAGCNDCKGCSACCKGMGKSIIL
FT                   DPFDIFRFTTNLGKSFEELLNDKIELNIVDGVILPNLKMVGESESCAFLNNEGRCSIHA
FT                   NRPGICRIFPLGRYYEDHAYQYILQIHECKYKNRSKVKVSKWIDTNDSKRNEQFIIDWH
FT                   YFLKDLQEQIKKSADSTWIRNINLYLLNAFYQKPYVKDKDFYLQFEERLELMKSYLVSL
FT                   ER"
FT   gene            224031..224828
FT                   /locus_tag="Cphy_0178"
FT   CDS_pept        224031..224828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0178"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: cdf:CD1963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40565"
FT                   /db_xref="GOA:A9KR97"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR97"
FT                   /protein_id="ABX40565.1"
FT                   /translation="MDFESLRRLQKDSERVDALYQIMKEDSRLNHSKAARVEFITTTTY
FT                   IEKYLKEGDRILDLGAGAGEYSLYFARKGYEVTAVELASANIEAFQKKITGEDKIELIH
FT                   GNALDLSCFAEDSFDVVLLFGPLYHLSKEEDRQKCITEAKRVLKPTGTIFFAFILNDMV
FT                   ILTELYYRQDFFLENSYDHETFKVEDFPFVFFTVDQTREMLQAAGIQILKEIASDGVSE
FT                   LLEDKINAMDEESYKQYVRYHLYCCEKPEMLGRSNHLLTIGKK"
FT   gene            225030..225293
FT                   /locus_tag="Cphy_0179"
FT   CDS_pept        225030..225293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0179"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; Helix-turn-helix type
FT                   11 domain protein; KEGG: mla:Mlab_0303 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40566"
FT                   /db_xref="GOA:A9KR98"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR98"
FT                   /protein_id="ABX40566.1"
FT                   /translation="MSFQESFKALSDPTRREIINILKRGKLTAGEIVEHFDMTGATISH
FT                   HLTILKAAGLVTDEKKGKYIYYELNLSVVEEIMTWFASLKEE"
FT   gene            225379..226032
FT                   /locus_tag="Cphy_0180"
FT   CDS_pept        225379..226032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0180"
FT                   /product="protein of unknown function DUF1648"
FT                   /note="PFAM: protein of unknown function DUF1648; KEGG:
FT                   bcl:ABC3712 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40567"
FT                   /db_xref="GOA:A9KR99"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR99"
FT                   /protein_id="ABX40567.1"
FT                   /translation="MKKLFHQDNYKLWLIAIIALLIAIIAYPFLPAEIPFHFGANGEVD
FT                   QYGGPWTIFLMPAIIIILIVLAELLRIIDPKRQSYAKFSRHYYGVYFLISLLFMFLEIY
FT                   IIAMSFGIEVMNINHLMPAIIGILFLALGNSMPKFKHNYFCGIRTCYTLANEDVWFMTH
FT                   RFAGKLWFLGGFCMILTILLPAKANWIVSFIIVAILGIIPVLYSYFAYQRINKK"
FT   gene            226406..227530
FT                   /locus_tag="Cphy_0181"
FT   CDS_pept        226406..227530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0181"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aminotransferase
FT                   class I and II; KEGG: gtn:GTNG_2699 cysteine desulfhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40568"
FT                   /db_xref="GOA:A9KRA0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRA0"
FT                   /protein_id="ABX40568.1"
FT                   /translation="MIYLDYAANTPASEEVLKVYLETEQQFIANPNSSHPLGILAKERL
FT                   TEVTKELATLLKVEPEQIIPTSGASEANNLAIKGITYGYRENGRHIISTCLEHPSVSGS
FT                   LTFLQSLGYEIDLVDILPNGQVDLEHLKELLRKDTVLVSICTVDSELGTVQPIKEIAKI
FT                   LESYENCFFHTDATQGFGKIEVDLSLADLTTFTPHKFYGLNGTGVLVKKKDVVLLPQIH
FT                   GGSSTTIYRSGTPMLSNVVALTEAVNLSLEHYEDRLNRVVSLRKQFESKLSKYPNVRIN
FT                   STECGVPHILNISVKGVRAITMKEHLEEYGICISIKSACSATMTPSRPVYAVTKDKKNA
FT                   LSSFRISLSHLTTEEEVEKFFEGFDASYQKAMKN"
FT   gene            227708..228574
FT                   /locus_tag="Cphy_0182"
FT   CDS_pept        227708..228574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0182"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: cbo:CBO0341
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40569"
FT                   /db_xref="GOA:A9KRA1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRA1"
FT                   /protein_id="ABX40569.1"
FT                   /translation="MERYQEIERSIVKKYRKEIWRPFVKAVQEYELIKEGDKIAVCISG
FT                   GKDSMLLAKCMQELQKHGKIPFELVFLVMDPGYNEINRQTIINNAKLLNIPIEIFESNI
FT                   FDIVAEVDESPCYLCARMRRGYLYKNAKAHGCNKIALGHHFDDVIETILMGMLYSGQIQ
FT                   TMMPKLHSTNFEGMELIRPMYYVKEDAILHWKQFHELQFIQCACRFTENCTLCDNGGGG
FT                   SKRQEMKALVKKFRSQSNIIDSNIFRSVENVNLDTVIAYKTKGTKHHFLDTYDREDSVD
FT                   LKDTDLQ"
FT   gene            229100..229969
FT                   /locus_tag="Cphy_0183"
FT   CDS_pept        229100..229969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0183"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mla:Mlab_0619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40570"
FT                   /db_xref="GOA:A9KRA2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRA2"
FT                   /protein_id="ABX40570.1"
FT                   /translation="MHYKEAKGILSSTNGMNLYRGCTHGCIYCDARSKCYQMDHEFEDI
FT                   EVKINAPTLLESALRSKRKKCMIGTGAMSDPYLSLEPELKLTRTCLSLINQYGFGLSIQ
FT                   TKSNRILRDIDLLKSIHEKSKCVVQITLTTYDEEICKIIEPGVCTTRERFEVLLKMKEN
FT                   NIPTVVWLDPILPFITDTEENLRGILNYCVEAKVYGIICFGMGLTLREGNREYFYQQLD
FT                   KHFPGLKKRYQETYGYAYEIMSKHNDKLMKIFYDICQNNHIVCDNKKVFQYLHEYEEKN
FT                   KTEQLSLF"
FT   gene            230082..230633
FT                   /locus_tag="Cphy_0184"
FT   CDS_pept        230082..230633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0184"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40571"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRA3"
FT                   /protein_id="ABX40571.1"
FT                   /translation="MGEIVNTRVKRLYDSIEKHVGKEKADTLLTKITLPKSASPQKRFE
FT                   WACNVCTLLEENFDEDTICEIRMDCCCKPSMLHMKKLKELYSKSESLPGYANLASNETP
FT                   AKFWAEGSVLYMSYPECYCSDVKHTKGTMSKTWCLCTLGYTKYMYEYIFGCAVKVELLE
FT                   SVKLGNNRCVIRIESEEKPV"
FT   gene            230930..231298
FT                   /locus_tag="Cphy_0185"
FT   CDS_pept        230930..231298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0185"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG:
FT                   lre:Lreu_1332 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40572"
FT                   /db_xref="GOA:A9KRA4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRA4"
FT                   /protein_id="ABX40572.1"
FT                   /translation="MKIDFESGKPIFQQIAEQIEDAIFIGAFEEGTQIPSTTEVSTSFQ
FT                   INPATVLKGMNQLMEDGILYKKRGVGVFVCEGARNQIVGKRKEKFYESYVESLITEARK
FT                   LDLTKQDIIELIERGLAK"
FT   gene            231295..232161
FT                   /locus_tag="Cphy_0186"
FT   CDS_pept        231295..232161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0186"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cbh:CLC_1248 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40573"
FT                   /db_xref="GOA:A9KRA5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRA5"
FT                   /protein_id="ABX40573.1"
FT                   /translation="MNGITIEQVSKRFGNVVALDNINLSLKAGKIYGLLGRNGAGKSTL
FT                   LNVITNRLFAEDGKVVIDGENATENDETLSKIFYMSEGNCYPENYTVKDVFQAAKLFYG
FT                   EFDFEYAKRLCKKFDLNIKKKIKGLSTGYGSIYKIITALCLPVPYLLLDEPVLGLDANH
FT                   RELFYQLILEDYNRYERTIIISTHLIEEVSGLIEEVIIINKGKVIRQESCEEILSSGYT
FT                   VSGNAKDIEQFIKDKNVLSETSLGGLRSVCILGKLNRAEIPDTLEITKLDLQKLFVNLT
FT                   SEKEEME"
FT   gene            232161..232895
FT                   /locus_tag="Cphy_0187"
FT   CDS_pept        232161..232895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbh:CLC_1249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40574"
FT                   /db_xref="GOA:A9KRA6"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRA6"
FT                   /protein_id="ABX40574.1"
FT                   /translation="MKLGRAFKFQMKEIIKSIATFYGFLFLFLFLFITISNNSGDRNGS
FT                   IGGFELFTMVMIFITMLNIIRSDFHLFLQHGYSRKTLFLSTILCIITTSSVVALMESIL
FT                   FKIFSHFVTYNGMYIQGYGAAYLSDVGVKGMVDEYFWKFFLYILAGAIGIFISLLYYRM
FT                   NKLQKMIVSAGVPALLFVIYPISDEFLFDGALSKISAKIMNFYTGYAFGSEPYVNVLCN
FT                   IALFALFGAFSFLLLRRCNYKK"
FT   gene            complement(232976..234154)
FT                   /locus_tag="Cphy_0188"
FT   CDS_pept        complement(232976..234154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0188"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   cac:CAC3332 predicted amidohydrolase (dihydroorothase
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40575"
FT                   /db_xref="GOA:A9KRA7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRA7"
FT                   /protein_id="ABX40575.1"
FT                   /translation="MKLLIKNGIILTMSETKYQPGDLLIEDGKIKEIAPTISISEDNSL
FT                   ITIPATNCIVMPGLIEAHCHVGISEEKKGKEGDDSNETSNPVSPYLRAIDAINPLDPAF
FT                   HDAIRAGITGIMVGPGSTNVVGGQFTFLKTAGSRCIEDLAILNPAAMKVAFGENPKSFY
FT                   GEQAMMPFTRMGIAFLLREELWKAKQYLKKKKKAEETSEEFDEDFRLEPWIPVLEKKIP
FT                   LKAHVHRTDDILTAIRIAKEFELDMTLDHCSEGHLISEEILDSGFPAIVGPDLASRNKI
FT                   EVQNMAFKTAGELSKAGVLVSITTDHPVSLIQTLPICTGFAVKNGLPMEDGLRAITINA
FT                   AKICRVDHRIGSLEVGKDADIAIFDGNPLEVFTNCLYTIIDGKIIYQYHKPK"
FT   gene            234483..234971
FT                   /locus_tag="Cphy_0189"
FT   CDS_pept        234483..234971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0189"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   cbe:Cbei_0409 CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40576"
FT                   /db_xref="GOA:A9KRA8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRA8"
FT                   /protein_id="ABX40576.1"
FT                   /translation="MERRDKVNYYLDIAETVSKRSTCLRRIYGAVIVNNDEIIATGYVG
FT                   APRGRANCSDLNYCIRTKLSVPRGERYELCRSVHAEANAIISAPREKMLGSTLYLVGFE
FT                   MPDMTYIQNANSCSMCKRMIINAGIESVVIRDSKEDYRIIEVNDWIENDESLDGVRGY"
FT   gene            235186..236616
FT                   /locus_tag="Cphy_0190"
FT   CDS_pept        235186..236616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0190"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: pdi:BDI_1500 putative
FT                   beta-lactamase class C, putative 6-aminohexanoate-dimer
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40577"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRA9"
FT                   /protein_id="ABX40577.1"
FT                   /translation="MNMTNNKKLIPEKAVKSFLKQIQGDRVNLHGFLMMLEDEVIYEGY
FT                   WEPFHAESMHRMYSVGKSFTSIAIGLLEEEGKLKLTDTICPYFEDKLPKEGVHPWIKET
FT                   TIRDMLCMTTAHHTTTYKRFPEDDWVKSFFHVEPTHKPGTIFSYDTSSTHVLSALVERL
FT                   TGMELLDYLRVKFLDRIGFSKDAKILKDPMGVSQGGSGLICTLRDLSLVANVCLHMGEY
FT                   RGEQLLPREYLMEATKKQVDTVLQPYLDEQFGYGYQIWKTRHNGFCFYGMGGQLAVCFP
FT                   EHNFVFATTADTQGSPNGLKNIYDAFYQQVYPYLEGVTLDDSEETLSDIINHLRVPIAS
FT                   SIFEPYIEGKKIMAQSYRMQPNQMGLEELTVTIDGEVGHFDYKMKQKSHRLTFHLKEAY
FT                   HQNFPDTQFECMCSGVWLTEDVLYIKTNIIEEYFASMNMLLVFREDTVTICMKKAAETI
FT                   LQDYEGFATGTRTYGGQA"
FT   gene            236617..238155
FT                   /locus_tag="Cphy_0191"
FT   CDS_pept        236617..238155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0191"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   bld:BLi00864 xylan beta-1,4-xylosidase; RBL03427"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40578"
FT                   /db_xref="GOA:A9KRB0"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB0"
FT                   /protein_id="ABX40578.1"
FT                   /translation="MRQEYCNPVQRGFFPDPSVIRVGDDYYMVNSSFQYFPAIPISHSK
FT                   DMVHWHIIGHAITNPEYLPLEDIKDSHGIWAPDISYHDGTFYIYATLRLNGSGTRGNNV
FT                   LRRQLLVTSKTPEGPYSAPTWLEVDAIDPSHFVDDDGKHYMVIAKAATVIPLSDDGKRV
FT                   IGEPFAAWTGTGECCPEGPHILKKDGYYYAIVAEGGTGYGHGINVARSKNLYGPYEECP
FT                   YNPVLRQFKEDSPIQRTGHGKLVQTQNGDWWMYYLLGRPNQGRYTTVGRESGLDPVTWT
FT                   EDGWFIVNEGKGPSERQIAPDLKPHVFERNLKDDFEEEKLNLDWEFVRNPDYGSCSSTE
FT                   RPGYFRIWTRDGRLDEIRAKNTLVRREQELSYEAETKVEFYPTKDGEQAGLTCYYSTAT
FT                   YARFSLCYEGGRKLQLVINRNHGEELMAEVLDIKERAVYLKVIVEKLTRSFYYSYDGKE
FT                   WTLAGVLENCIYLCDEGVPDDPKRHTGTLVGIYANNGGCGSRIPADFDYFYYQE"
FT   gene            complement(238298..240091)
FT                   /locus_tag="Cphy_0192"
FT   CDS_pept        complement(238298..240091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0192"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; protein of unknown
FT                   function DUF214; SMART: AAA ATPase; KEGG: ppe:PEPE_1650
FT                   ABC-type antimicrobial peptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40579"
FT                   /db_xref="GOA:A9KRB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB1"
FT                   /protein_id="ABX40579.1"
FT                   /translation="MLQVNHVTKKYGNAIILENSSYTFPSKGIVCLMGASGGGKTTLLN
FT                   LLAGFDTDYEGEILVGGTLISGMDAEKLCQYRRDNIGFVFQNYHLLPGYTASENVLLAS
FT                   ALSKDSPDASRQKAATLLTRLGIGEKENQKVENLSGGQKQRVAIARALMSDPQIIFADE
FT                   PTGALDRTTSTEIMKLLQEISRDRLVVVITHDAKICEFADEIIHIKEKKIIEERVIRRD
FT                   VTDEKALVVGSSPKISIFSRAVKNFKVHLTRYAAVSLSISIGLLAFLFSLSFGNVMERS
FT                   IDDFKTKNTAFNNGYIKGADDGTILEYLKKDERIENVYYQYKLRNLTLSTGDKSEQIAE
FT                   KFPTPKATESLSYGVMPRLGQNEIAITPSLAKKFDSDIKKLLGKEFILELDGQKHKLTM
FT                   SGIYNAGYDDFIVSSDIEQQFYKNITDEKNYSISYDVKEFSDIVGVSNVLKLRGITAKT
FT                   ASDEVYALQNTFHSLNKLFLVISFLILAISLFICTILLNKLQNTRYHEIGLLSALGFSR
FT                   QQISSMIRCENLLLSSLATVVNLILLFASILLGKLLDFALIFTGAQVVLSIVATFAIVM
FT                   LLSAVASYKLIRTEPAIALKK"
FT   gene            complement(240094..242037)
FT                   /locus_tag="Cphy_0193"
FT   CDS_pept        complement(240094..242037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0193"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; protein of unknown
FT                   function DUF214; SMART: AAA ATPase; KEGG: cbe:Cbei_4728 ABC
FT                   transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40580"
FT                   /db_xref="GOA:A9KRB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB2"
FT                   /protein_id="ABX40580.1"
FT                   /translation="MFLIRNVSKQFGDEYALRNISMTIGKGLNFIIGSSGSGKTTLLKI
FT                   ISGMEQKFDGEVFYCGQDVKALTEQEKSYYYNNIFGFVWQDFNLLDDLTVLENIMLPQF
FT                   LKHGQDKKAIMKVLRELKISELDNQKVGKLSGGQKQRVAIARELMKNPQVIIADEPTSA
FT                   LDEKSSKTTMDILRDIAKNRTVIVVTHDTSLIDQSAKVYELDKGELTAATEEVSIKEEK
FT                   ADTLKPHKLSFASACKLSLSNIKSKWNRTITTALSLVVAATLLLVTVSGAITDSSQSAF
FT                   DKLFETYGESILDISIVGSFMSAGGTDGSQKDEPNANVDQNIDGLYDKYLNDKRVSHIV
FT                   FTQHYNDIKVSADGKEYSIDTGSSVPTVNKLIAGKMPMGEDNEIVVPKSFIEKLGVSAE
FT                   EALGKTIDFKGNIYNWDSGEPVSMPVSTTANIVGVVDTTVKYEYGGQLMEYSVDDAFFF
FT                   SRSALNEMRTQADIKNGEGNFTIRTKTPADLIAIKDELNAEGIVPLGRFELVEDMVRLN
FT                   DQTTEQSGSAILVIGILAAVIILSVSLMTALTRRREYAIFKVSGYANQHLLLMTASEFM
FT                   ILAAASGILFLCISPLINLATTALWSVNILNGNLLFAGVLLVLVMGILACTTTTIAGIM
FT                   TKASASLKTGDR"
FT   gene            complement(242049..242735)
FT                   /locus_tag="Cphy_0194"
FT   CDS_pept        complement(242049..242735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40581"
FT                   /db_xref="GOA:A9KRB3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB3"
FT                   /protein_id="ABX40581.1"
FT                   /translation="MKKLITILMAALIATSITGCAKKQTAQDEDICPGKLLGEEGAPMA
FT                   MAEGFDQTVDMTFHTKDTNGTPVTNEIFSGTERGVWLVFWQTDNDKSLTELTRLNDMLP
FT                   IAKENGYKIVGIVMDGEENSDKAKEMTTNLGFTNIIWNDEVASRYNGISNFFSKEFYEN
FT                   NKELYSQFIVMPNLGDPVSGLANSRGQLQSSCTMIPMSNEKIEEQWKNNNSNATFEELQ
FT                   EEAFGK"
FT   sig_peptide     complement(242670..242735)
FT                   /locus_tag="Cphy_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.433 at
FT                   residue 22"
FT   gene            complement(242919..244052)
FT                   /locus_tag="Cphy_0195"
FT   CDS_pept        complement(242919..244052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0195"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: amt:Amet_4746 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40582"
FT                   /db_xref="GOA:A9KRB4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB4"
FT                   /protein_id="ABX40582.1"
FT                   /translation="MIKKLSIRARLTALSILALTTCCIGLTTILNLSAYHMADVIEAIP
FT                   ITPAYEVSKDATAIEQAPLLSRTTTTPSEGSQIARTRFLYQSIIYMVLIVTIGGGLTYY
FT                   ITGKALMPLRVLSHQMKNRTVHNLSEDLPVPEIHDEIADLTVSFNQMSSKLEEAFAMQK
FT                   RFSQSAAHELRTPLTVLRTKVDVFKKKKEHTSEEYDNLLSVITTHTNRLSELVKDLLDL
FT                   TNMDDLDYDEQIELNALLQDVVEELIPLTKEKNITINVNGTSKSIAGNKSLLHRAFYNL
FT                   VENAIKYNTENGTVDICIGDSADHAVVTIADTGIGIPKELEELIFEPFFRVDKSRSRQI
FT                   GGAGLGLSTVKTIIEKHNGVVSVSENETAGSRFTIQL"
FT   sig_peptide     complement(243948..244052)
FT                   /locus_tag="Cphy_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.711 at
FT                   residue 35"
FT   gene            complement(244049..244729)
FT                   /locus_tag="Cphy_0196"
FT   CDS_pept        complement(244049..244729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0196"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: ctc:CTC01482
FT                   transcriptional activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40583"
FT                   /db_xref="GOA:A9KRB5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB5"
FT                   /protein_id="ABX40583.1"
FT                   /translation="MRILIVEDEIDLCDTIAEGLQIDGYAVDTCYHGDVAYELISTETY
FT                   DLVVLDLNLPGMDGIDILSDLRKTNKDMKILILSARSSVSDKVLGLDIGANDYLAKPFA
FT                   FEELEARIRSLLRRSFVQENSVLVWNEISLDTVGRTVSVSGIDVTMTKKELALLEYFLL
FT                   NQSKVISQEELMEHVWNMEADSFSNAVRVHIASLRKKLKIALGYDPIATKIGEGYFLNG
FT                   GGSL"
FT   gene            244835..245491
FT                   /locus_tag="Cphy_0197"
FT   CDS_pept        244835..245491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40584"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB6"
FT                   /protein_id="ABX40584.1"
FT                   /translation="MIATKRKTKREDNDLKKTTVALFTALLVLSLAGCSSAPSDEKIKT
FT                   ALEDGTITIEDAKEKGWIDDEWVEANFEPIKAKTKIYLFDSFQTTYLDGTPASSELIEG
FT                   KMCLVFFNTAKDGTMDKLKVFNDIREEMEDIGVPILGIITDEQLEDAKEKLNDIKFPIL
FT                   VYNEEMQKSLAEFNELIDSDVVSIFTKEGGFYSAWNSGCDSESLLDFARGLADEE"
FT   sig_peptide     244835..244945
FT                   /locus_tag="Cphy_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.712 at
FT                   residue 37"
FT   gene            245608..246474
FT                   /locus_tag="Cphy_0198"
FT   CDS_pept        245608..246474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0198"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ctc:CTC01480 conserved protein, putative
FT                   ferredoxin-type protein NapH"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40585"
FT                   /db_xref="GOA:A9KRB7"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB7"
FT                   /protein_id="ABX40585.1"
FT                   /translation="MAKNKNRWKVQAAATLLTNSHISGFFTGKIYKGKLKSICVPGLNC
FT                   YSCPGAIGSCPIGSLQAVIGSSKFKFSYYIVGLLILFGVLLGRLVCGFLCPFGWFQELL
FT                   HKIPTKKFSTKKLKALTYMKYVILVVFVIILPMTIINEVGMGDPWFCKWLCPAGILEGA
FT                   LPLSIVDSGIRAALGTLFTWKSCLLVGIVTLSVFFYRPFCKWICPLGAFYALFNKLSFY
FT                   RFNIDKEKCTSCKACAKVCKMDVEVYKSPNHNECIRCGDCIRTCPHGAICKSINLRKED
FT                   KKNEKMA"
FT   gene            246458..246991
FT                   /locus_tag="Cphy_0199"
FT   CDS_pept        246458..246991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0199"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ctc:CTC01479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40586"
FT                   /db_xref="GOA:A9KRB8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB8"
FT                   /protein_id="ABX40586.1"
FT                   /translation="MKKWLSMLILAICMFSLVACSNNEIEGTKQPFPEFEGVDFEGNSV
FT                   SNDIFKDYDATIINFWTNGCGSCIAEMPELEEYYQKFKEKNINLIAVAASAGDSDEMRL
FT                   GAEKILKEKGVTFTNIIPDINSSFYKDFICEITGFPITYIVDSEGNMIGAPLIGVVKKQ
FT                   EDTLMKRLDKITEQ"
FT   sig_peptide     246458..246517
FT                   /locus_tag="Cphy_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.630 at
FT                   residue 20"
FT   gene            complement(247133..248617)
FT                   /locus_tag="Cphy_0200"
FT   CDS_pept        complement(247133..248617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0200"
FT                   /product="L-fucose isomerase related protein"
FT                   /note="KEGG: cac:CAC2610 L-fucose isomerase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40587"
FT                   /db_xref="GOA:A9KRB9"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB9"
FT                   /protein_id="ABX40587.1"
FT                   /translation="MNNIPNINVGIVAVSRDCFPMSLSNRRREAVVSSYREKGLEIYEC
FT                   PITIENEKDMLKALADVKAANCNALVVYLGNFGPESSETLLAKNFDGPVMFAAAAEETT
FT                   SILADERGDAYCGMLNASYNLKLRNIRAYIPEYPVGTPTEVATMIEDFLPIARTIIGLQ
FT                   NLKIISFGPRPQDFLACNAPIKALYSLGVEIEENSELDLFASFNDHANDPRIPDVIKDM
FT                   EEELGTGNNMPGILPKLAQYELTLLDWAEAHKGCKEFVVFANKCWPSFQTQFGFVPCYV
FT                   NSRFASKGMPVSCEVDIYGALSEYLGVCVSEDSVTLLDINNTVPADMYDASIKGKFDYK
FT                   PTDTFMGFHCGNTPSKKLSSCSMKNQKIMARSLEPNQEPNITRGTLEGDIAPGEITFFR
FT                   LQSTADTVLRAYVAEGEVLPVPTQSFGSIGVFAIPEMKRFYRHVLVEKNYPHHGAVAFG
FT                   HFGKAIFEVFKYFDVADIEFNRPASMMYPTENPFYR"
FT   gene            249113..251323
FT                   /locus_tag="Cphy_0201"
FT   CDS_pept        249113..251323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0201"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: csc:Csac_2452
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40588"
FT                   /db_xref="GOA:A9KRC0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRC0"
FT                   /protein_id="ABX40588.1"
FT                   /translation="MMKKKGNQEEFKVKRLKRQSKKEENIEKLYKLNKELKQEKEIRQD
FT                   RYSKKREKKRIFGIRLRLALAFMVPIAFIIILGITSYNKASEAMLKSYEESSFQALKTT
FT                   TNYFELAMQTVELRLNQLKGYENLKNYYSGTYKSDPITEMTTYKNLQVYIETTTYSDNV
FT                   LANLYVFSKRGNNLSNYGSMDLSGAELVEAYLETEEGKRDEKENGAYSWSGKHQFVDEH
FT                   FVQDKSKITIPYAFSVSSAFFGNGFKQIGYMVADIRLDLFQKKLSELELSENSIFVAIS
FT                   KDGYEVHSNEAEGVLIADKSFYTDALASSELSGTSYVDFNGEKHLFLYSKATKSGITVC
FT                   GLVPYSYLISQAKAIRTSTVIYVLIAVVSALFIAVIMSTDMGSAINKIIVALKKASEGD
FT                   LTVSVNCQRKDEFGMLADSANNMISNVKGLIDKAQKVKDTISLSTDEVSDSAKQLLIAT
FT                   QNISTSIEEIRQGIVQQAEDSEKCLRQSDELTTRVNQVSYNVTTIEKLTEDSKAVVQQG
FT                   LVSIDILRDKSEETTKITNNIIGDIESLEAESESIGKIIGVINDIAEQTNLLSLNASIE
FT                   AARAGDAGRGFAVVADEIRKLAEQSVRASGEIATIISSIQGKTKLTVTTVQKSENIVKS
FT                   QGNALLNTIDLFQKIDASVGMIAKELTEITSGISGIKVAENTTLNAIESISAVSEETAA
FT                   SSEEVDSAANRQVESVSKLREATLHLEAETKELNEALNQFRI"
FT   gene            251342..252022
FT                   /locus_tag="Cphy_0202"
FT   CDS_pept        251342..252022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0202"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: cbe:Cbei_2642
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40589"
FT                   /db_xref="GOA:A9KRC1"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRC1"
FT                   /protein_id="ABX40589.1"
FT                   /translation="MAMPELLTEVNVVSTTVRLLLALVCGGILGIERGRKKRPAGFRTY
FT                   MLVCIGSTLVMITSQYICSLYQNSDPARMSAQVISGIGFLGAGTIIVTGRNRVMGLTTA
FT                   AGLWASACIGLSIGIGFYSGAIIGCILIFFVMSVLHRLDERVISSVKIINLYVELSQMS
FT                   DVGHLMRFAKEQDLKVNDVEFVRGKSASGLALTLTLKFPKCYTQIEIIELFSTIEGVTY
FT                   MEVI"
FT   gene            252199..253326
FT                   /locus_tag="Cphy_0203"
FT   CDS_pept        252199..253326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0203"
FT                   /product="glycosyl hydrolase family 88"
FT                   /note="PFAM: glycosyl hydrolase family 88; KEGG:
FT                   amt:Amet_0895 glycosyl hydrolase, family 88"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40590"
FT                   /db_xref="GOA:A9KRV9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRV9"
FT                   /protein_id="ABX40590.1"
FT                   /translation="MDMIVKYINELLDKSTPEVPMWNIEKIKSGEKSEWNYIDGCMIKA
FT                   VLEMYAITKEEKYLKFADDFIDYRVDEEGNISGYEVEKFNIDDVNAGKTLFELYDLTGK
FT                   EKYRKAIDIIYKQVKTQPRTREGNFWHKLIYPQQVWLDGLYMGQPFYMEYETRFNNKKN
FT                   YEDIFHQFFNVYEMLRDEKTGLYYHAFDSSREMFWCDKETGLSKHFWLRALGWYAMALL
FT                   DTLDKCEPTGYEKEYERLKQIFIEYMETILKYQDESGMWYQIPDMGGRERNYLETSGSS
FT                   IMAYALLKGVRLGFLPESYRENAKKAMDGICEKYLHTEEGKMSLGGICLVAGLGGKQMR
FT                   DGTYDYYMSEPIVKDDAKGVGPFLLAYTELLRLQK"
FT   gene            253676..254716
FT                   /locus_tag="Cphy_0204"
FT   CDS_pept        253676..254716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0204"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; trigger
FT                   factor domain protein; KEGG: ssp:SSP1089 FKBP-type
FT                   peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40591"
FT                   /db_xref="GOA:A9KRW0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRW0"
FT                   /protein_id="ABX40591.1"
FT                   /translation="MKKKALLLGLCGCLMLSVVACSKKSSGGVDVTLGQYKGIEVTVEP
FT                   VEITEEQVNQQLDNFNKQKGKDVKITDRTDVRNGDTVNIDYVGKVDGKEFDGGKGEGYN
FT                   LEIGSNSFIDGFESGLIGKNVGETADVPVTFPNPYDSNPDLAGKDAVFTVTVNYLTDGN
FT                   KEPLTDEVVKQNSDYETIDAYKDYIKTALTESAEQQAQTQKEIDIIQKAIDNTTFKNLE
FT                   QKEYDAEETDMRAYYTSVASQYGVDLKTYILYFFGMSEEQFNTEIKKAAEFNVKQRLML
FT                   DEVVKTEKLDITDEEYTDKVTEYTEQNNYKTVEEFEEAYKGKENVKIALLREKALDFVI
FT                   NAAVVK"
FT   sig_peptide     253676..253738
FT                   /locus_tag="Cphy_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.898 at
FT                   residue 21"
FT   gene            complement(254877..255548)
FT                   /locus_tag="Cphy_0205"
FT   CDS_pept        complement(254877..255548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0205"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   cdf:CD1631 superoxide dismutase (Mn)"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40592"
FT                   /db_xref="GOA:A9KRW1"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRW1"
FT                   /protein_id="ABX40592.1"
FT                   /translation="MSQNNQTYPFPLLPLPYARDALSPNISEYTLYFHHEKHLKTYVDN
FT                   LNKALKDYPEFQSWNLEELIVHNNLLPSAIQIPVQHNAGGVYNHNLYFYSMKSPSKPSM
FT                   PPAQNTSQVTGNDFLNLINQTFGNFNEFKAKMKEAALQVFGSGYAWLVSNSRGELSIVT
FT                   TANQDTPLTLGLIPLLPIDVWEHAYYLDYQNRRNDYIDEWFDLINWDFVYYLYNRQFQI
FT                   Y"
FT   gene            255647..256024
FT                   /locus_tag="Cphy_0206"
FT   CDS_pept        255647..256024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0206"
FT                   /product="arsenate reductase and related"
FT                   /note="PFAM: arsenate reductase and related; KEGG:
FT                   ctc:CTC01181 arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40593"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRW2"
FT                   /protein_id="ABX40593.1"
FT                   /translation="MSYQYLEYPKCTTCIKARKWLEKNQIAFESRDITVNNPTKEELKL
FT                   WHEKSGLTLTKFFNTSGLLYREQNLKEKVKVMTVEEMIEILSTNGMLVKRPILVGDDFI
FT                   LVGFKEDEWKKRLLPPVLKRY"
FT   gene            256191..257048
FT                   /locus_tag="Cphy_0207"
FT   CDS_pept        256191..257048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdf:CD0306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40594"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRW3"
FT                   /protein_id="ABX40594.1"
FT                   /translation="MFGYIGIHKPELKMKEYYKYRAYYCGLCQVLKERYGRFGQMTLTY
FT                   DMTFLIILLTSLYESKVTEEQHRCLAHPTKKHWMLRNEITEYAADMNIALTYHKFLDDW
FT                   NDEKSLVGLSASKLFVRKYHKIEKKYPEKCQMIAECLAKLQKYEKENVTDLDKIAKSFA
FT                   DLMGEMFVYRKDEWEDTLRRLGFFLGKYIYLLDAYEDVKEDIRKDNYNPLKEKIGEPSF
FT                   EEEYRQILIMMMSECSKEFERLPLILDVELLRNILYAGVWKKYDEQGTKSCNKKAIDEE
FT                   GKGI"
FT   gene            257050..257670
FT                   /locus_tag="Cphy_0208"
FT   CDS_pept        257050..257670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0208"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   cbf:CLI_0254 molecular chaperone, DnaJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40595"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRW4"
FT                   /protein_id="ABX40595.1"
FT                   /translation="MTQDPYQVLGISRTATDDEVKKAYRELSRKYHPDSYINNPLSDLA
FT                   EEKFKEVQEAYDTIMNERQNGGYSTFNGNFSGQSYGNQTYSEDGVLADVASKINGRRFS
FT                   EALSLLSGISNRTARWYYYSAIANLGVGNNVLAADHARTAVSMEPNNSEYINLLNQLQW
FT                   GSRRYTQTGSGYGRGMDAGDMCCNLCIADACCECMGGDLCTCI"
FT   gene            257661..258230
FT                   /locus_tag="Cphy_0209"
FT   CDS_pept        257661..258230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdf:CD0308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40596"
FT                   /db_xref="GOA:A9KRW5"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRW5"
FT                   /protein_id="ABX40596.1"
FT                   /translation="MHLSTKKIAFSGLLLALTILFTILSSVFETSTFFFLAAASYLVGI
FT                   NFRESGVKFGIGFYLSAILLSIILVPNKLYCLTFATISAYIVIMEIIRVYLTKKELKKL
FT                   ATTNRDSIEKKSNAFFYSIKFVVFNVLYLPFLFLFPGLLYSGEISPMVYILFIIGGQII
FT                   FVIYDMAYDVFIQKYWKRIKKSIIRN"
FT   sig_peptide     257661..257777
FT                   /locus_tag="Cphy_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.280 at
FT                   residue 39"
FT   gene            258892..259182
FT                   /locus_tag="Cphy_0210"
FT   CDS_pept        258892..259182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0210"
FT                   /product="sporulation transcriptional regulator SpoIIID"
FT                   /note="TIGRFAM: sporulation transcriptional regulator
FT                   SpoIIID; KEGG: cth:Cthe_2618 stage III sporulation protein
FT                   D, SpoIIID"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40597"
FT                   /db_xref="GOA:A9KRW6"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRW6"
FT                   /protein_id="ABX40597.1"
FT                   /translation="MKGSNLFKHKQIEERAAEIAAFIIENNATVRQTAKQFGISKSTVH
FT                   KDVTERLLQVNPSLAERARVVLDLNKSERHIRGGLATKEKYLHKGKTVQGY"
FT   gene            259945..261264
FT                   /locus_tag="Cphy_0211"
FT   CDS_pept        259945..261264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0211"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   C subunit; PFAM: Respiratory-chain NADH dehydrogenase
FT                   domain 51 kDa subunit; KEGG: cbh:CLC_0426 electron
FT                   transport complex, RnfABCDGE type, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40598"
FT                   /db_xref="GOA:A9KRW7"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRW7"
FT                   /protein_id="ABX40598.1"
FT                   /translation="MAAGTFKGGIHPYEGKELTKDKPTTLLLPKGDLVYPMSQHIGNPA
FT                   KPIVAKGDKVLVGQKIGEADGVVSACIISSVSGTVKAVEPRLNVAGTMVESIVVENDNA
FT                   YTQVEGFGVERDYETLKKEQIRSIIKEAGIVGMGGAGFPTHIKLTPKDDSAIDYLIING
FT                   SECEPYLTSDYRMMLEETNRLIKGIKITLRLFENAKAIIAVEDNKPEAISMLTHALRNE
FT                   NRIELKVIKTKYPQGAERVLIYAITGRKMNSTMLPSDIGCIVNNVDTMISVCRAVAENT
FT                   PLIKRVVTVSGDAVKNQGNFIVLTGTNYSELVEAVGGFSAKPAKLISGGPMMGLALYSL
FT                   DIPVTKTSSALLAFASDEVADMEEGPCIRCGRCVEVCPGRIVPQKLMEFAERFDDKGFE
FT                   GLNGMECCECGCCSYICPAGRHLTQAFKQSKRSILNERKK"
FT   gene            261309..262319
FT                   /locus_tag="Cphy_0212"
FT   CDS_pept        261309..262319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0212"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   D subunit; PFAM: NQR2 and RnfD family protein; KEGG:
FT                   ctc:CTC01020 RnfD/NqrB"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40599"
FT                   /db_xref="GOA:A9KRW8"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRW8"
FT                   /protein_id="ABX40599.1"
FT                   /translation="MKDMYNVSASPHVRSGVTTAQIMRDVAIALMPACLFGIYQFGFSA
FT                   FLVLLVSVTSCVVSEFLYERLMKHPYRPYECSALVTGLLIGMNMPATIPVWIPMVGGVF
FT                   AIIVVKQLYGGLGQNFMNPALAARCFLSICFTSRMTTFAVDAFTNSGTSSRTLYLFNYG
FT                   YAGLDGVSGATPLAAMKASEAAPSLLDMFFGFHGGVIGETSAMMLLIGACYLLYRRIIS
FT                   LRIPLTYIATFAVFIILFSGKGFDVEYVLAQILGGGLILGAFFMATDYVTCPITKYGQI
FT                   LFGVCLGALTGLFRVFGGSAEGVSYAIIFCNLLVPLIEKITMPRGFGMGGKKLAK"
FT   gene            262309..262965
FT                   /locus_tag="Cphy_0213"
FT   CDS_pept        262309..262965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0213"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG: cdf:CD1139
FT                   electron transport complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40600"
FT                   /db_xref="GOA:A9KRW9"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRW9"
FT                   /protein_id="ABX40600.1"
FT                   /translation="MQNKKKSTIIKDAIALFAITLVAAVALGFVYEITKDPIAEAEAKA
FT                   KAKAYSMVFADAKLVDDKNEDVNAKVDSSKEFLTSQGFTSSTINEVCIAKDEAGNALGF
FT                   VMTLTSSAGYGGDIKFTMGVKADGTLTSIEIISMNETSGLGAKANDDSFKGQYSDKNVD
FT                   SFKVIKSAESKTGDDQINAISGATITSSAVTGTVNAGLAFANDLLENGVGGVTHE"
FT   sig_peptide     262309..262395
FT                   /locus_tag="Cphy_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.858 at
FT                   residue 29"
FT   gene            262958..263719
FT                   /locus_tag="Cphy_0214"
FT   CDS_pept        262958..263719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0214"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   E subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   ctc:CTC01022 rnfE/nqrD"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40601"
FT                   /db_xref="GOA:A9KRX0"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRX0"
FT                   /protein_id="ABX40601.1"
FT                   /translation="MSKALERIYNGVIKENPTFVLMLGMCPTLAVTTSAINGVGMGLTT
FT                   TAVLIMSNMLISMLRKAIPDKVRMPAFIVVVASFVTIVQLLLQAYLPSLNDSLGIYIPL
FT                   IVVNCIILGRAEAYASKYPVYPSIFDGVGMGLGFTVGLTLIGLFREILGAGTAFGFSIM
FT                   PDSYEPFSIFVLAPGAFFVLAMLTALQNKLKLKSATNVPMADKLACGGNCSSCSGSACH
FT                   SNHELLDSVKEEATKKAAAEKARAANQTEKK"
FT   gene            263734..264309
FT                   /locus_tag="Cphy_0215"
FT   CDS_pept        263734..264309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0215"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   A subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   fnu:FN1592 Na(+)-translocating NADH-quinone reductase
FT                   subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40602"
FT                   /db_xref="GOA:A9KRX1"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRX1"
FT                   /protein_id="ABX40602.1"
FT                   /translation="MKELLLVLIAAALVNNVVLSRFLGLCPFLGVSKKISTAAGMGGAV
FT                   IFVITIASALCSVIYDVVLVPLDLKYMNTIVFIILIAALVQFIEMFLKKFSPGLYNALG
FT                   VYLPLITTNCAVLGVAIDNVQKGNGFVISVVYGAGTAIGFLIAIVIMAGVRERIENNNV
FT                   TKSFQGSPIVLITAGLMSIAFMGFAGLL"
FT   gene            264327..265175
FT                   /locus_tag="Cphy_0216"
FT   CDS_pept        264327..265175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0216"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   B subunit; PFAM: 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; Fe-S cluster domain protein; KEGG:
FT                   cno:NT01CX_1584 polyferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40603"
FT                   /db_xref="GOA:A9KRX2"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRX2"
FT                   /protein_id="ABX40603.1"
FT                   /translation="MTNLALFDLLSNTGVLAFNMQGLITAAAIVGGVGLIIGILLGLAA
FT                   KVFEVEVDERELIVRDLLPGNNCGGCGYPGCDGLAKAIAAGEAPVSGCPVASAEIHAKI
FT                   GEVMGTEAIESERNVAFVKCNGTCDKTNVKYHYTGTPDCKKISTVPGNGEKTCIYGCMG
FT                   YGSCVRACAFDAIHVVNGIAVVDKEKCVACGKCITACPNDLIEFVPVSSTCKVQCNSKD
FT                   KGKDVNAACSVGCIGCMMCVKVCESDAVTVTNNLAHIDYSKCTHCGKCAEKCPRKIITI
FT                   A"
FT   gene            265478..266050
FT                   /locus_tag="Cphy_0217"
FT   CDS_pept        265478..266050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40604"
FT                   /db_xref="GOA:A9KRX3"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRX3"
FT                   /protein_id="ABX40604.1"
FT                   /translation="MVCKICGRTIQNEEANFCEYCGAPFRPGMDNRVLENEHSSSPNVY
FT                   GQDITMQQRLGQGSASQNGPWQTNYEQSAYGNSSMKDQVLGRFTNQDSNTNAQGSAVVQ
FT                   EKPMSVGKWLAVMMLGFIPPIGPYAFLILLFYWSFSKSIPLTRKNWARATLIVALVLVI
FT                   FLFAAIGMTGGEILSDPTAILNSIYGK"
FT   gene            266504..268846
FT                   /locus_tag="Cphy_0218"
FT   CDS_pept        266504..268846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0218"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="PFAM: glycoside hydrolase family 31; KEGG:
FT                   cbe:Cbei_0772 glycoside hydrolase, family 31"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40605"
FT                   /db_xref="GOA:A9KRX4"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRX4"
FT                   /protein_id="ABX40605.1"
FT                   /translation="MKFSNGCWLQKKGTECFSPVQVYDYQIKENEVRILTTTHQINHRG
FT                   DTLGGVNLTIFITAPAPEVLRVKTYHYMGVRKKSPEFELDLSGACTLECEDTEDILIIK
FT                   NGSLRLEVQKSNAAFAYYRGNEKLTSSGWRDLAYMKTDWQGLAYDDGGEEDTYMREQLT
FT                   LSVGELVYGLGERFTPFVKNGQSLDIWNEDGGTSTEQSYKNIPFYITNKGYGVFVNHPE
FT                   KVSFEIGSEMVTKVGFSVPGECLDYFIINGPDIKQVLARYTDLTGKPGLPAPWTFGLWL
FT                   STSFTTNYDEETVNSFVDGMLERGIHLGVFHFDCFWMKDFCWSDFTWDSRVFPDPKNML
FT                   ARLKAKGLKICVWINSYIGQESVLFEEGVKGGYFLKRKNGDVWQWDMWQPGMAVVDFTN
FT                   PEACKWFGEKLKALLDMGVDCFKTDFGERIPTDVVYYDGSDPMKMHNYYTYLYNKTVYD
FT                   VLASCKGREEAILFARSATVGGQKFPVHWGGDCWSDYESMEESLRGGLSLTMSGFGYWS
FT                   HDIGGFESTSTPDVYKRWAAFGLLSTHSRLHGSTSYRVPWAYDEEAVDVVRFFTELKGS
FT                   LMPYLYRNAVETSESGIPMMRSMVMEYTKDPNCSYLDKQYFLGDSLLVAPIFNENSMAH
FT                   YYLPKGKWTNYLTGEVKEGGRWYEEEHSYLSIPLYVKQGSIIASGPKGQGAVYEYTKDL
FT                   ELKIYELQEGVEVATTVYQETGEKAVVMSAVLNGGKITINLTSKVPVSIVLKNYVVNSV
FT                   EGVSFKVDGNDTIILAQESVVAIVAIS"
FT   gene            268918..269046
FT                   /locus_tag="Cphy_0219"
FT   CDS_pept        268918..269046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40606"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRX5"
FT                   /protein_id="ABX40606.1"
FT                   /translation="MDKRVCAEKGAHADRGAREDKGTRAEKGTRADKEIRIDKGNW"
FT   gene            269141..271306
FT                   /locus_tag="Cphy_0220"
FT   CDS_pept        269141..271306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0220"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: pdi:BDI_3104 glycoside hydrolase family 3, candidate
FT                   beta-glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40607"
FT                   /db_xref="GOA:A9KRX6"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRX6"
FT                   /protein_id="ABX40607.1"
FT                   /translation="MKKVNESVIEELLSQMTLEEKIGLIHGNGIFRSGGVERLGIPSLK
FT                   MSDGPMGVRREFEDNRWFLACKTDDYVSYLPSNSAIAATWNKDLAYTSGQVLGSEARGR
FT                   GKDVILAPGINIKRSPLCGRNFEYMSEDPKLIEELASFMIQGIQENDVAACVKHFAVNN
FT                   QETDRLAVDTDLEDRALFEIYLPGFKAAIKNGESYSIMGAYNKFRGAQCCENSYLLGTI
FT                   LREEWEYDGTIISDWGGVHDTKAAANSPLDIEMDVKPNFDEYNMANPLLEAVHRNEISE
FT                   AEIDKKVRNILRLMLRLKMIGEESEQRESGTYNMISHQQEILKVARESIILLKNEEDRL
FT                   PLKKNIKKLAVIGQNANILHAAGGGSAEVKALYEISPLLGIRMELGGNTEVTYRPGYYV
FT                   SYQKVFDIIGYQETSTDVMAERAKRKQVWLELEKEGKEKRKAEEKRLREEAVLLARETE
FT                   DVILVVGLDHHQDMEGRDRKRYELPYAQEKLIEEVLDANPNTILVVCAGSPVSMQKFSN
FT                   KAKTIVWSYYNGMQGGKALADVLFGIVNPSGKLPESMPKELNDCPAHKFGEFGTKGSVY
FT                   YNEGIMVGYRYYDTENITPEFCFGHGLSYTNFTYKNLTVRANKGKGAFLSFSIRNTGKT
FT                   AGAETIQVYVSDPVCSVKRPIHELKGFTKVFLQPGEEKELMMELKPSAFTYYCTESKKF
FT                   VLEGGEFIIEVGSSSRDIRLSKMVRIE"
FT   gene            271681..273153
FT                   /locus_tag="Cphy_0221"
FT   CDS_pept        271681..273153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0221"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="KEGG: ckl:CKL_1456 GluS; TIGRFAM: glutamyl-tRNA
FT                   synthetase; PFAM: glutamyl-tRNA synthetase class Ic"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40608"
FT                   /db_xref="GOA:A9KRX7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KRX7"
FT                   /protein_id="ABX40608.1"
FT                   /translation="MAKVRTRFAPSPTGRMHVGNLRTALYEYLIAKHEGGDFILRIEDT
FT                   DQERLVEGATEIIYRTIAKTGLIHDEGPDKDKGFGPYVQSERQATGIYLKYAKELVENG
FT                   EAYYCFCTKERLETLKSAVGEEDGESKEITKYDKHCLHLSKEEVEANLAAGMPYVIRQN
FT                   MPTEGTTSFTDAIYGTITVENSELDDMILIKSDGFPTYNFANVIDDHFMEITHVVRGNE
FT                   YLSSTPKYTRLYKAFGWEEPVYIHCPLITNEEHQKLSKRSGHSSFEDLIEQGFVTEAIV
FT                   NFIALLGWSSTTNEEIFSLEELVREFDYTHINKSPSVFDMNKLRWMNGEYIKRMDSEKY
FT                   YEYALPQIKKVVTKDYDLKFIADLVKTRIETFLDIAEMIDFFDELPEYDIAMYTHKKMK
FT                   TDSENSLKVLQDVLPRFEELTCYSVSSIESVLMGYIAENGIKNGQGLWPVRTAVSGKQS
FT                   TPGGAYEIMSILGKEESLRRIRIAIDKLSSSL"
FT   gene            273457..275457
FT                   /locus_tag="Cphy_0222"
FT   CDS_pept        273457..275457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0222"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: amt:Amet_2202
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40609"
FT                   /db_xref="GOA:A9KRX8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRX8"
FT                   /protein_id="ABX40609.1"
FT                   /translation="MKTVNEAQERAIKHHKGPMLVLAGPGSGKTLVIIRRTQYLIEQHG
FT                   ISPNNILVITFTKAAAMEMQERFDRLMGQGRFGVNFGTFHAIFFKILRFAYNYSVSNII
FT                   TEEERYRLLRDIIQSMELEIEDEKEFLEGIGSEISLVKGENMDISHYYSMNCSEETFQE
FT                   IYKEYDKKLRHQNKIDFDDMLLLCYELLIERPDILSLWQQKYQYILIDEFQDINRIQYE
FT                   IIKMLAKPKNNLFIVGDDDQSIYRFRGAKPEIMLSFEEEYKGVKKVVLNKNYRSKGNII
FT                   TGALKVVGNNKKRFPKEIQSIHEPGNEINVKSFSDLPAQNQAILEEIDHYRKMGMRYSQ
FT                   IAVLYRTNTQPGSLVTKLMEYNIPFKMRDSLPNIYEHWIAKDLICYIKLSMGIRERGLF
FT                   LQVMNRPKRYISREALEQTDVDLNTIREFYMEKPYVVERIDKLVYDLTLIRRTNPYAAI
FT                   NYIRRAVGYDDYLKEYAAFRRIKVEELYDILSELQEESREYKTHEEWLNHIDEYKDGLK
FT                   EQALKQNQKDVDGVILTTFHASKGLEFDVVILMDANEGITPHKKAVVPEDMEEERRMFY
FT                   VAMTRAKSFLHIFYVKQRYNKELSPSRFVGELLVSPMELREGMRIHHSIYGEGSIKKME
FT                   ENKLTIQFDKIFLPKVLDMEFCIRNQMIKVV"
FT   gene            complement(275696..276031)
FT                   /locus_tag="Cphy_0223"
FT   CDS_pept        complement(275696..276031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0223"
FT                   /product="protein of unknown function DUF1292"
FT                   /note="PFAM: protein of unknown function DUF1292; KEGG:
FT                   amt:Amet_0705 protein of unknown function DUF1292"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40610"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRX9"
FT                   /protein_id="ABX40610.1"
FT                   /translation="MDKHGDDCNCSSDEFFHDQVTLTLEDDTEVVCDIIAVFPCGEKQY
FT                   IALLPEDAGEEGEVFLYEFIQNGDEIELESIEDDAEFEAVSEAFDEFIDSEEFDEMFGD
FT                   EEAEDEE"
FT   gene            276345..278903
FT                   /locus_tag="Cphy_0224"
FT   CDS_pept        276345..278903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0224"
FT                   /product="DEAD_2 domain protein"
FT                   /note="PFAM: DEAD_2 domain protein; SMART: Helicase-like,
FT                   DEXD box c2 type; helicase c2; KEGG: cth:Cthe_0289 DEAD_2"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40611"
FT                   /db_xref="GOA:A9KRY0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRY0"
FT                   /protein_id="ABX40611.1"
FT                   /translation="MPDTDLKSIKISVRNLVEFIMKSGDLDNSVGKRDPDAMQEGSRLH
FT                   RKIQRRMGPEYKPEVALRVTVPVSREDIEFELIIEGRADGIITNIEPTKEDNPILEEKP
FT                   TLEEKPTLEEKPILEGKPILEGNPILEENPTLGEHHPSEEHPSKQNGAEGNIHVIIDEI
FT                   KCVYADISQITEMIPVHRAQALCYAYIYAKERVLDTISIQITYCHLETEAIRILSEELK
FT                   FKELSNWFQNLIQEYCKWAAWQIKWMESRNESIKQIEFPFEYRPGQRDLVTGVYRTIIR
FT                   DKKLYIEAPTGVGKTISTVFPTVKAMGEGFVSKIFYLTAKTITRTVAEDTYQLLLERGL
FT                   SMKLVTITAKDKICILDKPNCNPAACERAKGHYDRVNDAVFDLLTSESRISRELIEQYA
FT                   MKHCVCPFEMCLDVTLWADGIICDYNYAFDPNVYLRRFFENDKKQDYVFLIDEAHNLVD
FT                   RAREMYSAMLYKQDFLTVKGIVKDKSKTMVKRLEACNEVMLRLKRGCDDIEVLQDVNDL
FT                   VLPLLRLMSEYEEFFKEYGDFEGREVVSQLFFDLRKFLAIHDILGEDYLIYSDYDERGE
FT                   FRVKLLCMDPARNLLTCLNKGRSSIFFSATLLPITYYKEQLGGSEEDYAIYAPSPFEVS
FT                   KRLLMIAKDVSTKYTRRGQDEYERIVSYIEGFVNAKVGNYFVFFPSYQMLQQIAQLSED
FT                   RIPNLLLQKTSMGELEKEEFLAAFEENPTNTKVGYCVMGGIFSEGIDLKKDRLIGAVIV
FT                   GTGLPQVGNERELFRGYYDDRNGSGFDHAYLYPGINKVLQSAGRVIRTVEDKGAILLLD
FT                   ERFLNSQYKNLFPREWEQYDIVNQEKMQELLEDFWSQKNE"
FT   gene            complement(279075..279992)
FT                   /locus_tag="Cphy_0225"
FT   CDS_pept        complement(279075..279992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0225"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="PFAM: diacylglycerol kinase catalytic region; KEGG:
FT                   tva:TVAG_429710 conserved hypothetical protein Pfam:
FT                   DAGK_cat DAGK_acc"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40612"
FT                   /db_xref="GOA:A9KRY1"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRY1"
FT                   /protein_id="ABX40612.1"
FT                   /translation="MYHFIINPHSKTGKAKELWQGLRQRLENESINYKEYFTTGHGHAT
FT                   QIAKEICTIDNERKTIVIVGGDGTANEVINGIDNYEDVLLGYIPMGSSNDLARGLLLPK
FT                   NPAEALDRVLNPRKIRAVDHGQVTFEDGLPRRFSVSSGIGYDAAICQVAQTTKIKNFLN
FT                   KIGIGKLTYFLIGVKEIFANKPCDATVIADGITYSVKNLIFMASLIHKCEGGGLLMAPD
FT                   ASDNDRKLSICLVSNIPKLKILFVMPTIFLGKHTKIKGVQMITCSSVSIHTQSPLYVHT
FT                   DGEVLGEHTDLTLRCTSEQVNIIT"
FT   gene            280345..282126
FT                   /locus_tag="Cphy_0226"
FT   CDS_pept        280345..282126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0226"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   slo:Shew_1130 protein of unknown function DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40613"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRY2"
FT                   /protein_id="ABX40613.1"
FT                   /translation="MKDLKKRGKQGLVTIALSLSILVTGCANKEKPKDLTFEDYSNQMF
FT                   QEIVSSSAITYSQFIEDPENFGITEYDHVLATLSKKEYDKSIKQCEEDLAQLLKFDYDT
FT                   LTTAQKIDYDITKGMLERSIASKDSYYYSEPLSPLDGDHITLSGIVSLYGNRYFQTLVE
FT                   KEKGNKKEVEKFFEIYEMIGKYFNEVAQYEKEKAKAGLFMNSSRAEVVRKACLSVVNNN
FT                   ASDYKKTFQEEVTKLSFLSDSEKKELIEQSDSLVEKHIVPAYQKLVDTMNDLKDQGGKS
FT                   KGFYETEAGKIYYENLLKSTCSVNATPEELMKLLEENLAVFVNEKDQILADHPNIENEI
FT                   VISARQWPDAESITKMLSNKAKEDFPDADLAWGVKEMPTCMNSFAGGLFYPFAIDSTLK
FT                   EEYIYLGTMNAPGTLSFLQVLAHEGVPGHLFHYNYLNDIGTTDYRKVLAWAGTGLVGYL
FT                   EGWTTYVEEIGYSYGGLSDVQAREAQLNRLIEITLVTMVDIGVNYYGWENDKISEVISQ
FT                   YAPQYLIMSTYIKSIVEESPGLYSSYAVGYLYTKHIIDAINEKSGGTMSKKEVHEKYLS
FT                   VGPVTYDILMRELGVAQ"
FT   sig_peptide     280345..280434
FT                   /locus_tag="Cphy_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.606 at
FT                   residue 30"
FT   gene            complement(282192..283226)
FT                   /locus_tag="Cphy_0227"
FT   CDS_pept        complement(282192..283226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0227"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: amt:Amet_1262 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40614"
FT                   /db_xref="GOA:A9KRY3"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRY3"
FT                   /protein_id="ABX40614.1"
FT                   /translation="MLTVNENREFDALALGEILLRLSAPSNERIVRGDTFEKCAGGAEL
FT                   NVVSGISMMGLRTGIISKVPQNDIGTYVKNHLRFCGVSDDCLIFDESRDARLGIYFYEN
FT                   GAYPRKSSVVYDRRNSSINTISMDDIPESTFSSTKLFHTCGITLALSPQTRDVTEECIK
FT                   KFKEQGALISFDVNYRANLWDEATAKEYIERILPYVDILFVSEETSRRTFGKTGTIKEI
FT                   MKSYTEDFNIKIVATTERIVISPKKHTFGSTIYNAVEDKFYEEAPYQNIEVIDRIGSGD
FT                   AYVSGVLYGLLAYDDCQKALEIGNAASAVKNTIPGDLPSTDLKEIQKIISSHQNIGPQS
FT                   EMNR"
FT   gene            283704..284357
FT                   /locus_tag="Cphy_0228"
FT   CDS_pept        283704..284357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0228"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nar:Saro_1184 endo alpha-1,4
FT                   polygalactosaminidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40615"
FT                   /db_xref="InterPro:IPR025648"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRY4"
FT                   /protein_id="ABX40615.1"
FT                   /translation="MRNKKLMALSLVAVLAFTACGKKETNEPTPTPTVAPTETPAATET
FT                   PTETPAEPGTDGSGEELGATELTSNETLDKIHEEVKAAYGDNYLPNMPFTVENLDEMFG
FT                   IKADWYDAAIAEGPMMSAHVDKLIGIHVTEGNLENVQNALNEYQKKIATDIQYPMNLPK
FT                   VQASVVETAGDYVFFVMLGTIDEMKYTEDSDMIKAFGEQNQIAVDIIKKNIEAK"
FT   sig_peptide     283704..283769
FT                   /locus_tag="Cphy_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 22"
FT   gene            284607..285221
FT                   /locus_tag="Cphy_0229"
FT   CDS_pept        284607..285221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0229"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   amt:Amet_3127 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40616"
FT                   /db_xref="GOA:A9KRY5"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRY5"
FT                   /protein_id="ABX40616.1"
FT                   /translation="MNNADNFSSVGKDISSKEGVQSEQDKIIYQNFLDGDMEAFEELVI
FT                   KHKDRLIYFIQRLVNNLTIAEDLAQDAFVEVLVHKERYHFQVSFKTYLFTIGRNKAIDY
FT                   IRKNKRMMLVEDYPESYDEENRMEENIIRKEESKLLYDAMKKLKPDYKAAISLIDLEQM
FT                   SYAEAAKVLKKSDAQMKVLIYRARKSLAKLMEKEGYSYENK"
FT   gene            285208..285843
FT                   /locus_tag="Cphy_0230"
FT   CDS_pept        285208..285843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40617"
FT                   /db_xref="GOA:A9KRY6"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRY6"
FT                   /protein_id="ABX40617.1"
FT                   /translation="MKTNREFIEGIYKKAELLRQQKENSKSESWHLRFLRFNREKKRVP
FT                   AFAASLATFALFALVIITGSQAGKSPNIDNIENKHLRTVEGQNPIANVSAYGIDEDVSN
FT                   ENINTVLGVITEVVDIQNQKYINIQVSKLLCGEGTPDYITITEGLPLTITTESLKEMNV
FT                   IVSVKPILGQEEYALIDENSIYFYAKEENNQNYYQAIDGTIVSEDSFK"
FT   gene            285891..287309
FT                   /locus_tag="Cphy_0231"
FT   CDS_pept        285891..287309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0231"
FT                   /product="membrane bound O-acyl transferase MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase MBOAT family
FT                   protein; KEGG: cno:NT01CX_1336 alginate O-acetylation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40618"
FT                   /db_xref="GOA:A9KRY7"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRY7"
FT                   /protein_id="ABX40618.1"
FT                   /translation="MVFSSLPFLFRYLPIVLILYFIAPRKYRNAVLFFTSLVFYAWGEP
FT                   IYVLLMLFSTLVDYTHGMLVHHFKQKGEITKAKIALSSAMIINISLLGFFKYSDFAISN
FT                   INALTGSDIGLLKLVLPIGISFYTFQTMSYTIDIYRGEAEVQKNIISFGAYVVLFPQLI
FT                   AGPIVQYKTIAKQLQERREDFDQFSYGVLRFMSGLGKKVLLANNIGILWDRISVTPNGE
FT                   LTVVTAWLGITAFAFQIYFDFSGYSDMAIGLGNMLGFQFLENFNYPYMSKSITEFWRRW
FT                   HISLGTWFRDYVYIPLGGNRCGLGKQIRNIAIVWFLTGFWHGASWNFIMWGVYFGVILI
FT                   LEKFVLLKFLNKLPSFLSHIYAIVLVWIGWAIFAFDDFSKGINYIKAMFGVNTIGFIND
FT                   NARYLLMNYAIILIVLILGSTDLPKRVANRLVGEHSEKKTTAVVQGLFIVGVFVISVAY
FT                   LVDASYNPFLYFRF"
FT   gene            287321..288520
FT                   /locus_tag="Cphy_0232"
FT   CDS_pept        287321..288520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ctc:CTC00591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40619"
FT                   /db_xref="GOA:A9KRY8"
FT                   /db_xref="InterPro:IPR025945"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRY8"
FT                   /protein_id="ABX40619.1"
FT                   /translation="MSEVNKNLEAIPNPPTVKKGKGKGQRAKYSNVIIFLVLIYVLTIA
FT                   SMVKPVKGYSESENRVLEGRPKFSLESLFNGTFISKYETFVTDQFVSRDAWIGIKTRTE
FT                   LAMLKKDINGVYIGKDGYLIEKVDNSDLEMEQVNRNEKRLYAFINKYKEQLGDEHVFAM
FT                   IAPTAFEILKDKLPPYASGFDQGAFLDRLDEALANQFIDLRETLTEHKKDYIFYRTDHH
FT                   WTTLGAYYAYVEWANKIGETPMSQDEFEIKKISNDFLGTIYSKINLKLSSDDMYLYDSG
FT                   KNYTVEYNMDGVKKNSLYEMSHLDTKDKYSVYLGGNNPVVKIDSDNHNGKKLLIIKDSY
FT                   AHSFAPFAANHFETTYMVDLRYFNMPMSRFIEENGITDVLVLYNVNTYVKEKSLDNMVR
FT                   "
FT   gene            complement(288696..289409)
FT                   /locus_tag="Cphy_0233"
FT   CDS_pept        complement(288696..289409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0233"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   oih:OB0869 1-acyl-sn-glycerol-3-phosphate
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40620"
FT                   /db_xref="GOA:A9KRY9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRY9"
FT                   /protein_id="ABX40620.1"
FT                   /translation="MKRILLMLLRSFFNLPIWFFQLKRLCNIEKHDRFERYAWLHKNAP
FT                   VANRRGRVTIDCHGLENLPKEDGYILFPNHQGLFDALAFLETHERPFVTVMKKEVKDIF
FT                   FLRDVIKLLQAEIIDREDIRQSMTVIKNMTTRVKGGENFVIFAEGTRSKNGNQIGEFKG
FT                   GSFKSAMNARCPIVPVALIDAFKAFDTNSIKKITVQIHYLKPLYYDDYKGMKSTEIAEL
FT                   VENMIKETIAKFAQE"
FT   gene            complement(289502..290617)
FT                   /locus_tag="Cphy_0234"
FT   CDS_pept        complement(289502..290617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0234"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; sigma-70 region 1.2;
FT                   KEGG: csc:Csac_0883 RNA polymerase, sigma 70 subunit, RpoD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40621"
FT                   /db_xref="GOA:A9KRZ0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRZ0"
FT                   /protein_id="ABX40621.1"
FT                   /translation="MEEQVNTFEARLKELIAFANDNKGVIEVDKVNDFFKELNLNVRQI
FT                   DKIYEYLEANNIVVLNPTDEDEPNEDALLELEDDSDMIGDTEDLSAMTSTISDDPVKQY
FT                   LKEIGSYPLLSVAEEIELAKKIEAGDNMAKQILAESNLRLVVSIAKRYVGRGLSFLDLI
FT                   QEGNLGLIKAVDKFDYNKGYKFSTYATWWIRQAITRSIADQSRTIRIPVHMSEVINKTY
FT                   RVSRNLLQELGREPSEQELADAMNLPIEKVREILKVSADPISLDTPIGEEDDSHLGDFI
FT                   KDDTIMGPEDAASYAVLQDQISKLLDTLTEREQRVLILRFGLQDGRSRTLEEVGKEFNV
FT                   TRERIRQIEAKALRKLRHPSRARMLKGYELN"
FT   gene            291402..291824
FT                   /locus_tag="Cphy_0235"
FT   CDS_pept        291402..291824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0235"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: cdf:CD0068 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40622"
FT                   /db_xref="GOA:A9KRZ1"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KRZ1"
FT                   /protein_id="ABX40622.1"
FT                   /translation="MPTFNQLVRKGRKTMEKNSQAPALQKGFNSLRKKTTDASAPQKRG
FT                   VCTAVRTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLP
FT                   GTRYHIVRGTLDTAGVAKRRQARSKYGAKRPKEAKK"
FT   gene            292063..292533
FT                   /locus_tag="Cphy_0236"
FT   CDS_pept        292063..292533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0236"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: cbf:CLI_3667
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40623"
FT                   /db_xref="GOA:A9KRZ2"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KRZ2"
FT                   /protein_id="ABX40623.1"
FT                   /translation="MPRKGHIQKRDVLADPIYNNKTVTKLINNIMLDGKKGTAQKIVYG
FT                   AFEKVAEKSGKDATEVFEEAMNNVMPVLEVKARRIGGATYQVPIEVRPDRRQALGLRWL
FT                   TMFSRKRGEKTMVDRLAGEILDAAANTGSAVKRKEDMHKMADANKAFAHYRW"
FT   gene            292844..294961
FT                   /locus_tag="Cphy_0237"
FT   CDS_pept        292844..294961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0237"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: csc:Csac_0957 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40624"
FT                   /db_xref="GOA:A9KRZ3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KRZ3"
FT                   /protein_id="ABX40624.1"
FT                   /translation="MAGREYPLERTRNIGIMAHIDAGKTTLSERILYYTGVNYKIGDTH
FT                   EGTATMDWMEQEQERGITITSAATTCHWTLELEHKKAPGALEHRINLIDTPGHVDFTVE
FT                   VERSLRVLDSAVGVFCAKGGVEPQSETVWRQADKYNVPRMAFVNKMDISGANFFNVVDM
FT                   IKSRLGKNAVPIQLPIGKEDTFKGVIDLFEMKAYYYLDDKGEQIEIKEIPDDMKDQAEE
FT                   YRAAMIESICETDDDLIEAFLEGNEPSNEELKKALRNATISVQIIPVLCGSAYRNKGVQ
FT                   KLLDAVIEFMPAPTDIEDIKGFDEEGNEIHRISSDEEPFAALAFKIMADPFVGKLAFFR
FT                   VYSGTLNAGSYVLNATKNKKERVGRILQMHANKREDLDKVYSGDIAAAVGFKFTSTGDT
FT                   ICDEKHPVVLEAMEFPEPVIDVAIEPKTKAGQDKMGEALAKLAEEDPTFRVRTNEETGQ
FT                   TIIAGMGELHLEIIVDRLLREFKVEANVGAPQVAYKEGFTKEVDIDSKYAKQSGGRGQY
FT                   GHCKVKFSPMDVNGEKVFEFVSTVVGGAIPKEYIPAVQAGIEDAMKCGVLGGYPVLGVR
FT                   ANCYDGSYHEVDSNEMAFKIAGSMAFKDAMHKAGPILLEPIMRVEVTVPDDYMGDVIGD
FT                   ISSRRGRIEGTEDNNGSKIIRGFVPLSEMFGYSTTLRSKTQGRGAYSMFFSTYEPVPKN
FT                   VQEKVLSNKTK"
FT   gene            295200..296393
FT                   /locus_tag="Cphy_0238"
FT   CDS_pept        295200..296393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0238"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: amt:Amet_4480
FT                   translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40625"
FT                   /db_xref="GOA:A9KRZ4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KRZ4"
FT                   /protein_id="ABX40625.1"
FT                   /translation="MGKAKFERNKPHCNIGTIGHVDHGKTTLTAAITKTLHDRLGTGEA
FT                   VAFDKIDKAPEERERGITISTSHVEYESKARHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVAATDGVMAQTKEHILLSRQVGVPYIVVFMNKCDMVDDPELLELVEMEIRELLSEYE
FT                   FPGDDTPIIQGSALRALEDPNSQWGDKILELFDAVDTWIPDPQRATDKPFLMPIEDVFS
FT                   ITGRGTVATGRVERGVLHVSEEVEIVGVKEETRKVVVTGIEMFRKLLDEAQAGDNIGAL
FT                   LRGVQRTDIERGQVLCKPGTIKCYKKFTAQVYVLTKDEGGRHTPFFNNYRPQFYFRTTD
FT                   VTGVCNLPEGVEMCMPGDNIEMNIELIHPIAMEQGLGFAIREGGRTVGSGKVATIIG"
FT   gene            296631..297458
FT                   /locus_tag="Cphy_0239"
FT   CDS_pept        296631..297458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40626"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRZ5"
FT                   /protein_id="ABX40626.1"
FT                   /translation="MNMQNKTVFHRKFGKGIIVDLNQNKLSVQFDAGKKIFVYPDAFRQ
FT                   FLVLMEKDGKSYVDGMLKELDRKEEISNRIARKMERHNQLIDKLKLHPSSQIVIRFVEN
FT                   DKATFLEDKIINTGLIQTGKTKGSPVRPSRLHQNSACILTERNEEEDESSRTIFGIAMV
FT                   EEDFLGTDCKDGKVTLHSQYVLLLPDHLQKLKFWNYYTDERYPEKLVWKSGEFRYCSNL
FT                   ISAQILKDIMSLPLENDAAALAEEFYHYFCEINQIEESTLPLPLGKLLEEGIK"
FT   gene            297866..299836
FT                   /locus_tag="Cphy_0240"
FT   CDS_pept        297866..299836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0240"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; KEGG: cdf:CD1616 putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40627"
FT                   /db_xref="GOA:A9KRZ6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRZ6"
FT                   /protein_id="ABX40627.1"
FT                   /translation="MILGGLSSRRGYYDEHNTRNKRKIRFFVIMGIGILSIVAFLLSLK
FT                   GMLHSEAEKKLLEYTGLSADYIKKSEAGKQFMEEKWGSGIFTIIPGAKNPTYFQGNAHS
FT                   YVVTIKGEAIGAFSESGKDALSIYGNNVIDSIETWEDTKVYQEIIDKKGLVILTKLANG
FT                   EKYYIAFTSPSWLENGYIISIVSYQEIIQEIQSVLKMAIVIVLFSLLAIILAFFYSILH
FT                   RNRIKKRRMDMGAVDKITGLPNPLLHKKKVKEKLTKGNESYAYVTFCIDNFELIYELSG
FT                   KQYCEKLLKQIASKIQIMLVDGELFTRYQNDEFGMLLEYHGELNLRKRLVEMFKYAGDL
FT                   PQEDNNFCSITFQCGVCEMKKNMDVKDLIQYARQVRNNEVNGYTPNIEFYNKKEEKGEQ
FT                   PKIEEITNALSHNEFLVYLQPILQLDTKRIAGAEALVRWNHKMDGILPPNVFLPMLEED
FT                   GSIVKLDMYVLEEVCEYLRDWMDKGKRAVPISVNLSGKHLERPEFITELVEIVDYYQIP
FT                   HELLEFEFSEVNLYGAMDMMKNAIQKLRELGFLIAIDQFGAGFSSLQLLKELPIHVLKI
FT                   DKKLIMNLEDSEFSNQEKTIVMHILSFAKARNLTVIAEGVETKEQQDLLIDQQCDMMQG
FT                   FYYQKPMPSEEFERLLDASGA"
FT   gene            complement(299816..300436)
FT                   /locus_tag="Cphy_0241"
FT   CDS_pept        complement(299816..300436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40628"
FT                   /db_xref="GOA:A9KRZ7"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRZ7"
FT                   /protein_id="ABX40628.1"
FT                   /translation="MKKWINFEVSMNTTKMERKKITHEIHLVSNYRALLIAKHIGTLLL
FT                   ILYFAPAAITGFDESPALYILLLHNILPAVFFFLFTNKNNSNTKSPRILKPSAYDEVKE
FT                   EPKKKHTLSFSFAKEMEADTPLLPQLKKKYQYSRVKYQSNSISFLLTCFFLYLWQQQDL
FT                   TQTNFYLYRYMPVAILAVIVLTRFICIIFYECYIHYSLRSGGI"
FT   gene            300818..301807
FT                   /locus_tag="Cphy_0242"
FT   CDS_pept        300818..301807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0242"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell division protein FtsA; cell shape
FT                   determining protein MreB/Mrl; KEGG: cth:Cthe_2619 cell
FT                   shape determining protein, MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40629"
FT                   /db_xref="GOA:A9KRZ8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRZ8"
FT                   /protein_id="ABX40629.1"
FT                   /translation="MLGCDIGIDLGTASVLVYIKGKGVVLKEPSVVAFDRDTNKIKAIG
FT                   EEARLMLGRTPGNIVAVRPLRQGVISDYTVTEKMLKYFIQKAVGKQRFRKPIISVCVPS
FT                   GVTEVEKKAVEDATYQAGARDVAIIEEPIAAAIGAGIDISRPCGNMIVDIGGGTTDIAV
FT                   ISLGGTVVSTSIKIAGDDFDEAIVRYMRKKHNLLIGERTAEDIKIKIGSAYRRPEVVAM
FT                   DVRGRNLVTGLPKTISVTSEETEEALKETTSQIVEAVHSVLEKTPPELAADIADRGIVL
FT                   TGGGCLLYGLEELIEEKTGITTMTAEDPMTAVAIGTGKYVEFLSGKKD"
FT   gene            301931..302704
FT                   /locus_tag="Cphy_0243"
FT   CDS_pept        301931..302704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0243"
FT                   /product="flagellar basal body rod protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; KEGG: pth:PTH_2067
FT                   flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40630"
FT                   /db_xref="GOA:A9KRZ9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRZ9"
FT                   /protein_id="ABX40630.1"
FT                   /translation="MVRGLYTGWTGMENEQKRLDIISNNLANSATVGYKKEGVTNQSFD
FT                   DVLTLKIRDESENFTDKRIGKMTLGVKLGEVYTDYTQGSLRETGNTFDFAIEGSGFFKM
FT                   EVLDKDGNSKERYTRAGQFLMDKEGYVVDVNGNHLMSEGGYLQVPTDASQIVIDLQGNV
FT                   FADGAQVDKLVVTDFENYDYLKKFGESMYEAVDGARVKDTAAGIRQGYTEQSNVNVVSE
FT                   MVNMIAITRAYEANQKVLQSIDGTLELAANSIGKI"
FT   gene            302817..303632
FT                   /locus_tag="Cphy_0244"
FT   CDS_pept        302817..303632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0244"
FT                   /product="protein of unknown function DUF1078 domain
FT                   protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; KEGG:
FT                   cth:Cthe_2621 protein of unknown function DUF1078-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40631"
FT                   /db_xref="GOA:A9KS00"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS00"
FT                   /protein_id="ABX40631.1"
FT                   /translation="MMRALWTGASGMISQQTSLDTISNNLSNINTAGYKKENAQFSSLL
FT                   YSKIQSKVTDSEGKVKPVIGQVGSGVRVTGIVSSFTQGTLQESNNDWDLAISGNGLFSV
FT                   RDSDGNTAYTRNGSFHIAIGAEGVTLASADGYPVLNTKGQPVVFNNNWDISKVTMDEYG
FT                   NLMYPDANNIAQRTGIQIGLTQFVNPAGLEKAGGSLFYETESSGAPLKEVENNNLKQSK
FT                   IHTGYLEASNVQTADEIVNLIVTQRAYEMNSKVITAADEMLQQANNLRR"
FT   gene            303737..304081
FT                   /locus_tag="Cphy_0245"
FT   CDS_pept        303737..304081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40632"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS01"
FT                   /protein_id="ABX40632.1"
FT                   /translation="MSISVGSDAMFQTLTQTAQSTSKTSKLENSLVKDVKTASDEELME
FT                   SCKSFENYLVEQVMKQVKNTIAKSDDDENEYMSYFGDMLYQSYAKDITESGQLGIAKQL
FT                   YEAMKRDQNT"
FT   gene            304326..306554
FT                   /locus_tag="Cphy_0246"
FT   CDS_pept        304326..306554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0246"
FT                   /product="helicase, RecD/TraA family"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: amt:Amet_0722 helicase, RecD/TraA family;
FT                   TIGRFAM: helicase, RecD/TraA family; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40633"
FT                   /db_xref="GOA:A9KS02"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS02"
FT                   /protein_id="ABX40633.1"
FT                   /translation="MAEELKGYVERIVYRNAENGYTVLSLSAEEDEVTCVGTFSFVNEG
FT                   EYLSLTGSYTAHPLYGEQFQVSSYEMKEPEDLLSIERYLGSGAIKGVGTALAARIVRKF
FT                   KEKTFVIIEEEPERLSEVKGISDKLAREIYRQFSEKREMRSAMLFLQQYGISLNLAVKI
FT                   YKQYGERMYEVIKENPYRLAEDISGVGFKIADEIASRIGIRTDSDYRVKAGILYNLLLA
FT                   SGNGHVYLPMHSLVGKTCEMLMVEADTVKRHITSLALEKKLVVKESGEEQHVYSTSFYY
FT                   MELNVANMLSDLSISYDISPAQVETRLAKIEQETNLELDEMQRYAVMEAVRSGLLIITG
FT                   GPGTGKTTTINTILRFFEAEGMDMLLAAPTGRAAKRMKETTGYEASTIHRLLELTKGMD
FT                   DKDGRMSFERNELNPLEADVIIIDEMSMVDISLMHSLLKAITVGTRIILVGDVNQLPSV
FT                   GPGNVLRDMIESKAFPVVMLKKIFRQASESDIIVNAHKINSGEHITLDNKSKDFFLLKR
FT                   DDVNVIISVIISLVRDKMPKYVNASVYDIQVLTPMRKGELGVERLNQVLQQYLNPSSQE
FT                   KKEKEHFGGIFREGDKVMQVKNNYQIAWETKSRYGITIDSGTGVFNGDTGVIKEINLFA
FT                   EELTVEFDEGRLVTYPFSQLEELELAYAVTIHKSQGSEYPAVVLPIYSGPRMLFNRNLL
FT                   YTAVTRAKQCVTIVGSDNMVQSMIDNESELKRYSGLQSRIMERKQILS"
FT   gene            306745..307665
FT                   /locus_tag="Cphy_0247"
FT   CDS_pept        306745..307665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bfs:BF3922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40634"
FT                   /db_xref="GOA:A9KS03"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS03"
FT                   /protein_id="ABX40634.1"
FT                   /translation="MNKTTLVIMAAGIGSRYGGGIKQLEKVGPSGEIIMDYSIYDAIEA
FT                   GFSKVVFIIRHDLEKDFKEIIGSRIEKEIEVEYVYQELDKLPAGFSKPEDRTKPWGTGQ
FT                   AVLCCKGVVNEPFAVINADDYYGKEAFVKVQNFLRNVDTYNKENEYCMAGFVLGNTLSD
FT                   NGIVTRGVCNVDESGYLSHVEETFGIEKQGDVAVGKDGNGNPVTITLDSSVSMNMWGFI
FT                   PNFLQELETGFIDFLQGLDKNNTKAEYLLPNVVGKMVSEDRAKVKVLRTNDKWFGVTYK
FT                   EDKQLVVDSILELIAQGKYPNKLFN"
FT   gene            307688..308425
FT                   /locus_tag="Cphy_0248"
FT   CDS_pept        307688..308425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0248"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="KEGG: tte:TTE0490 predicted
FT                   amidophosphoribosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40635"
FT                   /db_xref="GOA:A9KS04"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS04"
FT                   /protein_id="ABX40635.1"
FT                   /translation="MWRMVWREILDAVYPKRCPICNEILVPKDRKICSICSEELPVLME
FT                   PRCKKCSKPVLAEEQEYCFDCVKKQHHYTRGFACFLYNEKLKKSLSEFKYHAKKEYAEF
FT                   YVDYMVSNLGDWIYKTKAEVLIPIPLHKNKYKQRGFNQAQLLAEGLSKALSIPVDTKLL
FT                   VRTMDTKPQKKLDNKERMKNLEKAFSVSTNVKKSEELFPYKRVILVDDIYTTGSTIEAC
FT                   TNVLQKAGCLEVFFVTVCIGNGF"
FT   gene            308496..308897
FT                   /locus_tag="Cphy_0249"
FT   CDS_pept        308496..308897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2247 regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40636"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS05"
FT                   /protein_id="ABX40636.1"
FT                   /translation="MDVRNCRSCGKLFNYLSGVQFCPACMRELDKKFEVVKNYIYDNPK
FT                   ANIQEVAEVNEVTVQQLRQWVREERLAFSEDSLVGLECENCGTMIRTGRFCNLCKDKLV
FT                   NTLGSAYKTDDPKGSKDYRDHAKMRFLDN"
FT   gene            complement(309186..310025)
FT                   /locus_tag="Cphy_0250"
FT   CDS_pept        complement(309186..310025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0250"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   cbh:CLC_1722 RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40637"
FT                   /db_xref="GOA:A9KS06"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS06"
FT                   /protein_id="ABX40637.1"
FT                   /translation="MIQLGKIQTLTVAKTTDFGVYLADNDNSRKEDTILLPKNQVAAGT
FT                   KIGDQLSVFVYKDSEDRPIATQTTPKLTLKEIAVLKVKEVTTIGAFLDWGIAKDLFLPF
FT                   KEQTHPVIADEEVLVSLYIDKSKRLCATMKIYDMLQTDSPYGKDDKVTGIVYEIIPAFG
FT                   AFVAVDNKYSALIPNKELHTKLNPGETVTARVTMVQADGKLDLSLREKTYLQLDSDAEI
FT                   IYEKLTAAGGFLPFHDKSEPDAIKKEFNLSKNAFKRAIGRLMKDNKIKILEDGIQIV"
FT   gene            complement(310038..310751)
FT                   /locus_tag="Cphy_0251"
FT   CDS_pept        complement(310038..310751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0251"
FT                   /product="acyl-ACP thioesterase"
FT                   /note="PFAM: acyl-ACP thioesterase; KEGG: cbf:CLI_3859
FT                   acyl-ACP thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40638"
FT                   /db_xref="GOA:A9KS07"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS07"
FT                   /protein_id="ABX40638.1"
FT                   /translation="MYSFDSRVRYSEVDHNKVMTASTIINYFQDCSNFQSDSLGVGIEE
FT                   LTKRSRVWIMSSWQLVINRYPTIGEQITIGTWPYKYNGIYGYRNFILYDEKKEVAAVAN
FT                   SIWVLMDTNLNRPVKITDEDYQAYRNEPAYPMEYADRKIRVPKELTSLTPFTVMPSFID
FT                   VLNHVNNAQYIRMATDYVDENFQITQMRADYRKSALLGDIIYPKISKTNDCITIVLSDK
FT                   EGQPYVTVAFYGTTV"
FT   gene            311051..312250
FT                   /locus_tag="Cphy_0252"
FT   CDS_pept        311051..312250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0252"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   amt:Amet_1623 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40639"
FT                   /db_xref="GOA:A9KS08"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS08"
FT                   /protein_id="ABX40639.1"
FT                   /translation="MNYVRKINIVFLFTITTIFISNFIPFRDFVSNEAFLLLISQAIIA
FT                   GPSIVFLIVESRRQKRFSDGLEINYYSMGYGTGEDKKSIREQLCFHKVSLSNVIWLILF
FT                   TICITPAINFVNAISRMFSVAAINDTMLNITQKNTYLFALFCVAFVPCVMEEIVYRGLF
FT                   YQGYRRVNPLGAAFLSAFLFGILHGNLNQFCYAFVMGIVFAFVIEATDSILSTMIIHFI
FT                   MNGWSITLVYAIPRLIEYLRNMANDAIARGDQGLADSITKLIGTDQVDFKQVLQESGNA
FT                   VLSDTNFIDILRTYGLTALLGGVLAFLIYRKIAKNTGRYEYIKSLFSKNKEYRLEGNHS
FT                   IPGDEYKGEGNHYISSDEYKGEGKVKARALFTLPLLIAIAICVFFLVINELTLQGIISM
FT                   "
FT   gene            complement(312240..312416)
FT                   /locus_tag="Cphy_0253"
FT   CDS_pept        complement(312240..312416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_0741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40640"
FT                   /db_xref="InterPro:IPR025906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS09"
FT                   /protein_id="ABX40640.1"
FT                   /translation="MDIAALSMANSQANLMTQVNTAVLAMNLSSIKEMGENITKLMEQS
FT                   VTPNLGQTIDVTC"
FT   gene            312520..313446
FT                   /locus_tag="Cphy_0254"
FT   CDS_pept        312520..313446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0254"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase;
FT                   glucose-inhibited division protein A; HI0933 family
FT                   protein; KEGG: tte:TTE2220 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40641"
FT                   /db_xref="GOA:A9KS10"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS10"
FT                   /protein_id="ABX40641.1"
FT                   /translation="MNKIIHDLAIIGSGPAGLTASIYASRAELNTIVIEKEPMSGGQII
FT                   NTYEVDNYPGIPGIGGFDLAVKFREHSDKLGATHVYGEVKAFEVEDGIKKIVLDNGEEF
FT                   YAKSLIIATGAASRKLDVKGEAELQGMGVSYCATCDGAFFRGKTVAVVGGGDVAVEDAI
FT                   FLARICKEVHVIHRRDEFRAAKTFITKLLSLENVTVHWNSVVDEIVGTDAVNAVKVRNV
FT                   ATEETSELNVDGVFIAVGNVPNSEVYTPAVAVDRGGYIIADESCETNVPGIFAAGDIRT
FT                   KELRQVITAASDGAVAVTGVERYLNHL"
FT   gene            314508..315044
FT                   /locus_tag="Cphy_0255"
FT   CDS_pept        314508..315044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0255"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   cac:CAC2847 ribosome-associated protein Y (PSrp-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40642"
FT                   /db_xref="GOA:A9KS11"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS11"
FT                   /protein_id="ABX40642.1"
FT                   /translation="MRYIISGKNIDVTEGLKSAIYEKIGKLEKYFNPEAEIHVTLSVEK
FT                   DRQKIEVTIPMKGNIVRAEQVSNDMYASIDLVEEVIERQLKKYKSKLKDMNQSAANFNP
FT                   SFFEDVLNEDSDEEDINITRVKRFAMKPMDAEEACVQMELLGHNFYVFRNAETDEVNVV
FT                   YKRKGNSYGLIEPEF"
FT   gene            315431..318007
FT                   /locus_tag="Cphy_0256"
FT   CDS_pept        315431..318007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0256"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   helicase domain protein; SEC-C motif domain protein; SecA
FT                   DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region; KEGG: csc:Csac_1325
FT                   preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40643"
FT                   /db_xref="GOA:A9KS12"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KS12"
FT                   /protein_id="ABX40643.1"
FT                   /translation="MGLIKKIFGTHSEREIKLIRPTADKIEALEPDMMKLSDDELRGKT
FT                   IEFKNRLKNGETLDDILVEAYAVVREAAKRTLGNRAYYVQLLGGIILHQGRISEMRTGE
FT                   GKTLTSTFPAYLNALEGEGVHIVTVNDYLAKRDAEWMGEVHRFLGLSVGCILNDMDNDE
FT                   RRKAYNCDITYATNNELGFDYLRDNMVIYKEQLVMRDLHFAIIDEVDSVLIDEARTPLI
FT                   ISGQSGKSTRLYEACDILARQLTKGTAKELSKMDIIMKEDDQETGDFVVNEKEKAVNLT
FT                   AEGVEKVERFFKIENLADPENLEIQHNIILALRAHYLMAIDKDYVVKDDEVLIVDDFTG
FT                   RIMPGRRYSDGLHQAIEAKEHVKVKRESKTLATITFQNFFNKYTKKCGMTGTALTEENE
FT                   FREIYGMDVVEVPTNRPVARIDKDDAVYRTKREKLNAVINAIVEAHKAGQPVLVGTITI
FT                   EASEEISELLKKKNIPHKVLNAKFHELEAEIIADAGQKGAVTIATNMAGRGTDIKLGEG
FT                   VTELGGLKIIGTERHESRRIDNQLRGRSGRQGDPGESCFYICLEDDLMRLFGSERLNTI
FT                   FKSLGLPEGEQIEHKMLSGAIEKAQKKIEDNNFGIRKNLLEYDKVNNEQREIIYAERRK
FT                   VLNGDSMRDVIFKMITDNVETCVNTSISDDQLPEEWDLAELNQMLLPIIPMEPVELKDN
FT                   ELRHMKRNELIHMLKEKAVKLYEEKEAEFPEKEHLREVERVVLLRVIDRKWMDHIDDMD
FT                   QLRQGIGLQAYGQRDPKTEYKFSGFEMFDTMINAITEDTVKALMHVRIEQKVEREEVAK
FT                   VTGTNRDESVAKAPVKRATKKVQPNDPCPCGSGKKYKHCCGGVGRI"
FT   gene            318278..319279
FT                   /locus_tag="Cphy_0257"
FT   CDS_pept        318278..319279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0257"
FT                   /product="peptide chain release factor 2"
FT                   /note="TIGRFAM: peptide chain release factor 2; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   cth:Cthe_0365 peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40644"
FT                   /db_xref="GOA:A9KS13"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS13"
FT                   /protein_id="ABX40644.1"
FT                   /translation="MEEPNFWDSQEKSQAYMKELKNLKDIVSEYNGLKQQYDDILTLLE
FT                   MGYEEEDPDLIPEIEQELEQFIDALEELRLNTLLSDEYDKDNAILTLHAGAGGTESCDW
FT                   ASMLYRMYQRWADKKGYTTELLDFLDGEEAGYKSVTLQINGLNAYGHLKSERGVHRLVR
FT                   ISPFNAAGKRQTSFVSCDVMPDIEEDIDIEINDDDLRIDTYRSSGAGGQHVNKTSSAIR
FT                   ITHIPTGTVVQCQNERSQFQNKDKAMQMLKAKLYLKKKEENAAKESGIRGEIRDINFGN
FT                   QIRSYVLQPYTMVKDHRTNTDVSNALGVLDGNIDPFINAYLKWIHSSSDEES"
FT   gene            319531..319989
FT                   /locus_tag="Cphy_0258"
FT   CDS_pept        319531..319989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0258"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: maq:Maqu_1966
FT                   putative CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40645"
FT                   /db_xref="GOA:A9KS14"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS14"
FT                   /protein_id="ABX40645.1"
FT                   /translation="MEATKQVVFKLGGEEYGFDILIVNAIETYHGVVPVPNAPDYILGI
FT                   LNLRGEVIPVYSLRVKFGLPEVESTTSQLIVTKTNGMTVGFKVDAVDGIVEFSAKDLNE
FT                   VPIIIKSKKTKYAKLVANKNGKMIVLLDHDGILDDEEHESITRLLEKQ"
FT   gene            320208..322196
FT                   /locus_tag="Cphy_0259"
FT   CDS_pept        320208..322196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0259"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="KEGG: cth:Cthe_0309 excinuclease ABC, B subunit;
FT                   TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase domain
FT                   protein; UvrB/UvrC protein; type III restriction protein
FT                   res subunit; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40646"
FT                   /db_xref="GOA:A9KS15"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS15"
FT                   /protein_id="ABX40646.1"
FT                   /translation="MDHFKLVSEFAPTGDQPEALEALVKGFEEGNQFETLLGVTGSGKT
FT                   FTMANVIQRLNRPTLIIAHNKTLAAQLYGEFKEFFPENAVEYFVSYYDYYQPEAYVPST
FT                   DTYIEKDSAINDEIDKLRHSATAALTERRDVIIVASVSCIYGLGSPVDYQNMTLSLRPG
FT                   MIRDRDDVLRRLVEIQYTRNDMDFKRGTFRVRGDVVEIFPITGTDLAYRVEFFGDEVER
FT                   ITEIDVLTGEIKCTLEHMVIFPASHYVVSKDNLERAIVNIEEELEDRIRYFKSEDKLLE
FT                   AQRISERTHFDIEMLRETGFCSGVENYSMHLAGLTPESTPHTLIDYFPDDFLIMVDESH
FT                   ITIPQVRGMYAGDQSRKTTLVDFGFRLPSAKSNRPLNFTEFESKINQMLFVSATPNVYE
FT                   KDHELLRAEQIIRPTGLLDPVVEVRPVHGQIDDLVSEVNKETAKKNKVMITTLTKRMAE
FT                   DLTDYMRELGIRIKYLHSDIDTLERSEIIRDMRMDVFDVLVGINLLREGLDIPEISLVA
FT                   ILDADKEGFLRSETSLIQTIGRAARNAEGRVIMYADRITDSMDKALRETERRRKIQDEY
FT                   NEKHGITPQTIKKKVRELISISKKVSKEMYDMNIKDYESMSRKELEAVAKKLTKEMHTA
FT                   AAELNFELAAELRDKLLELKKQINELE"
FT   gene            322207..325050
FT                   /locus_tag="Cphy_0260"
FT   CDS_pept        322207..325050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0260"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: cth:Cthe_0311 excinuclease ABC,
FT                   A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40647"
FT                   /db_xref="GOA:A9KS16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS16"
FT                   /protein_id="ABX40647.1"
FT                   /translation="MADNKHFIKIRGAKEHNLKGISVDIPRDEFVVLTGLSGSGKSSLA
FT                   FDTIYAEGQRRYMESLSSYARQFLGQMEKPNVESIEGLSPAISIDQKSTNRNPRSTVGT
FT                   VTEIYDYFRLLYARIGIPHCPICGKEIKKQTVDQMVDEIMRLPEGTKLQLLSPVVRGRK
FT                   GEHTKIFEQAKKSGYVRVMVDGNLYELTEEIKLEKNKKHNIEIMVDRIVVKAGIEKRLT
FT                   DSVESVLKLSDGLLIVDVIGGEQLTFSQSFSCPDCGISMEEMEPRTFSFNNPFGACPEC
FT                   HGIGIKMEFAEELLIPDTSQSIDEGAIAAMGWASVTDKGSYTRATMEALSKEYDFSLST
FT                   PYRDYPDKVKYIIMHGTDGKTVKVHYQGQRGVGVYDVAFEGLIRNMERRYRETGSETQR
FT                   AEYETFMNTTPCKACKGKRLKREALAVTVGDRNIAEVTEISIRELHEFMNQLTLTSMQL
FT                   KIGELVLKEIRARIGFLMDVGLDYLTLARATGTLSGGEAQRIRLATQIGSGLVGVAYIL
FT                   DEPSIGLHQRDNDKLLKTLKHLKELGNTLIVVEHDEDTMFAADCIVDIGPGAGEHGGEV
FT                   VAVGTAQEIMDNPNSITGAYLSGRIKIPVPKVRKEPTGFLTIKGAKENNLRNVNVDIPL
FT                   GVMTCVTGVSGSGKSSLVTQILYKRLARDLNRARCIPGKHDDMIGIDKLDKVINIDQSP
FT                   IGRTPRSNPATYTGVFDQIRDLFAATPDAKMKGYSKGRFSFNVKGGRCEACSGDGIIKI
FT                   EMNFLPDIYVPCEVCGGKRYNRETLEVRYKGKSIYDILDMTIEEAVKFFENVPSIKRKI
FT                   ETLNDVGLSYLKLGHPSTSLSGGEAQRIKLATELSKRSTGKTIYILDEPTTGLHFADVH
FT                   KLVEILQRLSEGGNTVVVIEHNLEVIKTADYIIDIGPEGGDKGGTVIAKGTPEEIAKVK
FT                   ESYTGYYLKKYLEEVRE"
FT   gene            325091..325672
FT                   /locus_tag="Cphy_0261"
FT   CDS_pept        325091..325672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0261"
FT                   /product="metal dependent phosphohydrolase"
FT                   /EC_number="3.1.3.5"
FT                   /note="KEGG: ppd:Ppro_1070 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40648"
FT                   /db_xref="GOA:A9KS17"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS17"
FT                   /protein_id="ABX40648.1"
FT                   /translation="MEYHFYAMMSRMKYIERWALMRNAISENISEHSLEVSMLAHALAV
FT                   IGKKRFHKELNAEKAALIGLYHDATEIITGDMPTPIKYYNRDILGAFQKIEENAANQLL
FT                   GMLPEDIREEYHSIFFPEEAESYLWKLVKGADKLSALIKCMEEEKTGNTEFVKAKASIE
FT                   EALEKMELPEVELFMKEYLPSYAKSLDELR"
FT   gene            complement(325777..326940)
FT                   /locus_tag="Cphy_0262"
FT   CDS_pept        complement(325777..326940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0262"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: dps:DP1647
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40649"
FT                   /db_xref="GOA:A9KS18"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS18"
FT                   /protein_id="ABX40649.1"
FT                   /translation="MNKVELKPGIYDVGAIDWNVRMFHGYTTNRGATYNAFLIIDEKIT
FT                   LIDAVKVGFTEELLNRIREIIDPAKIDYVISNHVEMDHSGALPGVMEVAKNATLVTSAP
FT                   NGLKGLMAHYGKDYNYLPVKSGDTLSIGKRTLSFIGTPMLHWPDNMVTYCPEEKILFSN
FT                   DAFGQHYATNKRFDDEVDLDKAMQEALKYYANIIQPYQLPMKKTLPLIEALDIDMIATS
FT                   HGVIWRSHVKDIIDKYKEWSSGENEEKALVIYDSMWHSTEKMAFSIVEGLSRKGLTTHL
FT                   FDLKETHISDIMSEVLKADYIIVGSPTLNHCMLPTVASFLCYLEGLTLKNKKAFAFGSY
FT                   GWGGQSVPAVHAKLASLGYEMVLDPIKINYIPTHDQLREIEDKVAEL"
FT   gene            327680..329335
FT                   /locus_tag="Cphy_0263"
FT   CDS_pept        327680..329335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0263"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   cth:Cthe_3075 von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40650"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR021908"
FT                   /db_xref="InterPro:IPR022156"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS19"
FT                   /protein_id="ABX40650.1"
FT                   /translation="MMNQSRVLKRIALILSIILILPNVVACSSKMDRENSTTGQNGSKS
FT                   SSDINFGSQVALQDTTSLSKTESDGLYVSYKLDGDNSNNMDFSTEEYNAVIEQGYQSTK
FT                   NHPLSTFSADVDTASYSNIRRMLKEGRRVDTGAVRIEEMLNYFNYDYKLPEGDSPFGIT
FT                   TELSDCPWNPDTKLFLAGIQTEKIDFSKSAPSNLVFLIDVSGSMMDEDKLPLVQRAFLL
FT                   LTENLTEKDRISIVTYAGNDTVVLSGAKGNQKEKIQNAITELEAGGSTFGSKGIETAYQ
FT                   LAMENYIEGGNNRVILATDGDLNVGVTSESELTNLIEEKRKSGVALSVLGFGTGNIKDN
FT                   KMEALADHGNGNYAYIDSLMEARKVLVEEMGATLVTVAGDVKFQVEFNPAKVKGYRLLG
FT                   YDNRLLATEDFNDDTKDAGEVGAGHSVTVLYELVLEDSKMEIPETELKYTTTEPTNMVD
FT                   ELLTVNIRYKKPGKDKSILMSEPVGINQLADTRTDNLAFATAVAEFGLLLKDSEYKGDA
FT                   TFSKVLSRLEETNYKQDEYRAEFYQLVKLAKDIY"
FT   sig_peptide     327680..327760
FT                   /locus_tag="Cphy_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            329775..331298
FT                   /locus_tag="Cphy_0264"
FT   CDS_pept        329775..331298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0264"
FT                   /product="GMP synthase, large subunit"
FT                   /note="TIGRFAM: GMP synthase, large subunit; GMP synthase,
FT                   small subunit; PFAM: glutamine amidotransferase class-I;
FT                   GMP synthase domain protein; KEGG: cth:Cthe_0375 GMP
FT                   synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40651"
FT                   /db_xref="GOA:A9KS20"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS20"
FT                   /protein_id="ABX40651.1"
FT                   /translation="MVIVLDFGGQYNQLIARRVRECNVYCEVMPYNISLEKIKELNPKG
FT                   IIFTGGPASVYAEGAPHCDKGIFELGIPVLGICYGAQLMTHLLGGSVTSAEVREYGKTE
FT                   IKVNTTSKLFKDVAENTICWMSHTDHIKTPAEGFVVTSSSDSCPVAAVEMVDKKLYSVQ
FT                   FHPEVVHTQEGTKMLRNFLYEVCECNGDWKMASFTEESIQALRDKIGDKKVLCALSGGV
FT                   DSSVAAVMISKAVGKQLTCIFVDHGLLRKNEGDEVEQIFTTQFDVNFVRVNAQQRFYDR
FT                   LAGVTDPETKRKIIGEEFIRVFEEEAKKIGTVDFLAQGTIYPDVIESGLGKSAVIKSHH
FT                   NVGGLPEHVDFKEIVEPLRLLFKDEVRKAGLELGIPEKLVFRQPFPGPGLGIRIIGEVT
FT                   PERIKLVQEADAIYREEIANAGLDRSIGQYFAALTNMQSVGCMGDERTYDYAIALRAVT
FT                   TTDFMTAEFAELPWELLGKVSSRIVNEVKGVNRVLYDCTGKPPATIEFE"
FT   gene            332463..332927
FT                   /locus_tag="Cphy_0265"
FT   CDS_pept        332463..332927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_2840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40652"
FT                   /db_xref="InterPro:IPR025375"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS21"
FT                   /protein_id="ABX40652.1"
FT                   /translation="MTKWKKNKKVEKEGVIYLENLVNNHGSIFREVPGDKDTGIDGFIE
FT                   FVDSEEATGRLLAVQVKSGDSYYNSEKKKFILYPDQEHLDYWKSYTLPVIVVFYSPTEG
FT                   CSAWIGIEEHIKNLKYHNKPLLSRIEVNNEGYNKVGIDLDDLKELYGYEV"
FT   gene            332911..333495
FT                   /locus_tag="Cphy_0266"
FT   CDS_pept        332911..333495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40653"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS22"
FT                   /protein_id="ABX40653.1"
FT                   /translation="MDMKYDSTKLLKSLDRCFDKDSDIVYRNFQILINHPDSRDNKGII
FT                   KVARELLEGNDKEIVKEALWYLGSCVGSQRWSWNPNNIEEKNLIEFSRNICSDISSGVI
FT                   YKLLCHVDDEYFSGLMGLGERLLDIISCCYDNAYSVLDNTVLNVSEPMNRRTNALFYLY
FT                   GGDEELMEDDIKNRGNNSKYKDVFDYLTHGY"
FT   gene            333780..335354
FT                   /locus_tag="Cphy_0267"
FT   CDS_pept        333780..335354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0267"
FT                   /product="putative modification methyltransferase"
FT                   /note="KEGG: fps:FP1566 probable modification
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40654"
FT                   /db_xref="GOA:A9KS23"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS23"
FT                   /protein_id="ABX40654.1"
FT                   /translation="MDEKSTGSFYTPVNLIKYMVSYIETKRKPTSILEPSAGDGRFVDF
FT                   VRKFDIPITLIEYDKKKVNQLRKKYRGVCSIHKADFNRFAQRNNRKYDLIIGNPPYISK
FT                   KNMTKELKEQSEKVVDSFGLAKDLFQNIWVPFILSSINMLELNGRIFFILPFEFLQVQY
FT                   AEKLRIFLETKFNIIEIITFEEQIFEGIEQDICLLYLENDKIGSPYIMYRTLNNPSERE
FT                   EKFQSVIMRNKPLKKWSNCILNDNETESLFNIANKFKRVNEFGDISPGIVTGANAFFII
FT                   SKDEYCKLNVDNNIGLPIISRSKDVKDCLLFGKEDYDRLYSDNAKVTMLNLNGVVEKSF
FT                   SSELVDYLEKGKEKKINERYKCSIRNRWYDVPIIRKGTVSFFKRYSIVPRIIVNDADVH
FT                   TTDVAYNIRLKEQYDSNSFAFCFYNSLTLALCEYEGRFYGGGVGELVPNEFKGLSMPYV
FT                   KVEDEKILHLDKLFREGANIEEIVDYVDSVVFATFEENDKQLLKAIRMRYLKRRLKIYE
FT                   KEIDING"
FT   gene            335347..337563
FT                   /locus_tag="Cphy_0268"
FT   CDS_pept        335347..337563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0268"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: pfo:Pfl_4625 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40655"
FT                   /db_xref="GOA:A9KS24"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS24"
FT                   /protein_id="ABX40655.1"
FT                   /translation="MDNNVVGNVNFKFAARFSKLIGRNLISNPIVAVSELVKNSYDADA
FT                   DNITVEFKNLVTGVSQLIVKDDGDGMSLDDIQNKWMIVGTDNKIHNPNTKSGRRKLGEK
FT                   GIGRFSVERLSRKLKITTTEFGKDFALVFEIDWDKDEAEADEFGIVNHPVYKIPFERNI
FT                   KGTEIIMEELRDEWTEDSLVDLRKELNLIRPININSVSYEKYKFPGDKVKINLYAPDFI
FT                   KSVNKVDANFMSYRQAHLYGKINKDGSAIIRVSIKSNISMSGQVNEQTYTYKNEELDNS
FT                   CGPVVYEAFVFLKDKRLYRSLDIDRKYMDDFLKSYSGVKIYRDGFRILPFGNVDNDWLE
FT                   LNAQRTKSPEHRMSTQNIIGIVYITRDENPGLQDVLSRENMYETKEFDALKTFVNLSFE
FT                   KYTSLQLNARKKKEKKIREEGKKTLSNVRKSVNDFSKQVDDLKVSVKQVNVNVDTVEAV
FT                   NQVQQKLTSILQAAESSLENFKKAFSYYKFQDDFKTREMQIYRNIATLGISAAMFGHEA
FT                   LHQTLDAKAICGDIKADYSEIINSTNQLKEYFNDLEKDIGLVNEKADFFRSYLKREKQD
FT                   RVRYVNIKEIVETIINQHKKAFEAIEVLPQLNVKISDDNIYTWGYEGDFETIFTNLVTN
FT                   SYKALKKEKNEKIFYINLEFENNAYIITSVNNGKVIEKENRIKIFQPLFSSYSDGTGLG
FT                   LTIVQDTVLNYSGTIELCKDYPLTKFKIVIPRQLETKEDVDDVN"
FT   gene            337553..338248
FT                   /locus_tag="Cphy_0269"
FT   CDS_pept        337553..338248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40656"
FT                   /db_xref="GOA:A9KS25"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS25"
FT                   /protein_id="ABX40656.1"
FT                   /translation="MSINILIIDDDKKAVERLINSLRRADTNNIIGECVVDDSVIYEDN
FT                   IEKYNPMKFGVRFDVLLVDYQLNSQFTGALVAAWIMLQLKIPKLTLTSGIYAGPREGFE
FT                   GFILKDELLDNPQMIIKKLVSVIDNFNSKKWFEEQHQALVSEYQVQLENKTLLQTNFAD
FT                   DKNLLLLEKILDKFEKVLDEEQEKEIKARMNICSQKESYNEIYESQNKKIDELDQTLED
FT                   LFTELSQYE"
FT   gene            338241..339011
FT                   /locus_tag="Cphy_0270"
FT   CDS_pept        338241..339011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_4627 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40657"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS26"
FT                   /protein_id="ABX40657.1"
FT                   /translation="MNSSIMKKLKYNNKPTYNKPSGYREYLREISDYSCEYCTITESEC
FT                   SGATFNIDHFRPKAYFPQYFSTCENLRYTCPRCNSYKNDKWIETEKGCIRNCEQCNNKA
FT                   CHENISRFIDNLYEDPQEVLELDDYGVLKAISGSNPADYTIKFLRLNRAQLIKLRKIRR
FT                   FIDLWNEELLAKRKEILLRNENLSLKIKRFDELKRHTFHSPKEECMLKIISTTLELLQI
FT                   QIDQELVLINDQLEKIEVLQKNRKISDDSFLNMI"
FT   gene            339345..339923
FT                   /locus_tag="Cphy_0271"
FT   CDS_pept        339345..339923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40658"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS27"
FT                   /protein_id="ABX40658.1"
FT                   /translation="MESENINSEWNKQIVNHRQYNKICSKHGSVLVKSPNSKCRRCIEE
FT                   MKNNYNDLNHNGIVKIIEKLKNKYDVIMVPTYIPEGSVRWNGRRKNFENPLSEIYNLYY
FT                   FVYIKFCVNKEGVIRALVAGKTGSKKVNYSGSDINFFESVNHGEARKLLKEKNMKWYKD
FT                   EILVIKADDEDSAYRIENEVQECFNLFGS"
FT   gene            340147..340566
FT                   /locus_tag="Cphy_0272"
FT   CDS_pept        340147..340566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40659"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS28"
FT                   /protein_id="ABX40659.1"
FT                   /translation="MNKAKLSSFAIAGAIGLASLSPITTVAAETKTQSTMQTEIKTDCK
FT                   DCKDKKAEFNKKMKAARERWNSLSQTQKDEVYSLLENKMKENNKVLDKLVELKVLEQSD
FT                   VDNLKANQATKFQKIKENGEFPMLRGKGMDRNHTR"
FT   sig_peptide     340147..340230
FT                   /locus_tag="Cphy_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.634 at
FT                   residue 28"
FT   gene            341024..341944
FT                   /locus_tag="Cphy_0273"
FT   CDS_pept        341024..341944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0273"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: dsy:DSY0147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40660"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS29"
FT                   /protein_id="ABX40660.1"
FT                   /translation="MEYMSVKEAALKWHISDRRIRVLCSEEKISGIRKEGKNYRIPVDA
FT                   LKPVDGRTLRGKDIPQEYKEVFARIDAKKAELQKRRPLTQGELERLREEFLIEFTYNSN
FT                   AIEGNTLTLQETASVLEGITIDKKPLKDHLEVVGHKEAFLYIVELVSKQVQISEKVIKE
FT                   IHSLILVDRPHDRGAYRQIPARIKGSVYIPPQPFLVPIQMEELMKDDSLRVNKMHLIER
FT                   LARFHMEFERIHPFIDGNGRIGRLLMNLELMQQGFPPTNVKFADRKRYYECFADYQEHN
FT                   NASKMIIMLADYMEEELDRYLEILG"
FT   gene            342030..343130
FT                   /locus_tag="Cphy_0274"
FT   CDS_pept        342030..343130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0274"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: amt:Amet_3776
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40661"
FT                   /db_xref="GOA:A9KS30"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KS30"
FT                   /protein_id="ABX40661.1"
FT                   /translation="MADQNINKNEKVLTGQPTENQEPVHKRRERYKGTHPKTFKEKYKE
FT                   RQPEKYADTIEKVIQKGSTPAGMHISICVNEILEFLQIKPGQKGLDATLGYGGHTREML
FT                   KCLESQGHMYALDVDPIEIVKTRERLQNLGFGPEILTIKQLNFANIDEVVEEAGLFDFV
FT                   LADLGVSSMQIDDPDRGFSFKTDGPLDLRLNPEKGISAAERLKTISQTELQGMLLENSD
FT                   EPYSEEISKAIVNEIKRGNEIDTTTKLRDLISKVLVTIPENEQKEAIKKTCQRTFQALR
FT                   IDVNNEYEVLYSFLEKLPNVLAKGGRVAILTFHSGEDRLVKKSFKNLQRAGIYSEVSDD
FT                   VIRPSAEECNRNPRARSTKMRWAIKA"
FT   gene            343239..344069
FT                   /locus_tag="Cphy_0275"
FT   CDS_pept        343239..344069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0275"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mla:Mlab_0650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40662"
FT                   /db_xref="GOA:A9KS31"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS31"
FT                   /protein_id="ABX40662.1"
FT                   /translation="MDNEKMALFIADQRKIKKLTQKELAAKLGVTDKAVSKWERGLSCP
FT                   DISLLSTLSDILGVTTGELLNGERAVMLENTNVDSIVESTIQYADTVTKRKSKDIRNAF
FT                   AVTITSLFLLGIMVCLICNFAISGKLTWAWFPISSIIYMWLLVIPMVICKKRGVCISLV
FT                   CTSLFTIPYLYVLERVIGIDRLIMPIAMPVSIVSLLYLWIVYVLLVKFTWGRYLSASIA
FT                   LIFGIPLSFGINFILSKQIGEPIMDIWDILVYSLLILLAVIIYVTGYIRNNARK"
FT   gene            complement(344532..345398)
FT                   /locus_tag="Cphy_0276"
FT   CDS_pept        complement(344532..345398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0276"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: dsy:DSY1016
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40663"
FT                   /db_xref="GOA:A9KS32"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS32"
FT                   /protein_id="ABX40663.1"
FT                   /translation="MKTVKQVAELTGISVRTLQYYDEIDLFKPSEVTDAGYRLYDDVSL
FT                   ETLQQILFFKELDFPLKDIKQIMENPQYDKFTAYKKQKELIRAKRDRLDRLLNLLEKLE
FT                   RGEQCMSFKEFDMSDYFHALQQFKSDHTDEVVKHWGSIEAFDSMLENFKDKESEIAKLA
FT                   IQQYGSIEKYTEAMKANLKNFPETMEKLQSLGKDKDDYLTRSKEINEKLTKDLTLDVAS
FT                   NEVQELVKEMVLLSNEVNKGFDMGENFWDMVIEGYLHSEQLIKANDSLYGEGASAFIGR
FT                   ALEEYFK"
FT   gene            345854..346531
FT                   /locus_tag="Cphy_0277"
FT   CDS_pept        345854..346531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0277"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   lmo:lmo0450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40664"
FT                   /db_xref="GOA:A9KS33"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS33"
FT                   /protein_id="ABX40664.1"
FT                   /translation="MKKQKQISESLQLGIILALSGGFMDAYSYVCRGKVFANAQTGNIL
FT                   LCGVHLSEGNWQLALRYLCPIIAFALGLILANVVQFHLKDKKVIHWRQITILFEAAVLF
FT                   LVGFMPQSANLLANSITSFACAIQLESFRKINGNGIATTMCIGNLRSATQSICEFLYTK
FT                   EKITLFRGLLYFTIIGFFAIGAILGNVSVKLLQEKAIIISTLFLLVGFAMMFFNGEDEK
FT                   VID"
FT   gene            346628..347287
FT                   /locus_tag="Cphy_0278"
FT   CDS_pept        346628..347287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_2911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40665"
FT                   /db_xref="GOA:A9KS34"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS34"
FT                   /protein_id="ABX40665.1"
FT                   /translation="MKVEMHMHTSEISPCAAVRAIEGVREYKKASYNGIVITDHFNDYV
FT                   LNGFIGSDREKVARFLTGYEMAKEQGEELGITVFFGIETCLLGAQNDFLLYGLQPEFLY
FT                   EYPKLYSLSIKELHQVVGEAGGIVVQAHPYRGYCTIEDPKYLDGVEVYNGNPRHNSRNH
FT                   LAKDFAKHYPHLIETSGSDYHQLSDLASGGMIFPRELHTETELKEALLARDYELIQ"
FT   gene            complement(347574..348416)
FT                   /locus_tag="Cphy_0279"
FT   CDS_pept        complement(347574..348416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_4038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40666"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS35"
FT                   /protein_id="ABX40666.1"
FT                   /translation="MEYQIEDLLPVVAKLTEKYTSKESSSVTYETARMLMEAVIYCLNE
FT                   AEAENDYSLVDEKQPNLALLYERGLNLVIEKTKEAKNLYDSIIENFEDYGCVNYIDTIL
FT                   KGMPAFFTRYDARFQPQNHLLTLDYPLIIDLPNLCGIDLIFSYLRGIRIEQHFLHCFDR
FT                   FAIRNLLVNILPDYQSLYFDNLSYPVLLNAVGRCIVKKPLKTLMLKYSDCDLIKAYFNG
FT                   DDVRTMEQKIKLLIQTIVSPLEDDIALIYFAKAAKDYAVRIQMGIQHGTLDRIFLCSV"
FT   gene            complement(348483..349025)
FT                   /locus_tag="Cphy_0280"
FT   CDS_pept        complement(348483..349025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC3435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40667"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS36"
FT                   /protein_id="ABX40667.1"
FT                   /translation="MDSNFFELILLQNKQNELSTLISCNDKTEQFGLTLTNEEAEELMV
FT                   CRNDSLRKHKRVEFNNGILDKLIYAFCDSQYISQDNYVELLEELQDIFYEFKNESEDKL
FT                   TDDELITFMKEQFESVCFGDIDYLSGTCLERFCSAIRAGYEGYKRTGGSHEYDQFSEEA
FT                   RWDKDLYLEVLRELCWR"
FT   gene            349185..349946
FT                   /locus_tag="Cphy_0281"
FT   CDS_pept        349185..349946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0281"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   sgo:SGO_0487 phosphorylase, Pnp/UDP family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40668"
FT                   /db_xref="GOA:A9KS37"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS37"
FT                   /protein_id="ABX40668.1"
FT                   /translation="MILEEFDSNKKAIINPEEIIEKIPDFPRVGVSCFSLTLFNRIISI
FT                   LNPSKIAQTGTASTQVIIYEITYHDVKIAFYMSPVGAPACAAVYEDLIAMGLDKLVLFG
FT                   TCGVLDRTIADCSIIIPTSAVRDEGTSYHYMPASDEIKVNNKGIDIFKEILSKHHYSYT
FT                   EGKIWTTDGIYRETREKLEKRKSMGCICVDMECSAMAAVAAFRECELFHFFYAADNLDS
FT                   DNWDARSLGNLVKLDEKEKIALLALEMASKF"
FT   gene            350094..351305
FT                   /locus_tag="Cphy_0282"
FT   CDS_pept        350094..351305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40669"
FT                   /db_xref="GOA:A9KS38"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS38"
FT                   /protein_id="ABX40669.1"
FT                   /translation="MYSIIEKPLWTKEYVNELFLSRNTKDKKQLRNSLLYFFTVTILGI
FT                   GVGLITNSILLSEENSKFWLIAILFTWLDGILLIVIHEAGHFVGGIITSYRFQSFRVFS
FT                   YCIVKEDNKYKIEKRKIPGTSGQCLMKPPKNWTLDSPFFLYHAGGGIATFLVSMLSLLL
FT                   FKLTSSPLAQIIFFILFGYGLILTIINLVPLQLPSSNNDGANILAIRRDKTAKETFFKQ
FT                   LECNAWLSDGRKLEDISEDYLKLSENAVWSEPLNYYLEWILYSKFLKEREFDKAEELLM
FT                   KMEEAYHDMLPSKKIRIDSERLYLLIIRQVDTDCINTFYKNVADKLRIQKLCTPILRTL
FT                   IAYEKYSNNNNNNNNKCALEQYQRMFYRAMKSAACKQEAEVDYILTYQVEEACDTEKGS
FT                   SDLI"
FT   gene            351565..352659
FT                   /locus_tag="Cphy_0283"
FT   CDS_pept        351565..352659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr7467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40670"
FT                   /db_xref="GOA:A9KS39"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS39"
FT                   /protein_id="ABX40670.1"
FT                   /translation="MAFCTSCGKPIEKTAKFCIHCGEVNKAYENGSAAVMKQTQDKPVE
FT                   EKKSNEGSYIHPPVNKIKTMDAIKATMPFIIVKGIVQLIVTLVMIVMAIIGIVIITQTG
FT                   ESGVIVVLILGAAFFGIIKFAKRYVLYMIKVAYIAALTSYIKTGESPKVQGYSGVLAYG
FT                   TNLVKDNFGTANVGFVADALISGAVQQICKFLFKIGDLLSFIPGLKNVIDILTYIISVA
FT                   LNFIDEAILSYIFFHQEEKNSWKKACDAIVYYGQSWKGMFKGAAKVAFSIWGARIVSFF
FT                   IFMLIGKSFAPTAVAVIISFLLVYALEAIFVEPYMVVVMTKQYYASIENQPLKSDLYAK
FT                   FTKCSRKFKKLMEKSENEEVPVAA"
FT   gene            complement(352773..353978)
FT                   /locus_tag="Cphy_0284"
FT   CDS_pept        complement(352773..353978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0284"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   ljo:LJ1010 trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40671"
FT                   /db_xref="GOA:A9KS40"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS40"
FT                   /protein_id="ABX40671.1"
FT                   /translation="MEKEKESVMSMSKARKIARKKEIEQMKRNAIISKVVSICVVAVLC
FT                   VGLVSYIGYSIHRKATQVTASSNFSAQLNDKGFIDGVDASSLLNLVDYKTIKAPLSEIE
FT                   YSDESVAKDIATAVEAKKTLNKETDAAIADGNIVNIDYVGTIDGKEFDGGNTNDNGYEL
FT                   KIGSKKLVDDFEEQLIGHKIGDEVTVNVTFPEDYTNKDLAGKDAEFKVKINGIYDVPEF
FT                   TDAFVKENLSEYASNVEEYKKYLKDTNYASTLNTYIVSYLADNTTVTSYPEKYVKLSKS
FT                   LLKFSDQSYYNSMNQYYMENLGAPAYNSFEEYTGVSEAEYDKSLAEPAEKQVKAALIYQ
FT                   AILEKEGVTVTADDYIAYLESQGQTKEDFDNQVETYGKNFVLQEMVKIKALELVKGMVT
FT                   VE"
FT   gene            354430..356565
FT                   /locus_tag="Cphy_0285"
FT   CDS_pept        354430..356565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0285"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: cbe:Cbei_4017
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40672"
FT                   /db_xref="GOA:A9KS41"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS41"
FT                   /protein_id="ABX40672.1"
FT                   /translation="MKRKMVEKLSHKSLAKRISFLVTKLLAVVFILFIVVSSLISGLSI
FT                   EKSIRGEVSVLSEKNALKVQGIFDDASSVADIILTYVEKQYVHDSTLSAQEKLPIYQGQ
FT                   VYDDKLTKTDYETEKFIIDIAKSSIINYPTITGVGIMFEPYEFNSKIKNYSIYIKRGYL
FT                   EAKPGSYGDYDKYSIQPYFTEAKSSLKPVFTDPQDYNGVTFISAAYPIVLDGVFKGVIV
FT                   VDIDIANFNELEIHNDNYTSMYSTVYTPDGLIVYDSESHVEEGEDLSNFLASEKDYNTI
FT                   LQKFEGEEAFTIHTKRKDGGSETRFLYPIQAGSERWWAQTAISQLDMYKSVIVTVVVLT
FT                   VFTLAGLLVIVFLVSRAMKKRLAPIQGIVNSAEKIAKGEFDIVAEYKEDDEIGKLARSF
FT                   ANTANTLNLIIDDINYLLNEMASGNFVIESSCTENYVGGFQPILKSVGHINRQLSNTLH
FT                   EINEAADQVATASSAMADGSSSLAEGCTDQASSVEELVATITSLENDIDENTNKTIEAS
FT                   KKMQLIGETAQESGAKMNELTLAMEKISQSSGQIAEIITTIEGIAEQTNLLSLNAAIEA
FT                   ARAGEAGRGFTVVAEEIRKLANQSALAVQSTRELIVTALSEIESGNEITSQTSESLQQV
FT                   EVGVKEAIALAEGSKDASISQAQAMREITSVVEQISVVVQNNSATAEESSATSEELSAQ
FT                   AQTLADLVGRFKLREDL"
FT   sig_peptide     354430..354555
FT                   /locus_tag="Cphy_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.295 at
FT                   residue 42"
FT   gene            356849..357376
FT                   /locus_tag="Cphy_0286"
FT   CDS_pept        356849..357376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0286"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: ctc:CTC01413 methylated-DNA--protein-cysteine
FT                   methyltransferase; TIGRFAM:
FT                   methylated-DNA--protein-cysteine methyltransferase; PFAM:
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40673"
FT                   /db_xref="GOA:A9KS42"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS42"
FT                   /protein_id="ABX40673.1"
FT                   /translation="MKNVFYYNTMIGKLRIEEEDNFIIGVSSSDGDKTDQIKEKQIRET
FT                   EQINEAEQVKESDLIKRTYLQLMEYFEGKRTTFDVPIRLDGTSFQTKVWEELRKIPYGE
FT                   TRSYGEIAKQVGVPKGARAVGGANHNNPVLIIVPCHRVIGSSGALVGFGAGIPVKELLL
FT                   KLENQESENILS"
FT   gene            357478..358032
FT                   /locus_tag="Cphy_0287"
FT   CDS_pept        357478..358032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0287"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   lsl:LSL_0634 phosphinothricin N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40674"
FT                   /db_xref="GOA:A9KS43"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS43"
FT                   /protein_id="ABX40674.1"
FT                   /translation="MTEELVIRMATILDAPKLLEIYAPYVRETAITFEYTVPTVQEFES
FT                   RIAKILTRYPYLVAEKEGEILGYAYVSSFKERAAYDWAVETTIYINQNQRGSGVGKRLY
FT                   LKLEEIVKRQNIINMNACIAYPNPGSIAFHEHLGYKTVAHFTKCGYKLDRWYDMIWMEK
FT                   ILEEHPEKPKEFIPINKLFIE"
FT   gene            complement(358277..359431)
FT                   /locus_tag="Cphy_0288"
FT   CDS_pept        complement(358277..359431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0288"
FT                   /product="glycosyl hydrolase family 88"
FT                   /note="PFAM: glycosyl hydrolase family 88; KEGG:
FT                   rle:pRL120662 putative unsaturated glucuronyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40675"
FT                   /db_xref="GOA:A9KS44"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS44"
FT                   /protein_id="ABX40675.1"
FT                   /translation="MNLIDEITNHELKSSISKAVEILRGNLSEFTEKFQDSTSINNFYP
FT                   VSENVEWTTGFCTGEYWLAWEITGDESFKKAALIQTESFLQRIEKQIDVNHHDMGFLYT
FT                   PSCVAAWKLTASETGRKAALLAADNLMKRFHEKGGFFQAWGELGAPDNYRLIIDCLLNL
FT                   PLLYWASEETGNPIYREKALIHTKSSLENLVREDYSTYHTFYFDPIDGKPLRGVTAQGY
FT                   RNDSAWARGQAWGIYGLALSYRYTNDSGCIDLFYKVADFFINRLPDDIVPYWDLDFAQG
FT                   SDEPKDSSAACIAACGMLEMAKYLPKDKAEYYMDIAKKIAGSLSRNYTADIGKSNGLLL
FT                   HGVYAKKSPYNTVTDRGVDECNTWGDYFWFELLIRLFKDWDTYW"
FT   gene            complement(359443..360273)
FT                   /locus_tag="Cphy_0289"
FT   CDS_pept        complement(359443..360273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0289"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL120663 putative
FT                   permease component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40676"
FT                   /db_xref="GOA:A9KS45"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS45"
FT                   /protein_id="ABX40676.1"
FT                   /translation="MVERKSAKSQLFIYVLLIFIVAITLLPLVWMFSASLKLNKDVFTI
FT                   PIQWIPRNPVWKNYITIWKKIPLAKFTTNSFKLTIIVCIIQVFTSSFAAYGFAKCHFPG
FT                   RNFLFLLYVATISIPWQVYMLPQFIEMRTLGLTNSHLGYVLMQSFIAMGVFLVRQFYIS
FT                   IPDELLEAARIDGLNEYSIYARIVLPLSKPALASLTIMSFVTIWNDFMGPMIYFTRTEL
FT                   KTIPLGIRMFIGQYSAEYSLIMAAAVLSIIPVFAVFMMFQKYFVQSVTSSGVKG"
FT   gene            complement(360288..361181)
FT                   /locus_tag="Cphy_0290"
FT   CDS_pept        complement(360288..361181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0290"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: efa:EF2233 ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40677"
FT                   /db_xref="GOA:A9KS46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS46"
FT                   /protein_id="ABX40677.1"
FT                   /translation="MNNRKKKLSLRTRNALIGYSFILPNFIGFFIFVFIPVMFSLVLSL
FT                   VSWNGFGPMKFVGLKNFVTIFKDKNFVNALSRTMYYTFFTVVLTTFIALGLAVLLNNKL
FT                   RFRGFFRSAVFFPYVASIVAVGVVWNMLFQKDFGPINEFLRWIGIQNPPGWTASVKWAI
FT                   PAVIIVSVWKYMGYYMIVLLAALQDIPVDLYEAATIDGANRRQYFWRIAAPLLTPALFF
FT                   VVLMLTVTSFKSFDLIYVMTEGGPGQATTLVVNYIYSKSFISETYGVSSAAAMVLLFII
FT                   SIITLIQFHAEKKLTN"
FT   sig_peptide     complement(361047..361181)
FT                   /locus_tag="Cphy_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.377 at
FT                   residue 45"
FT   gene            complement(361234..362583)
FT                   /locus_tag="Cphy_0291"
FT   CDS_pept        complement(361234..362583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0291"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rle:pRL120659 putative substrate-binding component of
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40678"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS47"
FT                   /protein_id="ABX40678.1"
FT                   /translation="MKNKKLVKVLSSLLAASVIFTGCSSTKNNQPSSADPTPTNNSSES
FT                   KPTTEPEKNELSGSITFSAWDVDTQMPYIKDMLAEFMSQHPGVNVEIVDIPSADYDTKL
FT                   NIDLNGGAAADVILVKNASTMPSMNQKGQLVDLNEYIKRDNVDLSSYNGLDKSISINGT
FT                   QPGLPFRTDYYVLYYNKDIFDTAGVAYPSNDMTWADFEELAKKVTFGEGANKVYGAHLH
FT                   TWQALVENWAIQDGKNTTMGPDYEFMKPYYEMALRMQNDDKTIMDYATLKTANIHYSGV
FT                   FQNGSVAMLPMGTWFMATMRDVVSKGECSVNWGVATIPHPEGLEAGNTVGSATPISINA
FT                   ASKNKELAWELIKFMTGDSGASYLASVGQLPARINPELLDTVTSLEGMPEGAKEALQVK
FT                   NIVLDRPIVDNVNEVDKMLGEEHSLIMLGEVTIDEGIKAFTENSKTIQEQ"
FT   sig_peptide     complement(362503..362583)
FT                   /locus_tag="Cphy_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.644 at
FT                   residue 27"
FT   gene            362867..364387
FT                   /locus_tag="Cphy_0292"
FT   CDS_pept        362867..364387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0292"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase internal region; KEGG: cbe:Cbei_4458
FT                   histidine kinase internal region"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40679"
FT                   /db_xref="GOA:A9KS48"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS48"
FT                   /protein_id="ABX40679.1"
FT                   /translation="MKHKLKIILMSALCIITVGVCSSVYLYNNLMNIISNKEEGISDLY
FT                   LETVRNQLNYNLVELVGLSQCRNDLDISKAMRLDKMSSSKEKNLALRASEKLTSYLSNY
FT                   RTWRYVDKLIAFNEKGISVQAATLGVNRLDDPDRILELNIFNSLLQSGDKQIISLSPSI
FT                   INGKECIALICQIYDINNSKSNGWLYMEINTDIIADNLSKDLGVNLYVAKADGTYLLGN
FT                   QITSGVGKTMKTHEIPLSVAGLKLIGFKESISTARSVSSVIITIVVVVLAALVAAILMA
FT                   IVIISLLRESEVLRNQRKNAEITMLQSQINPHFLYNTLESIQWMAKIQKNTGIVKITRC
FT                   LISLLRNMAKSVGEKISLGEELALLNDYVELQSIRYMDAFEVVNNIPESFHSYAIIKFS
FT                   IQPLVENAIFHGVVPSGKNGTITINAIEDGNDLLITVTDDGIGMEPPELRKLSDRMEST
FT                   SSKGLTGIGLSNVNNRYKLSYGEQYGLTFESESGQYTKVIMRFPKEVV"
FT   sig_peptide     362867..362947
FT                   /locus_tag="Cphy_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.632 at
FT                   residue 27"
FT   gene            364406..366004
FT                   /locus_tag="Cphy_0293"
FT   CDS_pept        364406..366004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0293"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; response regulator receiver; KEGG: tte:TTE0288
FT                   CheY-like receiver domains"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40680"
FT                   /db_xref="GOA:A9KS49"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS49"
FT                   /protein_id="ABX40680.1"
FT                   /translation="MYRVLLVDDEPLILSGVKFLIDWEKNDCILAGTAKNGAQALELID
FT                   ELKPDIVITDINMPIMNGIELLRHTQENYPAIVFIMLTNLEEFDLAREAMRMKAADYLT
FT                   KSMMEPQMLENSLTMAKKEAKTRGGFLHAEAAGYYLLENKRKLLTVASEHFISKNEISK
FT                   HESAILAEHGILEGWACILIWFTAAESTAISNDSEEDTEITSWMNEIVENLAQNSFSNY
FT                   LIQTRFKNKQRFLLLHWGKSIAENEKQAVIFAKRLSSASENIAGLKASVLYTDVFKKED
FT                   KRKECLKQLYDLDTYFYLNKTMLAGYHEIGTTVCNPLGLMGLPKKMEVELNSLSISGCN
FT                   DIFTKAIHRISEIPHEKEEAIWICEEICDVLKRWFSERGDDIAINSIFQSYKEIEMLTA
FT                   RSQVICWLEKLKKEVLEWLKPLAEHRSDLVDKAKEYVRNNVDKRITLQDTASHVGVSLG
FT                   YLSSLFKKQDGQNFIDYVNKSKVDRACELIREGGLRLNEISYMLGFENAYYFSKVFRRH
FT                   VGVTPSEYQNELKNN"
FT   gene            366262..366486
FT                   /locus_tag="Cphy_0294"
FT   CDS_pept        366262..366486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40681"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS50"
FT                   /protein_id="ABX40681.1"
FT                   /translation="MKSNRLEKLDPKVEELMSTHPNLRKAPANITNHVEQEPGMMTKQG
FT                   SSYGANNKCAPDNNIFYEDRSNHLCSKGD"
FT   gene            complement(366857..369103)
FT                   /locus_tag="Cphy_0295"
FT   CDS_pept        complement(366857..369103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0295"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.99.1.3"
FT                   /note="PFAM: DNA gyrase/topoisomerase IV subunit A; DNA
FT                   gyrase repeat beta-propeller; KEGG: cno:NT01CX_0861 DNA
FT                   gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40682"
FT                   /db_xref="GOA:A9KS51"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS51"
FT                   /protein_id="ABX40682.1"
FT                   /translation="MKKEAENIIQLDFSEEMKTSFRNYAMSVIMARAIPDVRDGLKPVQ
FT                   RRILYSMIELGLDPKKPHRKSARIVGDTMGKYHPHGDSSIYDALVHMTEPYSMQIPLVD
FT                   GHGNFGSIDGDGAAAMRYTEARLSDGAMTLLDHLDKGLVEFVPNFDESEKEPSVLPAML
FT                   PNLLINGTTGIAVGMATNMPPHNPSEVIEGVIAYIDNPDITTEGLMKYIPGPDFPTGGT
FT                   IINSEDIRNIYETGEGRLKVRAKTEIEASDNGRKNIVITEIPYTVAGNKTKLVESLVDL
FT                   MKDKVFDEIFDVRDESSKEGIRVVIEVKKDRDIENLLNGLYKKTSMEDTYGVNLLAVKD
FT                   QQPIVFKLKNLVGEFVSFQEELYTKEYEHLLDKANKRLEIVDGLIRATDVIDLIIEILR
FT                   GSSSIKQAKDCLIHGNTTEINFKTEASRKKAAKLDFTERQADAILAMPLSKLIGLEILR
FT                   LHEENQSLLDSIEQYQSILGNKKELFKVIKSNLKEYKKQFNVPRHTVLANMEIAEYVEE
FT                   VKVEDIYILIDKFGYTKSVDNTSISRVSEDNLKDFVHIVKMKNTDRLCLFTAQGNMYQV
FT                   KAEKIPKCKIKDKGTLIHNLCKVDKEEILLYIAFEDLFESQLLFTTKNGFIKLVSGIEF
FT                   ETNRAMISATKLEEADHVVSVLCLSAHTISNPDSKVILLTEDSLSLGFPLTEVSELKKT
FT                   SKGVKGITLEKKDKVAFATVALPETEFFEYQGKELSAKKVRNRKRAAKGQKASL"
FT   gene            complement(369348..371276)
FT                   /locus_tag="Cphy_0296"
FT   CDS_pept        complement(369348..371276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0296"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gka:GK0005 DNA gyrase subunit B; PFAM: DNA
FT                   gyrase subunit B domain protein; ATP-binding region ATPase
FT                   domain protein; TOPRIM domain protein; DNA topoisomerase
FT                   type IIA subunit B region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40683"
FT                   /db_xref="GOA:A9KS52"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS52"
FT                   /protein_id="ABX40683.1"
FT                   /translation="MEQYNGSQIVVLEGLEAVRKRPGMYIGSTGTRGLHHLIWEILDNG
FT                   IDEHLAGFCNQLEITLLKDGGISIADHGRGVPVDIHPTKKIPTARVVYTILHAGGKFGG
FT                   SVYKVSGGLHGVGASVVNALSTRMIVEIRRDGKIYRDEYEHGGHPCVELENGMLPVVGK
FT                   CNKSDTGTKVTFYPDPTIFETVEFKAETITKKLKEVAFLNKNLSIVFYDQNTGFKKTYC
FT                   EEFGIKSFVSYINREASVIHEEPIYIEGKSGDIEVEVALQYTNSFSEQINAYCNRINVV
FT                   DGGTLVTGFKTALTRVMNQYARELGVLKEKDENFDGKDIRNGLVTIISIKHPDPQFEGQ
FT                   TKTKLGNTDAKSAVEDVFSGEVTRFFDKNVEILKAILENSMRSYTARKASDKARSAVLK
FT                   QLNDIDTKSKLASCSSKKPEECEVYIVEGDSAGGTVKTARNRRTQAVLPLRGKIINVEK
FT                   ATLEKILVNNEIKSMIASFGCGIGEDFDISKLRYDKIIILTDADVDGAHISTLLLTFFY
FT                   RFMPELIMEGKIYRGLPPLYRVEYETSEGKKKKKFEYIYNDFELDKFRKNTKHKIIHIQ
FT                   RYKGLGEMDAEQLWETTLNPETRVLAQVSITDTVDADETTTLLMSNNVPPRRAFIMDEA
FT                   KYAKLDI"
FT   gene            371897..374809
FT                   /locus_tag="Cphy_0297"
FT   CDS_pept        371897..374809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0297"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: glycosyl transferase family 2;
FT                   CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; KEGG: bld:BLi03816 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40684"
FT                   /db_xref="GOA:A9KS53"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS53"
FT                   /protein_id="ABX40684.1"
FT                   /translation="MPVYNVSRYLRNCLDSIVAQTMEDIELIVVNDGSTDDSLSILKEY
FT                   EVQYPEWMHVYTTENRGVSHARNYGIERASGEYLLFVDSDDFVEPEICEKLYEKAAQDN
FT                   NDVVICRYNDVYENADSDMLTVKQGKAFEIVIGRNFNIHETKFELTHISPFPWDKLYRR
FT                   TLFETIRFPEKLRFEDLAIMYCLMTKATSIGVIEDRLYNYRRASEGSFLSNFSEGTLDI
FT                   VTSLRLFLKQMKEQGNYEEFKEEIEYICTRHLLVRYDAIFDTATKGKLDIKKEMIHNCV
FT                   DFFHEFFPKWRENRYLLYTASGASRKKMRKYTSRGKMIRSATMCEYTPVFVTKTLRKMK
FT                   KIQDKIKKKWKKFSKAKNKFRFIYNHIPGIKLLHLPNDVQYTMFYEKLGVNENDVLFES
FT                   KHGDDIAGNIFMMLQAMGDDKYRDFHIMVTLKEENISAYSALLARYGIDYVDIITTDSK
FT                   EYLKVLATAKYLITDTSFPPYYIKRPEQVYLNTWHGTPLKAMGRIVPKREYALGNVQRN
FT                   FYLADYLLYQNKFSRDIFVEDYMLAPIFNGKVMLSGYPRNSAFFNTERYDAIRSELGVE
FT                   DMQVMGYMPTWRGLLNKKENKKQVSELINYFYELDMLLRDDQVLYVKLHPFVKSEVNYD
FT                   DFTHIVPFPEEYETYDFLNATDLLITDYSSIMFDYAVSKKKIILFTYDREEYLNDRGMY
FT                   LDLNDLEFPIADTVEQLVKEIKKDSSYPKFHEEFCSLDSADTAEEVCETLFLKKEPSFS
FT                   LEPIQRENKKKVLILISGLRNNATSEQLMERINELDTDRYDVFLCAKASTIRKATSVLS
FT                   KLRDEINYIPLMFDVNYTIKDRIACLKSFKFGYSSKRTEGLIRRLAERERVKYFGAINF
FT                   DIVINLSSLDQILFHMCKSFDGVKIFNMKSFEYKKYTQNKDYRKFMDYFLNRLDGYDYV
FT                   TGTKQILKLNQAVFEQNQVKHLIGHESKLELPELLKEVDR"
FT   gene            374809..375912
FT                   /locus_tag="Cphy_0298"
FT   CDS_pept        374809..375912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_0211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40685"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS54"
FT                   /protein_id="ABX40685.1"
FT                   /translation="MKVGVVTFHSAHNYGASLQAWALQKVLKNLGTEPGVIHYHPEIID
FT                   KLYVAPKLDTTKKKLKYLLKKEYRSRIQTQVYKNKRYSKFIREKFHLIGDYKTYEELLN
FT                   ANLSLDAYITGSDQVWNSDHTGGFDPAYTLDFAKPGAKKISYAASVGREYILPQYREQF
FT                   RQSLESYTSISVREASSKPGIEALTDKPVEVVLDPTLLLERKDYEELKKPGKFKGRYIL
FT                   VYMMESNKELVQFANRLSVAIGLPIIQRKLPGVFRNELGSYYEDTAAEFLGEIENAEYV
FT                   LTNSFHATVFSLIYEKPFISMLHTSTGARTSDLLKSVGLESHLLYHIGDFHDMNQFDIE
FT                   DVEALRQRIRELRESSIDFLKRALDKK"
FT   gene            375937..376965
FT                   /locus_tag="Cphy_0299"
FT   CDS_pept        375937..376965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0299"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   lsa:LSA1519 putative teichoic acid/polysaccharide glycosyl
FT                   transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40686"
FT                   /db_xref="GOA:A9KS55"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS55"
FT                   /protein_id="ABX40686.1"
FT                   /translation="MKRLTAVVPCFNEEEVLPMFYEEIMNVAECLKNEVEFEVLFVNDG
FT                   STDGTLQEIRKLRERDKRVKLVSFSRNFGKEAAMYAGLEHSTGDFVAILDADLQHPPKM
FT                   LIEMYHGIVLEGYDSVAAKRVTRDGEPKIRSFFSKKFYNILCKLSKIEIVEGSVDYRLM
FT                   TRQMVKAVLSMSERNRFTKGIFGWVGFHTKWIAYENVERAAGQTKWSFWKLFKYSLEGI
FT                   IGFSTAPLAISSILGLAFCGFSVLAIIYIVIKTIIWGDPTSGWPSLACIILMVGGIQLF
FT                   CMGILGQYMGKTYIEVKNRPIYLASLVETEEEQDDRMSEANQKQDEMLPETISKATNKE
FT                   IT"
FT   gene            377015..377401
FT                   /locus_tag="Cphy_0300"
FT   CDS_pept        377015..377401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0300"
FT                   /product="glycerol-3-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.39"
FT                   /note="KEGG: lin:lin1076 highly similar to
FT                   glycerol-3-phosphate cytidylyltransferase (gct),
FT                   CDP-glycerol pyrophosphorylase (teichoic acid biosynthesis
FT                   protein D); TIGRFAM: cytidyltransferase-related domain
FT                   protein; glycerol-3-phosphate cytidylyltransferase; PFAM:
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40687"
FT                   /db_xref="GOA:A9KS56"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS56"
FT                   /protein_id="ABX40687.1"
FT                   /translation="MKKVITYGTYDLLHVGHINLLRRAKEYGDYLIVVLSSDEFNAIKH
FT                   KTAYHCYEDRKTILEAIQYVDEVIPEYNWEQKIKDVVDNNVDVFVMGDDWKGQFDFLKD
FT                   YCEVVYLPRTEGISTSKIKNDLHK"
FT   gene            377579..378751
FT                   /locus_tag="Cphy_0301"
FT   CDS_pept        377579..378751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0301"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; KEGG: lmf:LMOf2365_1103 teichoic
FT                   acid biosynthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40688"
FT                   /db_xref="GOA:A9KSP4"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSP4"
FT                   /protein_id="ABX40688.1"
FT                   /translation="MLRKIMKKGILAIYRILRFLPLQKRTICFMSNLGRSYGGNPKSIY
FT                   EEMVREGLDKEFRCIFFLEDTNAPIPGRVWKVKLSRFRYYYFLAVAGIWVSDTRFPNYI
FT                   KKRKGVTYLQTWHGTPLKKLALDMTSLVMAGEETLEQYKEEFKKNSATWDYLISQNPFS
FT                   TETFRRAFDFQGEILEYGYPRNDVLFQKNNSYDIDQIKKKLNIPRDKKIILYAPTWRDN
FT                   EYHDKANYKFNAPLDYNYLYEQLKDEYVILLKYHYMVREKLPLEQYRGFYMVVEQEIDI
FT                   SELYLVSDMLITDYSSVMFDYSLLYRPILFYVYDLKEYEDNLRGFYFDFVEEAPGPLFT
FT                   SSRELVSMVKNYYPEDYADKYKAFCDKYHTFENGNAAKRTVRLLSEKGMK"
FT   gene            379217..380476
FT                   /locus_tag="Cphy_0302"
FT   CDS_pept        379217..380476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0302"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG:
FT                   drm:Dred_3249 Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40689"
FT                   /db_xref="GOA:A9KSP5"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSP5"
FT                   /protein_id="ABX40689.1"
FT                   /translation="MKKPFVTLEKVNEIVNTHSTPFYIYDEKGIRENARKLKEAFSWNK
FT                   GFKEYFAVKATPNPFILQILKEEGCGSDCSSETELMISEAVGITGSEIMFSSNNTPEGE
FT                   FTKAKELGAIINLDDYTHIDFLKEECGIPETICCRYNPGGVYEVSNGIMDNPGDAKYGF
FT                   TKQQLIDGYKKLMELGAKNFGIHSFLVSNTVTNDYYPALARTLFELAVELKNETNANIT
FT                   FINLSGGIGIPYLPEEKGNDIMVIGEGVRKAYEEILVPNGLGDVAIFTELGRYMLAPYA
FT                   HLVTKAIHEKHIYKEYLGVDACAVNLMRPAMYGAYHHITVLGKEETPLDTMYDVVGSLC
FT                   ENNDKFAIDRMLPKVDMGDYLVIHDTGAHGFAMGYNYNGKLKSAELLLKEDDSVQLIRR
FT                   AETPEDYFATFDFCDILKQK"
FT   gene            381033..381305
FT                   /locus_tag="Cphy_0303"
FT   CDS_pept        381033..381305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0303"
FT                   /product="anti-sigma-28 factor, FlgM"
FT                   /note="PFAM: Anti-sigma-28 factor FlgM family protein;
FT                   KEGG: csc:Csac_1662 anti-sigma-28 factor, FlgM"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40690"
FT                   /db_xref="GOA:A9KSP6"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSP6"
FT                   /protein_id="ABX40690.1"
FT                   /translation="MRIDALSKINQLYQTNDTRKVSKTQNGNKKDSVEISQMGKDFQIA
FT                   KQAVSSAPDIRQEKVDEIKKKLASGNYEINLEELADKMINDFFEE"
FT   gene            381357..381872
FT                   /locus_tag="Cphy_0304"
FT   CDS_pept        381357..381872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40691"
FT                   /db_xref="GOA:A9KSP7"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSP7"
FT                   /protein_id="ABX40691.1"
FT                   /translation="MASLIQELITTLREEEQLYQEMIPIAAKKTRVIIDNDLASLQQIT
FT                   EEEQVTVEKVNALERKREEVIVNIGTVINRKSDTLTMKTIITLLENQPEEQKELSLIHD
FT                   SLTTTINQLVELNHKNKSLIQQSLEMIEFNMNLIQSTRMSPGSTNYTKGASQLEMPAAQ
FT                   TGMFDAKQ"
FT   gene            381918..383780
FT                   /locus_tag="Cphy_0305"
FT   CDS_pept        381918..383780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0305"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: cth:Cthe_2244
FT                   flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40692"
FT                   /db_xref="GOA:A9KSP8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSP8"
FT                   /protein_id="ABX40692.1"
FT                   /translation="MSLMSSLYVGVSGLQVSQNGLNTTGHNLANVETEGYVRQQTVLQT
FT                   SQYRTIGQSYISPMQLGLGAETAAVRQVRDIFLDKSYRQELGRRGFYDSQYETVSEIEN
FT                   LMGELEGVAFQDSIADFWKNLQELAKEPDSLVKRASLVETSVGFVERSENLFKQLRDYQ
FT                   LNLNLKITNTISRINEIGDQISSLNDRICAYESNRVEHANDLRDTRNKLLDELSQMITI
FT                   TYRENADGRVTVNAEGVPFVTEDLTHHMGSMTVTQIRQRQLDEDEFNSTGMMENSDMLI
FT                   PIWPTYGNVEVFNRDLIPNPVDNSDIGSLKGLILARGTKVAKATDIPIAPNKDNYLDEF
FT                   GDLKEDEYNLALKDYKEAVKTYNKTIEPSIVMSTQAQYDQLIHGIVTKINDILCPNKEV
FT                   VIAAGTTIQLSNGDTYTYDKDTVIKIFDDENAPIGINGEGGTELFSRKSMPRYMDYQEI
FT                   TLANGDTILAKIYNEEDEANNYSLYTVGELVVNQEMIEDKSKIPLSQSSNTGDYDIKTT
FT                   ERLLKAWQEPFATLSPNTLTKSNINDYYNALIGGIATTGERYHTIVKSQEGMVTSIDNQ
FT                   RQSVLGVASDDELTSLIKFQHAYNAAARYINVIDQMLEHIVTRI"
FT   gene            383872..385713
FT                   /locus_tag="Cphy_0306"
FT   CDS_pept        383872..385713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0306"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: amt:Amet_0727
FT                   flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40693"
FT                   /db_xref="GOA:A9KSP9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSP9"
FT                   /protein_id="ABX40693.1"
FT                   /translation="MPSTFFGLSIGNSGLYASQAGLNTTAHNIANIETEGFSRQVAKQQ
FT                   AGTALRVNSSYGMVGTGVDIKGVTQIRDSYYDLKYMKNNTMYGAYSTKEYYLTSIENYF
FT                   NEVKLEGFLTNFDNMYNSLQELSKQPEDLTVRTQVTNMAQSTCDYVNSLSTSLSRLQEE
FT                   CNFEIKNQVERVNSLAQQIAIVTKQINTIEVNGGTANDLRDQRALMVDELSGFATVSVN
FT                   ERIVGDNVGVTSYTVKLDGQTLVDNYEANQLKVVPRDTKVNQLDATGLFNVCWSNGQPV
FT                   DLNSPTMGGTLKALIQVRDGNNKEGYQGKAIASAGDTTITVTSTNKNNVEDLNIASNGI
FT                   ITIGNREYHYNGFAVTKDEDTGEFIYEFSLDEPVKVDVNEETAHIGKQVDYKGIPYYMA
FT                   QLNKFARTYAKAFNDVHKSGQDLNGDQGLDFFNGVDVVTGKNFIFDKSPSDEGNGYLFT
FT                   SKTGAYAGDYADEPNFASYYLLTADTFGVTKAVYSDPKKLATASSIENGVANADNVQKL
FT                   LALKDDVRMFGQGKPAQFFQTLVAEIGIDAKQASNFAENQMNILSAVQNQRLSISGVDQ
FT                   EEEAMNLVRYQKAYNLSAKVISIMDQIYDRLINYMGA"
FT   gene            385771..387315
FT                   /locus_tag="Cphy_0307"
FT   CDS_pept        385771..387315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0307"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="TIGRFAM: flagellar hook-associated protein 3; PFAM:
FT                   flagellin domain protein; KEGG: csc:Csac_1665 flagellar
FT                   hook-associated protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40694"
FT                   /db_xref="GOA:A9KSQ0"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSQ0"
FT                   /protein_id="ABX40694.1"
FT                   /translation="MEVSMRITNKMMTNNVLYNINNNKNSLSKTEQQYSTGKKIQRPSE
FT                   DPIVAVRALKLRTNLTELNQYYEKNIPDALAWMDLTESSLSNINEILTKIHTYCVNGAN
FT                   DTLTEEDRNSLAVNLNQLKDQIYQEGNTNYAGRYVFSGYKTDSSLVFSENTSKYNYLLT
FT                   ERLSGANLDVIQKSINSFDLSSYNPNAPWDTSFDEKPNYITAHRLRLAYNNLKNLDDGQ
FT                   LKIEIADQDSDGNVILDGDGNRTYTEYSGIIESRLSTDEDAYTPPDGTIYFLADTGELI
FT                   LPEDVYQDFRDKVDIKVSYEKNSFVKNDLKPEHYFDCVQTDLTSDDLVERNFTKQNQEI
FT                   RYEINFSQSMVVNTQGSDAITHNIGRTIDDIIFAVNSVIAVDKKISEVNKMLASGNITE
FT                   EQKTTLNQALEVLTAEKILKDEVMQKTFGSALSGIKEQQNIINVAVSDLGSRSVRIQLT
FT                   ESRLSMEQVDFEDLLSKNEDADIVDTIIKMKSQESVYNASLSAAAKIVKNSLLDFL"
FT   gene            387427..387897
FT                   /locus_tag="Cphy_0308"
FT   CDS_pept        387427..387897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0308"
FT                   /product="protein of unknown function DUF180"
FT                   /note="PFAM: protein of unknown function DUF180; KEGG:
FT                   cth:Cthe_2240 protein of unknown function DUF180"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40695"
FT                   /db_xref="GOA:A9KSQ1"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSQ1"
FT                   /protein_id="ABX40695.1"
FT                   /translation="MVIATKHFGEIELEEDKILTFDHGIFGFEDCKRYTILYDGEDENS
FT                   SVISWLQSLDEVSLALPIIQPSHVIDQYNPVIEDELLVSLGDIKEENIVVFLTLTVPSD
FT                   LTKMTTNLKAPFIINTANKKGCQVVVEDPMFVVKYPVYEKFQNRAKKEDGEC"
FT   gene            387891..388109
FT                   /locus_tag="Cphy_0309"
FT   CDS_pept        387891..388109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0309"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="PFAM: carbon storage regulator; KEGG: lbl:LBL_0100
FT                   carbon storage regulator protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40696"
FT                   /db_xref="GOA:A9KSQ2"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSQ2"
FT                   /protein_id="ABX40696.1"
FT                   /translation="MLALSRKLNESIMLGNDIEITILEIKGDQVKIGIKAPKSVPIYRK
FT                   EIYLQIQESNKEAIDGGVSLEAISKLF"
FT   gene            388399..388887
FT                   /locus_tag="Cphy_0310"
FT   CDS_pept        388399..388887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40697"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSQ3"
FT                   /protein_id="ABX40697.1"
FT                   /translation="MEKNETIKTYLCALIISLEKKEQVLIKLISITKKQKIALEAQPPN
FT                   LEEFKLEVSNKEVLIKEINELDIQFESLFHKVKAYVPDVATDYALEIKKMQEMVPRVVE
FT                   LGVTLRGLEQQNKMKLELISTTRAKEVVNVKKSSKSVAECYRAIHNLKDNKTWLDQKK"
FT   gene            389103..389477
FT                   /locus_tag="Cphy_0311"
FT   CDS_pept        389103..389477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0311"
FT                   /product="flagellar protein FlaG protein"
FT                   /note="PFAM: flagellar protein FlaG protein; KEGG:
FT                   csc:Csac_1698 flagellar protein FlaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40698"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSQ4"
FT                   /protein_id="ABX40698.1"
FT                   /translation="MEIKSINGIANYAESPVATPTVGKTGTAAVSPIQKKAPAEAMDLP
FT                   NNKQTNEQQIKSAVDKANQAMKHTQTRCEFSYHEPTKSISIKIIDEQTDEILREVPPEK
FT                   VLDMIEKMWEMAGLLVDEKR"
FT   gene            389492..391567
FT                   /locus_tag="Cphy_0312"
FT   CDS_pept        389492..391567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0312"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated protein 2 domain
FT                   protein; flagellar hook-associated 2 domain protein; KEGG:
FT                   drm:Dred_2418 flagellar hook-associated 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40699"
FT                   /db_xref="GOA:A9KSQ5"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSQ5"
FT                   /protein_id="ABX40699.1"
FT                   /translation="MPIRLSGLASNMDTDSIIKELMKAQGLKKTKVENKLTKLEWTKDI
FT                   WKDMNSKIYKFYTGPLSKLKTQGSFATKKATSSNESKVTVKAGTGAATGSHNVQVNKLA
FT                   SAQYVTGFKLDKDKNEIEVTGKTTLEDLGFAIDDGSQSTDGSKNEIVIKINNSGKTTNL
FT                   YVTAETTLNDLVNACAKAGLNASYDNTQKRLFISTKESGIDNYFEMTTDTVVVTADREE
FT                   VRNLLGYHNEGTSGSARFQMDQTIDTYTELLAITDRTKEQQKAFDEAEKKLKEYTKSNT
FT                   IADVQKDYDSLTSNVENIKCPGKIEEEIRDKYKDLTNPPPEETILAEINEAVDSEKSKY
FT                   VKYKLDEYEKINSGELPSTVTNRFYDNQTKMLGALKSAGIKDATNKIDNNNLDDIGIGT
FT                   ITVTDNVCSTSISGNKVSIISSDNSEIIYNGAKLEGTSNQVTVNGVTFELHGVTGENEK
FT                   VTLTVANDTDAVYDMVRNFVKGYNELLQEMNKLYNADSARGFNPLTEDEKGSMTDSQIE
FT                   KWEQKIKDSLLRRDDNLSGLLSSMRSNMAGSVTVNGKNLSLSTFGIVTGVYTEKGLLHI
FT                   NGDGEDPIYGGYEDKLKKALEENPEDVMAVLNKLADNLYQDMSNKMKGTSLRSALTVYN
FT                   DKEMAKLEKSYKKDIATLEKKLKEVENRYYKQFTAMETAMSKLNSQSGQLSSMLGL"
FT   gene            391596..391976
FT                   /locus_tag="Cphy_0313"
FT   CDS_pept        391596..391976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0313"
FT                   /product="flagellar protein FliS"
FT                   /note="PFAM: flagellar protein FliS; KEGG: cth:Cthe_2217
FT                   flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40700"
FT                   /db_xref="GOA:A9KSQ6"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSQ6"
FT                   /protein_id="ABX40700.1"
FT                   /translation="MAQNAASIYQGTKINTASPAELTLMLYEGAIKFCNKALYGLEQND
FT                   IAKVNENLLKAQKIVTELRSTLDFKHPIAREFDTVYDYINRRLVDANIKKDTEILEEAL
FT                   DYIRQMRDTWKEVMKKNNIYVQ"
FT   gene            392121..392591
FT                   /locus_tag="Cphy_0314"
FT   CDS_pept        392121..392591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40701"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSQ7"
FT                   /protein_id="ABX40701.1"
FT                   /translation="MKVEILLKLKEMLNKKKECLQNILYVAKEQDEITFAKESDLEIFE
FT                   KYIDEKEDLILALSKLNQEYEEFIEQMGEASSDNADSDMKQQINLINQEIISLSKEIQV
FT                   LEGKSKEKFEAYVQQEREKIKNFRLNSQMASNYYKSMNVGQLEDSYFMDQRK"
FT   gene            392760..393596
FT                   /locus_tag="Cphy_0315"
FT   CDS_pept        392760..393596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0315"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: cbh:CLC_2604
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40702"
FT                   /db_xref="GOA:A9KSQ8"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSQ8"
FT                   /protein_id="ABX40702.1"
FT                   /translation="MIIQHNMTSANTSRQLGITTGNLAKSSEKLSSGYRINRAGDDAAG
FT                   LSISEKMRGQIRGLEQGSTNAQDGISLIQTAEGALNEVHSIVQRMRELTVQASNDTYVD
FT                   EDRTSISNEMKQLSKEIDRIGTDTEFNTLKLFAADNTKYNFQVGANSDQLIEVTMKQIS
FT                   AAKLGIDDAKIADIVGTAGKTGTDITKLIDTVNSGLTIVSAFRSDLGAVQNRLEHTIAN
FT                   ADNTAENLQASESRIRDTNMAKEMVKYSKDNILQQAAQSMLAQANQSTQGVLSLLR"
FT   gene            393775..394935
FT                   /locus_tag="Cphy_0316"
FT   CDS_pept        393775..394935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0316"
FT                   /product="FliB family protein"
FT                   /note="KEGG: cbe:Cbei_2712 FliB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40703"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSQ9"
FT                   /protein_id="ABX40703.1"
FT                   /translation="MKILKPYYYDKFTCIGNKCPNTCCKGWRITVDDATYKAYKDVEGT
FT                   FGKQLIQNIDCEGKVKKFILDSDMKCPFLNDNLLCDIYINLGEEFMCRTCKVYPRVIKV
FT                   HADVIEQTLTLSCPEVSRLLISSNKVIDFKLEEETHSVFKSAKTMDDALLSCLLHVRSL
FT                   IIDIMQKRHIKLYYRQLLIIIIADKVQTSLNKKDYNEAEVIIQRFYHEDIINLYIEQFK
FT                   NIKENKKVKFDFISKLLEQIISCFLDKDKYISQLYKKYLIDSGMTIESILGKYEEQFDQ
FT                   YYESHQYVYENFYVHTIFRYCLDALDDGDISKQVVLANIGYIIIHVFDIISWMDNNKEL
FT                   SIDNQSLIMGGFSFAFEHNPIKFNALNEFLEKNNLSSLAFQALMLT"
FT   gene            395189..396976
FT                   /locus_tag="Cphy_0317"
FT   CDS_pept        395189..396976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40704"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSR0"
FT                   /protein_id="ABX40704.1"
FT                   /translation="MKIDTKTHRKWNNYSNFVKFLGCFLLLFAFSVSLIAFGKLTAYGQ
FT                   TGRSVTYSDITIDHTKGEIRISVQSGDTILYCDAKKLDWMEATTTVNGTNSVAVIDISW
FT                   INRSKEYILGIKNKDETSDDAMVQINLRPREEGLKVGLSGTSTLIDKVVNKPLELVYPT
FT                   NYTINSVCKEYGYIYFYTGNGSTARYYEEYDNIEWKNGADGVWREFKELNPAIYANKGA
FT                   SLYFRVKTAVEEKLTTTVDKQGVYVTKGAPAGKEVRFSYPKLANAPKVALNGGDLTVAL
FT                   RAGYEYRLPGGEWVNVVDAHANSLGKIDPVSLYSLYEKYNRNDNSQNKKFTFQYQEFVM
FT                   QIRVAATSKKPSSKSFNLNVEAPKATETTGIDISYTLPYSKKDGISFTNSNPDSYQVAL
FT                   ISSKFCGGVGTFDASKVDYKQVKWYTVKPGTTEKPSVVKIAGTAYTGKNEIEQPILIYR
FT                   LAPINESKTQKQMIASKAIAVNLPTEVVQTVTDSVQSKVELVQGAAAEGKIEVSTTNVS
FT                   VGATPKISALKKPTGITITADKVKTDGKFTISVKITSAAKVVDSYKFNVTIEGVTKEYS
FT                   VTIKEKPAPTPTVTPTPTP"
FT   sig_peptide     395189..395305
FT                   /locus_tag="Cphy_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.654 at
FT                   residue 39"
FT   gene            397096..398499
FT                   /locus_tag="Cphy_0318"
FT   CDS_pept        397096..398499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0318"
FT                   /product="Amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="KEGG: sfu:Sfum_0268 amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40705"
FT                   /db_xref="GOA:A9KSR1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSR1"
FT                   /protein_id="ABX40705.1"
FT                   /translation="MGGFFGVASKTDCVFDLFFGTDYHSHLGTRRGGMAVYGEDGYDRS
FT                   IHNIENSPFRTKFEKDVNNLKGNIGIGCISDFEPQPLMVRSHHGTYAITTVGKINNSEE
FT                   LVNQIFQSGNPHFLEMSGGDINPTELVAAIINQKDHLVEGIRYAQEIIDGSMTLLIMTP
FT                   KGIYAARDRMGRTPVSIGQKEGAFCASFESFAYLNLGYSEYKELGSGEIVVITPEGVQT
FT                   LSEPTSDMKICTFLWVYYGYPSSSYEGVSVEQMRYRCGDLLARRDQVKPDIVAGVPDSG
FT                   TAHAIGYANRSGIPFSRPFIKYTPTWPRSFMPTIQSKRDLIAKMKLIPVHDLIKDKSML
FT                   LIDDSIVRGTQLRETTEFLYQSGAKEVHIRTACPPLLYKCKYLNFSRSTSEMDLITRRV
FT                   IMEAEGEHANEVLPEYANPESDRYLYMLDQIRSKLNFTSLRYQRLDDMIKSVGISPCKL
FT                   CTYCWNGKE"
FT   gene            398539..399117
FT                   /locus_tag="Cphy_0319"
FT   CDS_pept        398539..399117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0319"
FT                   /product="glycerol-3-phosphate responsive antiterminator,
FT                   GlpP"
FT                   /note="PFAM: glycerol-3-phosphate responsive
FT                   antiterminator; KEGG: spe:Spro_2465 glycerol-3-phosphate
FT                   responsive antiterminator, GlpP"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40706"
FT                   /db_xref="GOA:A9KSR2"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="InterPro:IPR035928"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSR2"
FT                   /protein_id="ABX40706.1"
FT                   /translation="MDVNMKHTFTKTLEDCPVIAALKDNEGLEQCLSSESSTVFILYGD
FT                   ILTISDIVNRVKECGKLAMVHVDLISGLSSKEISVDFIKKHTKADGIISTKPMLIKRAK
FT                   ELSLYTVLRFFVIDSMAYENIEKQCMNVKPDCIEILPGIMPKVIKKICNTRDIPVIAGG
FT                   LISDKEDIMQALDAGAVSISTTNPKVWFM"
FT   gene            399661..401118
FT                   /locus_tag="Cphy_0320"
FT   CDS_pept        399661..401118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0320"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; BFD domain
FT                   protein [2Fe-2S]-binding domain protein; KEGG: ctc:CTC02436
FT                   glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40707"
FT                   /db_xref="GOA:A9KSR3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSR3"
FT                   /protein_id="ABX40707.1"
FT                   /translation="MYDVIIIGAGVIGCAVARELSKYERKVLVVDKASDICEGTSKANS
FT                   GIIHAGFDAKPGSLKAKFNVLGNQMMEELSKQLDFPFQRNGSFVLGFSEEDLIELEKLK
FT                   EQGEKNGVKELEILTGEEARSLEPNLSKEVIWALYAKQGGIVCPFNLTIALAENAFMNG
FT                   AQFKLNTEVLCINRISSTEEIPYDFYHIETNLGILRSRTVVNAAGVYADQFHNMVSEHK
FT                   IKIIPRKGEYCLFDKSVGNYVHKTIFQLPTKMGKGVLVTPTIHGNLLVGPTAEDVFDKE
FT                   DISTSLDGLNEVLNKASKSVKDLPRKQVITSFAGLRAHEESGDFIIEECEDAKGFFDVA
FT                   GIESPGLTSAPAIGEYISNLIMDYLPAYLNSSFKPYRKGFISIAHASFEERKQYFQENP
FT                   AYANVICRCEMVTEGEIMDAIHRPLGATTLDGIKRRTRAGSGRCQTGFCSPKIIEILAR
FT                   ELKVDPSTITKLGDGSNFLTGFNKEEV"
FT   gene            401119..402381
FT                   /locus_tag="Cphy_0321"
FT   CDS_pept        401119..402381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0321"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ctc:CTC02435 sarcosine oxidase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40708"
FT                   /db_xref="GOA:A9KSR4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSR4"
FT                   /protein_id="ABX40708.1"
FT                   /translation="MNYDIVIIGGGPAGLAAALGARESGASSILIIERDKELGGILNQC
FT                   IHTGFGLTTFKEELTGPEYAHRYIEQIKEKDVTVMLQSMVIEITKEKQIMVMNRERGCF
FT                   MIEAKAIILAMGCRERPRGALNIPGYRPAGIYTAGTAQHYVNVEGRMPGKEVVILGSGD
FT                   IGLIMARRLTLEGAKVKLVAELLPYSSGLKRNIVQCLEDYEIPLKLSHTVVAIDGKDRV
FT                   KGVTLAKVDEQLQTIKGTEEYITCDTLLLSVGLIPENELSALLSATINPTTGGPIVNES
FT                   LETSVDGVFACGNVLHVHDLVDNVSSEARSAGKHAVEYLNHVTEEEVEKEILVQSGEGI
FT                   RYTVPNQLRFSRLDEQTMIRFRVTRPFNTAYFSVYFDDIRVDRKSKKNLTPGEMGQIII
FT                   NKKEIEKYPNLNKITVKIEED"
FT   gene            402394..402762
FT                   /locus_tag="Cphy_0322"
FT   CDS_pept        402394..402762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0322"
FT                   /product="protein of unknown function DUF1667"
FT                   /note="PFAM: protein of unknown function DUF1667; KEGG:
FT                   ctc:CTC02434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40709"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="InterPro:IPR036593"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSR5"
FT                   /protein_id="ABX40709.1"
FT                   /translation="METRVFTCIRCPMGCELTATINDNGVITVKGNACIRGEQYARKEL
FT                   TSPLRVLTTTVRVIGGTQAMVPVRTKGDIPKEKIMDGIRQLKQIQVKAPIQIGEVIVEN
FT                   LVNTGIAVIATKTVQKRA"
FT   gene            402853..403878
FT                   /locus_tag="Cphy_0323"
FT   CDS_pept        402853..403878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0323"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cdf:CD3350 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40710"
FT                   /db_xref="GOA:A9KSR6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSR6"
FT                   /protein_id="ABX40710.1"
FT                   /translation="MITVSACLIVKNEEEVLARCLDCVQRVADEIIIVDTGSTDRTKEI
FT                   ASRYTDLIYDFKWVDDFSAARNFSFSKASMEYLYVADADEIIEEEQIHNFLRLKETLFP
FT                   EIEIVQMYYCNQLEFNTTYNFDKEYRPKLYKRVREFRFYDPLHEAVRLEPVIYDSEIEI
FT                   VHKPLSNHAPRDFTTYQKIIARGENLSDKLRSMYARELFIAGEDSDFIDAYSYFYETVL
FT                   HTTLGLTELKQCQCVLARGARLQQKDQDFFKVCLKNVACSVTSSEICFELGEYYLQNGD
FT                   ELEAILWYYNAAFETEAELNLHYQGDYPLNKLALCYQALGNDEEALKYVNLRDEWKAEE
FT                   R"
FT   gene            404066..404515
FT                   /locus_tag="Cphy_0324"
FT   CDS_pept        404066..404515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0324"
FT                   /product="peptidase A8 signal peptidase II"
FT                   /note="PFAM: peptidase A8 signal peptidase II; KEGG:
FT                   chy:CHY_1506 signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40711"
FT                   /db_xref="GOA:A9KSR7"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSR7"
FT                   /protein_id="ABX40711.1"
FT                   /translation="MIFFIIAIAIFVLDFFIKQYIEKNKTLGKSEKIFKDRIIVTKYHN
FT                   QGAFLNFMEKKREILLLLSGIMIGGITILMAIIFPQKGKRILKTGIAFLAGGAASNVYD
FT                   RLKRGYVVDYFSFSFYQKVIFNISDFFIFLGSIVLAVRIIFKGLE"
FT   gene            complement(404694..406298)
FT                   /locus_tag="Cphy_0325"
FT   CDS_pept        complement(404694..406298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0325"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="PFAM: glutamine amidotransferase class-I; CTP
FT                   synthase; KEGG: cth:Cthe_1923 CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40712"
FT                   /db_xref="GOA:A9KSR8"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSR8"
FT                   /protein_id="ABX40712.1"
FT                   /translation="MGVKYVFVTGGVVSGLGKGITAASLGRLLKARGYHVTMQKFDPYI
FT                   NIDPGTMNPIQHGEVFVTDDGAETDLDLGHYERFIDESLTKQSNVTTGKIYWTVLSRER
FT                   RGDFGGGTVQVIPHITNEIKSRFYRNDGCDETQIAIIEVGGTVGDIESQPFLEAIRQFQ
FT                   HDVGRENAILIHVTLIPYLKASGEMKTKPTQASVKDLQGMGIQPDIIMCRTELPLETGI
FT                   REKIALFCNVPRNHVLQNLDADTLYEIPLMMEEEHLADVACECLHLDCPEPDLRDWEDM
FT                   VYSLKNPTRDVTVALVGKYTQLHDAYISVVESLKHGAVAHNASIQIKWIPSESVTKESV
FT                   ADLLQEVSGVLVPGGFGDRGIEGKILAIQYAREHKLPFLGLCLGMQLAVVEFTRHVLGF
FT                   SDAHSVELSPETTHPVIHLMPEQDGIEDIGGTLRLGSYPCILDKTSKAYELYQTTTITE
FT                   RHRHRYEVNNYYRDELIRHGVKLSGLSPDGRIVEMIELLDHPWFLATQAHPEFKSRPNR
FT                   PHPLFKGFVGAALEYSK"
FT   gene            406898..408943
FT                   /locus_tag="Cphy_0326"
FT   CDS_pept        406898..408943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0326"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="KEGG: cbe:Cbei_3037 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase central domain protein; peptidase
FT                   M41 FtsH extracellular; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40713"
FT                   /db_xref="GOA:A9KSR9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSR9"
FT                   /protein_id="ABX40713.1"
FT                   /translation="MDNRDKNGGDKKKNWPGKRGWIFSLVAALIMVMLFSYMTKQLERS
FT                   RIEEISFNEFLAMIENNNQNKIDHIEIDYSKNQYTIYTELAKNNPREKIYVAGIPRDYP
FT                   VSELLIEKGIKELPNRNDNETTIVDILLAYVLPFVLIYGVMFFLFRMISKSGGGMMGVG
FT                   KSNAKVYVEKETGVTFKDVAGQEEAKESLTELVDFLHNPGKYTRIGAKLPKGALLVGPP
FT                   GTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRDLFKQAQTQAPCIVFIDEI
FT                   DAIGKSRDSHYGGGNDEREQTLNQLLSEMDGFDTSKGIVILAATNRPEVLDKALLRPGR
FT                   FDRRVIVDKPDLKGRIETLKVHAKNVLMHDSVDLEEIGLATSGAVGSDLANMINEAAIL
FT                   AVKEGRTVVTQNDLFESVEVVIAGKEKKDRILGPEEKKIVAYHEVGHALVTALEKNAEP
FT                   VQKITIVPRTMGSLGYVMQVPEEEKYLMSKDELLARIVTLYGGRAAEELVFGSITTGAS
FT                   NDIEKATSLARAMVTQYGMSDRFGLIGLESVENRYLDGRAVLNCGDATAAEIDSEVMAI
FT                   LKKCYDRAKELLAGNRDVLDKIADFLVNKETITGKEFMKIYHEVKGIPEEEKELISSEE
FT                   RNKIREVSVRKQDNHESSSSIVRAAELKEKTETEEEMNSNSGNTVL"
FT   gene            409162..411048
FT                   /locus_tag="Cphy_0327"
FT   CDS_pept        409162..411048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0327"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   Excinuclease ABC C subunit domain protein; excinuclease ABC
FT                   C subunit domain protein; UvrB/UvrC protein; KEGG:
FT                   amt:Amet_4124 excinuclease ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40714"
FT                   /db_xref="GOA:A9KSS0"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSS0"
FT                   /protein_id="ABX40714.1"
FT                   /translation="MFDLDEELKKLPAKPGVYIMHNNKDEIIYVGKAISLKNRVRQYFQ
FT                   SSRNLSTKIQQMVSNIDHFEYIIVDSEMEALVLECNLIKEHRPKYNTMLKDDKSYPYIK
FT                   VTVNEAYPRVLFARQQKKDKAKYFGPYTSLGAVKDILDLLRRLYFIRTCNRNLPKDIGL
FT                   ERPCLYYHIKQCKAPCQGYISEEEYRKSIDEVIEFLNGNYALVTKDLQAKMKAASENLE
FT                   FEEAAGYRDLILSVEKLSQKQKASDVDGVDRDIIAFASTGDEAVAQVFFIRDGKMLGRE
FT                   HYHITGVANESRSSIMTNFVKQFYAGTPYIPRELLLSEPLEEEELISEWLSTKRGQKVR
FT                   IHVPKKGDKERLVELAEKNASLVLQQDSDKIQREEAKTIGAVRHIADMLSLPGIYRMES
FT                   FDISNTNGFESVGSMVVYENGKPKRNDYRKFKIKSVQGPDDYASMREVLTRRFSHGQKE
FT                   AEELAKKNIDISHGSFTRYPDLILMDGGRGQVNIALEVMNELKLTIPVCGMVKDDNHRT
FT                   RGLYFDNVEIPIDTHSEAFRLITRIQDETHRFAIEYHRSLRSKAQVHSILDDIDGVGQT
FT                   RRRALMKHFASIDAIKAASMEDLMAVPSMNKLSAAKVYEFFHTSSERGTETT"
FT   gene            411257..412186
FT                   /locus_tag="Cphy_0328"
FT   CDS_pept        411257..412186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0328"
FT                   /product="HPr kinase"
FT                   /note="TIGRFAM: HPr(Ser) kinase/phosphatase; PFAM: HPr
FT                   serine kinase domain protein; KEGG: cth:Cthe_0110 HPr
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40715"
FT                   /db_xref="GOA:A9KSS1"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSS1"
FT                   /protein_id="ABX40715.1"
FT                   /translation="MYTVELGKLVEKMNLENCTPEIDISSIQITQPDVNRPALQLTGFF
FT                   DYFDSDRVQIIGNVEHAYMQKMEKDHGLGIMKKLMSFKMPCIVFCRGIEVSEDFKEVAI
FT                   EEGVPIFRTEKTTSSFMAEVIRWLKVELAPRISIHGVLVDVYGEGILIMGESGIGKSEA
FT                   ALELIKRGHRLVTDDLVEIKKVSDDTLIGTAPDITRHFIELRGIGIIDVKTLFGVESVK
FT                   NTQSIDLVIKLEEWNRDKEYDRLGLEEQYIEFLGNRVVCHNIPIRPGRNLAVICESAAV
FT                   NYRQKKMGYNAAQELYNRVTNNLLKKSK"
FT   gene            412380..413318
FT                   /locus_tag="Cphy_0329"
FT   CDS_pept        412380..413318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0329"
FT                   /product="glucokinase, ROK family"
FT                   /note="TIGRFAM: glucokinase, ROK family; PFAM: ROK family
FT                   protein; ATPase BadF/BadG/BcrA/BcrD type; KEGG: cac:CAC2613
FT                   transcriptional regulators of NagC/XylR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40716"
FT                   /db_xref="GOA:A9KSS2"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSS2"
FT                   /protein_id="ABX40716.1"
FT                   /translation="MDKFCFGIDIGGTTIKCGLFTANGELKEKWEIPSRTENGGIQVPQ
FT                   DVADTIDAKLKELSIEKKDVLGVGIGVPGPITEDGTVLKCANLGWDIFNVNEKMSALTG
FT                   LKVATANDANVAALGEMWMGGGKGYKNIVMVTLGTGVGGGVILNGKIVAGSNGGGGEIG
FT                   HMTMNLDEKETCGCGKHGHLEQYASATGIVRLAKKRLLDTSVTTSLRELAEVTAKDIFD
FT                   HAKAGDTVALELVEELGRYLGLALSHVAAAVDPQVFVIGGGVSRAGSMLLDVISKYYNQ
FT                   NIIFALSNKEFRLAELGNDAGIYGCAKLVIG"
FT   gene            413478..414410
FT                   /locus_tag="Cphy_0330"
FT   CDS_pept        413478..414410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0330"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: tte:TTE1836 UDP-N-acetylmuramate
FT                   dehydrogenase; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40717"
FT                   /db_xref="GOA:A9KSS3"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSS3"
FT                   /protein_id="ABX40717.1"
FT                   /translation="MNNVILQELKNIVSTERVTCNEPLSKHTSFKIGGPADYFVITKKI
FT                   EETAAVIQCCNQHNLPLLMIGKGSNLLISDAGIRGVVLKQEDNTEGFFVTQCEEGYLVT
FT                   GGAGMNLSAFAMKIANESLTGFEFAAGIPGSLGGAVYMNAGAYGGEIKDCIKSARVLTK
FT                   EGQILSLNREELELSYRSSIIQKKGYYVIDATFLLQKGNQEDILRKIEELNQARKDKQP
FT                   LEYPSAGSTFKRPEGYFAGKLIMDAGLRGYRVGGAMVSEKHCGFVINTGDATAKDVLQL
FT                   IDDVRRIVKEKFGVTLEPEVRLIGEKVNP"
FT   gene            414428..415309
FT                   /locus_tag="Cphy_0331"
FT   CDS_pept        414428..415309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cac:CAC0511 predicted P-loop containing kinase, similar to
FT                   B.subtilis YvcJ"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40718"
FT                   /db_xref="GOA:A9KSS4"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSS4"
FT                   /protein_id="ABX40718.1"
FT                   /translation="MSEDVDEHMRFVIVTGMSGAGKSSVLKMLEDSSYFCVDNLPIPFI
FT                   MKFARLAVKESANITKVALGIDIRSGQALEELGKVLEDVKSAGYQYEILFLEASTEILV
FT                   KRYKETRRMHPLSGTGRVDKGIELERRKLRFLKERADYIIDTSRLLVRELKTEIDNIFV
FT                   QDGTYRNFFITVLSFGFKYGLPNDADLVFDVRFLQNPYYVPKLKSKTGNEPEVRDFVLS
FT                   LEQAEEFLTKLMDMLLFLIPNYIAEGKNQLVIGIGCTGGRHRSVTLANEITKRLSATEY
FT                   GVKAEHRDVEKG"
FT   gene            415316..416257
FT                   /locus_tag="Cphy_0332"
FT   CDS_pept        415316..416257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0332"
FT                   /product="protein of unknown function DUF199"
FT                   /note="PFAM: protein of unknown function DUF199; KEGG:
FT                   tte:TTE1821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40719"
FT                   /db_xref="GOA:A9KSS5"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSS5"
FT                   /protein_id="ABX40719.1"
FT                   /translation="MSFSKEVKEEITKQMNNARHCRLAEIAALLSACGHVIQKDGEIKS
FT                   IVLQTENILVARKYFTLLKKTFNINTEILIRKNKAGKNSLLFLLVVKLPKQVSLLYQAT
FT                   KLSLHHELGDKALVVDPIVVQNTCCKRAFVRGLFLAAGSMSDPEKTYHYEIVFPDLERA
FT                   SQLQEIINSFLIDAKIVLRKKYYVVYVKEGSQIVDLLNIMEAHTSLMDFENVRILKEMR
FT                   NSINRQVNCEAANINKTVTAAAKQIDDILFIRDTIGFDNLTEGLEEIAELRISYPESSL
FT                   KELGAMLNPPIGKSGVNHRLKKLCSIADGLRQ"
FT   gene            416274..416531
FT                   /locus_tag="Cphy_0333"
FT   CDS_pept        416274..416531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0333"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: oih:OB2465 catabolite
FT                   repression HPr-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40720"
FT                   /db_xref="GOA:A9KSS6"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSS6"
FT                   /protein_id="ABX40720.1"
FT                   /translation="MISKKIVIKIPTGLEARPVALLVQVASQYESNVYVECEEKKVNAK
FT                   SIMGMMSLGLPAGEEINVIVDGSDEEVAMENIEKYLCGNK"
FT   gene            416855..418246
FT                   /locus_tag="Cphy_0334"
FT   CDS_pept        416855..418246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sha:SH0302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40721"
FT                   /db_xref="GOA:A9KSS7"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSS7"
FT                   /protein_id="ABX40721.1"
FT                   /translation="MDNQKKPKDGKITLRKVTKILIMEGLILSVLFISFAMKRLSDNKV
FT                   DPVETTKPVVQTSNNNITITPTADPMREVKKEQEAKQQEVLKEAKLLAAGYDYDKAINM
FT                   LKSEKGYENVDSYMVAINEFEEEKKSLVPLGAYKSSEEVSHLFFHSLIYDTSKAFDGDY
FT                   KENGYNYYMVTVKEFKEMLRQLYENNYVLVSVHDLVTKVTKKDGTTTYQDGEILLPPNK
FT                   KPFVLSQDDVNYYDYMDGDGFASRMVIDENGKPSTLMINEDGTTTVGDYDMVPIVERFI
FT                   EEHPDFSYRGARGIIALTGYEGALGYRTDPASKNSKTYAQDKETVKQVAEVMKQYGWEF
FT                   ASHSNGHRDMGACTEEFLKKDTDKWLKYVGSLVGETDLYIFPYGIDIQSGAGTYKNAKF
FT                   QYLDSVGFHYYFGVFKEPWIQVKDNYVRMSRRAIDGQAMLQYPERLKDIFDLSTILDDV
FT                   RPALK"
FT   gene            418448..422008
FT                   /locus_tag="Cphy_0335"
FT   CDS_pept        418448..422008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0335"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: tte:TTE1818 DNA polymerase III alpha subunit;
FT                   TIGRFAM: DNA polymerase III, alpha subunit; PFAM: PHP
FT                   domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DNA polymerase III alpha subunit;
FT                   SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40722"
FT                   /db_xref="GOA:A9KSS8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSS8"
FT                   /protein_id="ABX40722.1"
FT                   /translation="MSFTHLHVHTEFSLLDGSGKIKEMAAQAKKLGMDALAITDHGVMY
FT                   GVIDFYRACLAEGIKPIIGCEVYVAPNSRFDKEGSASEERYHHLVLLAENDIGYHNLIK
FT                   IVSRGFTEGFYYKPRVDHELLKEYSEGIIALSACLAGEVAVMLRRNFFEEAKASALKLQ
FT                   EIFGAGNFFLELQDHGYPEQKSVNQGLLRISEETNIPLVATNDIHYTYDTDETAHDILL
FT                   CIQTQKKVTDEDRMRYAGGQFYMKSPEEMRELFPYALQALQNTEEIAKRCNVTIEFGHY
FT                   KLPKYDVPAPYTVSPGSGSTDDEGDISASQNISTNTDILAREYLRKLCEEGLVRRYKDP
FT                   STELWDRLNYELETIENMGFVDYFLIVWDFIKYAKDNDIIVGPGRGSAAGSVVSYCLEI
FT                   TNIDPIKYSLLFERFLNPERLTMPDIDIDFCFERRQEVIDYVVSKYGKDRVVQIVTFGT
FT                   MAARAVIRDVGRALDMPYASVDVVAKMIPTELGITIEKALNINPDLKKLYESDPEVMHL
FT                   IDMSKRLEGLPRHTSMHAAGVVISNAPADEYVPLSRSSDDSITTQFTMTTLEELGLLKM
FT                   DFLGLRTLTVIQNAVLLVNQAKARLGETEENFLNIDEIDYNDSKVLDLISSAKTEGIFQ
FT                   LESSGMKSFMKELKPQNLEDIIAGISLYRPGPMDFIPKYIQGKNNQKSIQYECKELEPI
FT                   LSPTYGCIVYQEQVMQIVRELAGYSFGRSDLVRRAMSKKKASVMEKERQSFVYGNVEEG
FT                   VPGCISKGIPEAVANHIYDEMTDFAKYAFNKSHAAAYAVVSYQTAYLKCYYPVEFMAAL
FT                   MTSVIDNPSKVAEYIYTCRQMGIKLLPPDINDGYATFTVSGENIRYGLSAIKGLGRPVI
FT                   DALVIEREENGPYLNLKDFASRLSGKEVNKRTIESFIKSGAFDSMPGTRKQLMHVYVGV
FT                   LDGVSQEKKRAMTGQMSLFDLDGDAKVMNEEIIFPEVGEYSKEELLAFEKEVLGIYVSG
FT                   HPLEAYELLLKRNATANTADFIVEEETNTVKVADGDTVTVGGMITSRTLKTTRTNAVMA
FT                   FITLEDMFGTMEVIIFPRDYEKFKYTLEIDNRVFIKGKVAVEEDKPAKLICQSITPFAD
FT                   ISKELWVKFSDKEAFLNNEKALYEIIKNYDGNDRITVYCEKEKAIKKLPLSQSVIIEEG
FT                   LLENLRNAFSEENIKVVEKL"
FT   gene            422399..423424
FT                   /locus_tag="Cphy_0336"
FT   CDS_pept        422399..423424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0336"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="KEGG: csc:Csac_1830 6-phosphofructokinase; TIGRFAM:
FT                   6-phosphofructokinase; PFAM: phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40723"
FT                   /db_xref="GOA:A9KSS9"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSS9"
FT                   /protein_id="ABX40723.1"
FT                   /translation="MTSSKDVMFEQLGASNEITSNVKTIGILTSGGDAPGMNAAIRAVV
FT                   RTALANGLEVKGIRRGFTGLLEEDIIDLNANSVSDIIQRGGTILYTARCPEFVTKEGQD
FT                   KGAEVCRKHGIDGLVVIGGDGSFQGAKQLAARGINTVGLPGTIDLDIACTDYTIGFDTA
FT                   VNTAMESIDKVRDTSTSHERCSIIEVMGRNAGYIALWCGIANGAEDVLTTERYDHDEQR
FT                   IISNIIEKRKIGKKHHIIVNAEGIGDSYGMAKRIEAATGMETRATIIGHIQRGGSPTCK
FT                   DRVYASAMGAKAVDILCRGGSNRVVAYKHGEFVDFDINEALAMKKDLDEYLFQMSKKLS
FT                   R"
FT   gene            423685..425433
FT                   /locus_tag="Cphy_0337"
FT   CDS_pept        423685..425433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0337"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: ctc:CTC01811
FT                   multidrug resistance ABC transporter ATP-binding and
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40724"
FT                   /db_xref="GOA:A9KST0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST0"
FT                   /protein_id="ABX40724.1"
FT                   /translation="MNPRAKKFLSYYKPYWKLFLADMLCALTAAGISLVYPLIVRYITQ
FT                   DVLVNNEINQAIQIIIRMAAVLIGLAILEFGCNFFIAYKGHIMGAKMEYDMRNEIFGHF
FT                   QKLSFNFYDNQKTGQLMTRITNDLFDITELCHHGPEDIVISIIKFVGAFIILVRINWKL
FT                   TIILFLFIPMMFIFAYIMKGRMNRAFRKNRERIADINAQIEDNLSGIRVVKSFANEDCE
FT                   TSKFDAGNKRFVDSKSHAYWQMATFHSGLSFFTNLINVAVIVGGGILIALSGILLSDML
FT                   TFMLYVNNIIEPIRKLINFTEQFQNGVTGFSRFMEIIETNPDIVDSPDAKELKNVRGDI
FT                   SFEEVSFKYQDTTSEVFRNINLQVPAGEYIALVGSSGVGKTTMCSLIPRFYEVSTGRIT
FT                   IDGQDIRSLTQKSLRKNIGIVQQDVYLFAGTVADNIRYGDLDATMEEVIEAAKNANAHE
FT                   FIMNLPEGYNTYIGQRGVKLSGGQKQRLSIARVFLKNPPILIFDEATSALDNESEKIVQ
FT                   ESLEKLAKNRTTFVIAHRLTTIKNARNIIVLTEEGIKEQGTHEKLLSLDGIYASLYHLN
FT                   YEKQQA"
FT   gene            425701..427869
FT                   /locus_tag="Cphy_0338"
FT   CDS_pept        425701..427869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0338"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: mmp:MMP1127
FT                   RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40725"
FT                   /db_xref="GOA:A9KST1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST1"
FT                   /protein_id="ABX40725.1"
FT                   /translation="MKIFEQLKEELGIKLEQVEATVKLIDEGNTIPFIARYRKEVTGSL
FT                   NDEVLRSLSERLTYLRNLEEKKASVLASIEEQGKLTEELKAQIEAAATLVVVEDLYRPY
FT                   RPKRRTRATIAKEKGLEPLAEIIIAQEISRDILELAEDYVSEEKEVSSAKDAVAGALDI
FT                   IAESISDEADYRIHIRKLTFEEGSITSAAKDAEAESVYELYYEYSEKISKVAGHRVLAL
FT                   NRGENEKFLTVKITAPTEKIMNYLKGKVIKRDNPHTNDYLVVAIADSYDRLIAPAIERE
FT                   IRNDLTEKAEDGAIVVFGQNLTQVLMQPPIAGQVVLGWDPAFRTGCKLAVVDATGKVLD
FT                   TVVIYPTAPQNKVEEAKTVLKKLFKKYQITLISVGNGTASRESEQIIVDLLKEITEPIS
FT                   YVIVNEAGASVYSASKLATEEFPNFDVGQRSAASIARRIQDPLAELVKIDPKSIGVGQY
FT                   QHDMNQKKLSEALGGVVEDCVNKVGVDLNTASASLLEYISGISKPIAKNIVIYREENGK
FT                   FKNRKQLLKVAKLGPKAFEQCAGFLRINDGDNPLDGTSVHPESYEAAEKLLEMLEVKDL
FT                   RELQAKAKEVDAKREQSISQKVKDKKKMAQELSIGEITLTDIIKELEKPSRDPREEMPK
FT                   PILRTDVLDMKDLTEGMILKGTVRNVIDFGAFVDIGVHQDGLVHISQLSKQKFVKHPLD
FT                   IVSVGDIVEVKVLSVDVSKKRIQLSMIL"
FT   gene            428277..429278
FT                   /locus_tag="Cphy_0339"
FT   CDS_pept        428277..429278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0339"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bld:BLi01385 transmembrane
FT                   lipoprotein; RBL02385"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40726"
FT                   /db_xref="GOA:A9KST2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST2"
FT                   /protein_id="ABX40726.1"
FT                   /translation="MESTKQDAVAIVNTSKQRFRRHKKKKEIEYEEKIPFFKYFKRHYI
FT                   LYLMVLPGIIYFIVFRYVPMLFNIIAFQNYSPYKGIAGSDWVGWMHFKNFFAGKDFAML
FT                   LTNTLAISFMNLFIFFPMPIILALLLNEIKHNGYKNIVQTCVYIPHFISLVVVYSLTYL
FT                   ILNESNGVINQLIQAMTGHTVDFLSSKPWFRPILLLQTVWKETGYGTIIFLAALAGVDV
FT                   QLYEAAEVDGAGRWKKMWHITLPAIKATIITMLILRVGSILNTGYEQIFLLQNSLNRSV
FT                   SEVFDTYVYKQGITQGSFSYATAVGLFKGIVGTVMVLTVNKIAKKSGEDGLY"
FT   gene            429392..430300
FT                   /locus_tag="Cphy_0340"
FT   CDS_pept        429392..430300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0340"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bld:BLi01386 transmembrane
FT                   lipoprotein; RBL02384"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40727"
FT                   /db_xref="GOA:A9KST3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST3"
FT                   /protein_id="ABX40727.1"
FT                   /translation="MKIFTYKRKGIKGRLSTRVVTGIIYSFCGLCALITLLPFLYIVAG
FT                   SFATEKELIERAFFLIPSQISWNAYHYIIKTGAIILGIKNSLYLTTVGTIMNMILMTLF
FT                   AYPLSRRGFRGKNLILNMVILTMLLPVGMIPMFMLIRGIGWYDSYLALTIPGAINAFNM
FT                   IIIKKFFQGLSLELEDAARIDGASDWKIFRKVALPLSKPVLASITLFTAVGYWNNYFGP
FT                   MIYLNSQKKYTAQLFLRQIVMTSQGISKDGSLIDWGDFGAPPTVAIRMAATVITTVPIL
FT                   MVYPFVQKHFAKGVMVGSVKG"
FT   sig_peptide     429392..429538
FT                   /locus_tag="Cphy_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.836 at
FT                   residue 49"
FT   gene            430405..432018
FT                   /locus_tag="Cphy_0341"
FT   CDS_pept        430405..432018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0341"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bld:BLi01384 lipoprotein; RBL02387"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40728"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST4"
FT                   /protein_id="ABX40728.1"
FT                   /translation="MRKKKLLSMLLAAALVVTSLAGCSAKEEKTGGQGNVATQPPKGNE
FT                   NAGVSNTPKERPKVSIMSFDYSGQAMMGPNAEQVIKVLEDYTETNLEFQFVPSDAYEDK
FT                   LSLTLASGSDMPMIIACGSFNANIVNNARAGAFWDLNDFIYDEAKYPNLSKANKNISNM
FT                   VSVDGSLYGIYRARTLGRNGFGYRKDWADKLGLKEPETIDDVYNMLYQFTYGDPDGNGK
FT                   KDTYGLNLCKYTGPLDIMQTWFGCGNGWVDQNGSLVPVHQTPEYEEALDWFKKLYDDGL
FT                   IAKDWAVRETGTWTDDNKNGISGMYIDTIDNARKVWDYYVNNNIPSVLNDGTIATFAMG
FT                   GGIAKTAGGQKHTLATAGYNGFFVLTKGGCKTEADVEAALHFLDKMNDDEMQILSSYGL
FT                   KDIHYSLDENNVFTDIKGDNKDTLLLDYEALNQTVAYIPTNTITGIKIPTTERQDIQAE
FT                   LYIQNEKNVVFNPAAALIINSETYTLNGANLDQIINDARTQYIVGEINKDGLKAAWNLW
FT                   ASTGGSDVIKEVNDAYAKTK"
FT   sig_peptide     430405..430482
FT                   /locus_tag="Cphy_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.702 at
FT                   residue 26"
FT   gene            432371..434707
FT                   /locus_tag="Cphy_0342"
FT   CDS_pept        432371..434707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0342"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bha:BH0483 transcriptional regulator
FT                   (AraC/XylS family)"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40729"
FT                   /db_xref="GOA:A9KST5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST5"
FT                   /protein_id="ABX40729.1"
FT                   /translation="MEEKQGSINYKKQIFIIIMTGALLPVILLALYFYYTYIHEVSDKI
FT                   DLSNAKALEQVRNKVENVTETMQLNYMSSLWKGDYVVKEDSIDWFMKNIVSYSDYSNLK
FT                   KVQDELLGATYLRIYINSFYFINFSTGWVLTSNGMYPLNEVVNQEQLYDLFYTGMSDCK
FT                   WTYLSIENEGKGNRVIKSDYITLAIKAPLNLKSPNCLLLVNLSSVGFERLLRNSLSSGK
FT                   LTVFDAQGKLLFTEHKEVSEFLDEYIKEHNTTIESLVERRDELSKKSGFNLNFSYSGAN
FT                   GWLYVSSYDPAIVTREASSIIITAGLLILFMMTLIFLFSVVGSRTIYRPVSQLVTNLRN
FT                   IEEIEEVAGQKENEFKFIGKRINRLVDSKNDMKELIQVQQKQLKELFVLRLLKGEVREE
FT                   NIESNLKNFGFEKMRYISMITISVSSKVIEEDWDYTKQDMIKISIVENMPEFISDQLLF
FT                   PTVTNSNVILCTITRELKEELEAASIELIRHLTDYIVMESGYHANFGISQPFDSLMKFR
FT                   QAYNESLEAVKNNETLNRENTICEQQNFIFYSDIANSNSNNYTYELILEKEMKAAVDEC
FT                   DKEKAFLLADTFINHMAESGAVLNELHFYLHRFMVAVILVATDAGISVNDILGHGSVNV
FT                   FLQFNQLSDLDKIRSFYKHNIISPVIKQLSTFRRSNSDLVLDKIVKLVRETSSDITLTE
FT                   CADQLGYHPSYIWKIMKSKINMTFTDYVTIQRLEIAKKMLLETDKSVAEIAEQLKYTNA
FT                   QNFIRFFSKHVGTTPGKFRLMDRNS"
FT   gene            434803..437214
FT                   /locus_tag="Cphy_0343"
FT   CDS_pept        434803..437214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0343"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein; KEGG: bha:BH1114
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40730"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR034641"
FT                   /db_xref="InterPro:IPR041624"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST6"
FT                   /protein_id="ABX40730.1"
FT                   /translation="MTGLRIKDFDKEHVTIQWDGDPYANSYRIYWADKDTKGMKYKRLS
FT                   ETKETEYTLERSTHVAHYLKVASISGDQEVSISSVLKTPIGKTFHEQLEKLSRGLVVVK
FT                   RQKGIFLAWRLMKNEVSGFCSTGLTGADFLVYKNGELLTTVTDSTNFVDEKGTSEDKYS
FT                   IGVLENGVEVERTKEMSAFRSGANYIDLPLQKPSDGTTPAGEVFSYHANDMSIGDVDGD
FT                   GEYEYFVKWDPSNSKDVSQKGYTGNCYIDCYKLEGRLLWRLDMGVNIRAGAHYTQFMVY
FT                   DFNGDGKVEMAVKTAPGTKMIYFDEQGNVEKEIYITMPGCDIDSGYSNRDDYRLSAEGY
FT                   YKHLVTVFMNWHNHPMVIEKTWPQTLEECFGIEKKYQYPLIREDAMKLVDYFLDVYALS
FT                   RSERNDLRHFEGFIIDGPEYLTMFSGLGEELETIPFPYPREDDGLVWGDYSMRRIEPAN
FT                   RVDRFLSGVAYLDGERPYLIVCRGYYTRATIVAYDFFENRFREYFNVDSGHVRMNNPFM
FT                   DNAHGGGGSDPVYGRLAGQGNHSLSTADVDGDGYQEIIYGAAVIDHDGSLLYSSFGYLP
FT                   DGTYTKLGHGDAMHVADIDPDRPGLEIFQVFEGAKHAPFGYALRDAETGEVIFGEYAET
FT                   DLGRCMVGDVNPKVRGLQTWVTKMQSVKGEVLPDKLLGTNFSIRWLPDMSTQIIDGVDL
FT                   FGNHAGVINDNTHGIIFIPEGVATNNGTKGNPCLVADIFGDWREELLLRTSDSSAIRIF
FT                   VNTDLTNHKLYTLMHDIQYRTGITWQNNCYNQPCYPKFYFASDTDWEYVL"
FT   misc_binding    437445..437582
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 70.41"
FT   gene            437841..438587
FT                   /locus_tag="Cphy_0344"
FT   CDS_pept        437841..438587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0344"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: cno:NT01CX_0505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40731"
FT                   /db_xref="GOA:A9KST7"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST7"
FT                   /protein_id="ABX40731.1"
FT                   /translation="MENLEKLMEVAKTNVGFLLLSVTIVAIIVGAAYAAERVIRKKIGL
FT                   DKRRGKQSVRSMVIIAVLSTIAVVLMLFEFPLWFAPGFYKLDFSELPVVIGAFTLGPVA
FT                   GITIELIKIVLNLLLNGTTTAFVGEFANFLMGCVFIIPASFFYFLRKSKKNAVIGLLVG
FT                   TVIATLTGCFLNAFVLLPKYSEAFHIPIEAFIAQGTEKISAIKGMFTFVVLAVAPFNLL
FT                   KYALVSLITILIYKNISKILKGDYKD"
FT   sig_peptide     437841..437945
FT                   /locus_tag="Cphy_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.986 at
FT                   residue 35"
FT   gene            438772..439278
FT                   /locus_tag="Cphy_0345"
FT   CDS_pept        438772..439278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bsu:BG10173 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40732"
FT                   /db_xref="GOA:A9KST8"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST8"
FT                   /protein_id="ABX40732.1"
FT                   /translation="MEKEIMFQYQTKVSDMYRFLMHHAYIGVSGIVNLVISVGALVLLF
FT                   AGAGGGQAFSNLMLILIASLFTIINPILLYYKAAKQVKLTPMFQKPIDYFINEEGILVS
FT                   QGEEKLLINWTDIWKAVETKHAFYFYLSTRGAYILPKAALLEYVEALKKLVIEHAPEAR
FT                   KKFKK"
FT   gene            439293..439724
FT                   /locus_tag="Cphy_0346"
FT   CDS_pept        439293..439724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0346"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   cth:Cthe_1776 protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40733"
FT                   /db_xref="GOA:A9KST9"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST9"
FT                   /protein_id="ABX40733.1"
FT                   /translation="MKYESYTEGDTYRLGKQMGENAQKGQVYCLSGELGVGKTVFTKGF
FT                   AAGLGIAEPISSPTFTIVQEYEQGELPLYHFDVYRIEDIEEMEEIGYEDYFYGDGVCLV
FT                   EWAVRIKELLPEDYIQITIEKDLDKGFDYRVISVEENQI"
FT   gene            439847..440572
FT                   /locus_tag="Cphy_0347"
FT   CDS_pept        439847..440572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0347"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   cth:Cthe_1775 peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40734"
FT                   /db_xref="GOA:A9KSU0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSU0"
FT                   /protein_id="ABX40734.1"
FT                   /translation="MKILVLDSSGLVASVAIMTEDTLLAEYTVNYKKTHSQTLLPMLDE
FT                   CVKMLGLELSEIDAIAVAKGPGSFTGLRIGSATAKGLGLALDKPIIAIPTVDALAYNLF
FT                   ATEAIICPLMDARRNQVYTGLYSFEKNEFHVIKEQTACDIEEIIDQINEYQRPVIYLGD
FT                   GVEAYQKQLIESTKVPYYFAPAHLSKQRAGALGALAFHYIKEGKLESAMDHIPTYLRKS
FT                   QAEREREEALSKGEQVDNS"
FT   gene            440559..440993
FT                   /locus_tag="Cphy_0348"
FT   CDS_pept        440559..440993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0348"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: csc:Csac_0216 ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40735"
FT                   /db_xref="GOA:A9KSU1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSU1"
FT                   /protein_id="ABX40735.1"
FT                   /translation="MIIRKMLPNDSKAMAIIEQETFSDPWSEESFLKEATEKDHIYLVV
FT                   EDSGNLIAYCGMWNITGEGYITNVCVKKEKRKQGIGKLMLVSLLEQAKLCNIEAVTLEV
FT                   RESNQSAIHLYEQLGFQSVGKRKDFYAHPTEDAIIMWLNF"
FT   gene            441107..441349
FT                   /locus_tag="Cphy_0349"
FT   CDS_pept        441107..441349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40736"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSU2"
FT                   /protein_id="ABX40736.1"
FT                   /translation="MAHLIKERKKNDLLCNVCGRALRMEKGMLLEDAFVVSKEWGFFSS
FT                   RDLEVHRFTICENCYDQLIAQFKIPIEVFDKSEAL"
FT   gene            441620..442534
FT                   /locus_tag="Cphy_0350"
FT   CDS_pept        441620..442534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0350"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="KEGG: cac:CAC1584 ribonuclease Z; TIGRFAM:
FT                   ribonuclease Z; PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40737"
FT                   /db_xref="GOA:A9KSU3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSU3"
FT                   /protein_id="ABX40737.1"
FT                   /translation="MLDVCLLGTSGMMPLPGRWLTALMTRLNGSSLLIDCGEGTQIAIR
FT                   EKGWSFHSIDIICFTHYHGDHISGLPGLLLSMGNADRTQPVTVIGPKGLERVVSALRVI
FT                   APELPFELNFIEVTNPQETICVNDYVINAFRVNHNVICYGYTIEVKRTGRFIPEMAMQN
FT                   EVPIELWSRLQKGQTIEKDSRVFTPDMILGPQRKGIKLTYCTDSRPVPQIIEQAQGSDL
FT                   FICEGMYGEKEKQSNAIENKHMTFYEAAELAKQAGVKELWLTHYSPSLTRPEEYMKETK
FT                   EIFPNAKAGKDRKSITLEFDKNE"
FT   gene            442647..443312
FT                   /locus_tag="Cphy_0351"
FT   CDS_pept        442647..443312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40738"
FT                   /db_xref="GOA:A9KSU4"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSU4"
FT                   /protein_id="ABX40738.1"
FT                   /translation="MVELSTKKMLMPQGEYVGKGSDFMKGSKKSSKNNTVMSVITMIFI
FT                   GCVIVGSFAYLYNREKKDKPDIELTEVQKLLVMDLERTYPATPREVVKLYSRFSMCIHN
FT                   DDLTDEEFKKLGEKVQNLYAKELIEENPSDEYLMNLAVEVAEYHKSERKIKSYTIDSGN
FT                   SIVTWKEDGKEFARLLATYSLREGKEFNTVHQEFLLQKDEAGLYKILGWRLAEKADAN"
FT   gene            443491..444552
FT                   /locus_tag="Cphy_0352"
FT   CDS_pept        443491..444552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0352"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: cno:NT01CX_0478 metalloendopeptidase,
FT                   putative, glycoprotease family; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; PFAM: peptidase
FT                   M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40739"
FT                   /db_xref="GOA:A9KSU5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSU5"
FT                   /protein_id="ABX40739.1"
FT                   /translation="MEGYMEDYRKDVVEKEDVYILAIESSCDETAASVVKNGREVLSNV
FT                   ISTQIDLHTLYGGVVPEIASRKHMEKINQVIEEALSQAQMGLTDMNAVAVTYGPGLVGA
FT                   LLVGVAEAKAISYAAKLPLIGVHHIEGHVSANYIENKELEPPFLCLIVSGGHTHLVLVK
FT                   EYGTYEIIGRTHDDAAGEAYDKVARAIGLGYPGGPKIDKLAKEGKKNAIVFPRASIEGC
FT                   PFDFSFSGVKSAVLNYINSSTMKGEAINRADIAASFQEAVVDVLISHTMAAAKEYGMKK
FT                   IAIAGGVASNSALRSAMEEACKKNQFEFYHPTPLFCTDNAAMIGAAAYYEYLKGNFSGL
FT                   DLNAVPNLKIGQR"
FT   gene            444624..445325
FT                   /locus_tag="Cphy_0353"
FT   CDS_pept        444624..445325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0353"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   cno:NT01CX_1092 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40740"
FT                   /db_xref="GOA:A9KSU6"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSU6"
FT                   /protein_id="ABX40740.1"
FT                   /translation="MEKVTAIVLAAGQGKRMKSSVSKQYMLLKDKPVLYYSLKAFENSL
FT                   VTDIIVVVGNDEISYVKEEIIKPYGFRKVTHVVEGGSERYLSVLNGLNKIKDSDYVLVH
FT                   DGARPLIKTNTINTVISEVEEKKACIVGVASKDTVKISTHDGIIDSTPDRNQVYTIQTP
FT                   QAFEYSILREAYDNLASYQGAMITDDAMIVECLNRYPIYLVQGEYTNIKITTPEDLIFA
FT                   EAILREHQDFI"
FT   gene            445426..445511
FT                   /locus_tag="Cphy_R0024"
FT                   /note="tRNA-Ser2"
FT   tRNA            445426..445511
FT                   /locus_tag="Cphy_R0024"
FT                   /product="tRNA-Ser"
FT   gene            445606..445694
FT                   /locus_tag="Cphy_R0025"
FT                   /note="tRNA-Ser3"
FT   tRNA            445606..445694
FT                   /locus_tag="Cphy_R0025"
FT                   /product="tRNA-Ser"
FT   gene            446242..447765
FT                   /locus_tag="Cphy_R0026"
FT   rRNA            446242..447765
FT                   /locus_tag="Cphy_R0026"
FT                   /product="16S ribosomal RNA"
FT   gene            447851..447967
FT                   /locus_tag="Cphy_R0027"
FT   rRNA            447851..447967
FT                   /locus_tag="Cphy_R0027"
FT                   /product="5S ribosomal RNA"
FT   gene            447973..448045
FT                   /locus_tag="Cphy_R0028"
FT                   /note="tRNA-Ala2"
FT   tRNA            447973..448045
FT                   /locus_tag="Cphy_R0028"
FT                   /product="tRNA-Ala"
FT   gene            448333..451232
FT                   /locus_tag="Cphy_R0029"
FT   rRNA            448333..451232
FT                   /locus_tag="Cphy_R0029"
FT                   /product="23S ribosomal RNA"
FT   gene            451301..451372
FT                   /locus_tag="Cphy_R0030"
FT                   /note="tRNA-Asn2"
FT   tRNA            451301..451372
FT                   /locus_tag="Cphy_R0030"
FT                   /product="tRNA-Asn"
FT   gene            451454..451525
FT                   /locus_tag="Cphy_R0031"
FT                   /note="tRNA-Glu1"
FT   tRNA            451454..451525
FT                   /locus_tag="Cphy_R0031"
FT                   /product="tRNA-Glu"
FT   gene            451645..451717
FT                   /locus_tag="Cphy_R0032"
FT                   /note="tRNA-Thr2"
FT   tRNA            451645..451717
FT                   /locus_tag="Cphy_R0032"
FT                   /product="tRNA-Thr"
FT   gene            451746..451822
FT                   /locus_tag="Cphy_R0033"
FT                   /note="tRNA-Met3"
FT   tRNA            451746..451822
FT                   /locus_tag="Cphy_R0033"
FT                   /product="tRNA-Met"
FT   gene            451868..451941
FT                   /locus_tag="Cphy_R0034"
FT                   /note="tRNA-Asp2"
FT   tRNA            451868..451941
FT                   /locus_tag="Cphy_R0034"
FT                   /product="tRNA-Asp"
FT   gene            452017..452089
FT                   /locus_tag="Cphy_R0035"
FT                   /note="tRNA-Val2"
FT   tRNA            452017..452089
FT                   /locus_tag="Cphy_R0035"
FT                   /product="tRNA-Val"
FT   gene            452107..452192
FT                   /locus_tag="Cphy_R0036"
FT                   /note="tRNA-Leu2"
FT   tRNA            452107..452192
FT                   /locus_tag="Cphy_R0036"
FT                   /product="tRNA-Leu"
FT   gene            452241..452314
FT                   /locus_tag="Cphy_R0037"
FT                   /note="tRNA-Arg1"
FT   tRNA            452241..452314
FT                   /locus_tag="Cphy_R0037"
FT                   /product="tRNA-Arg"
FT   gene            452927..453502
FT                   /locus_tag="Cphy_0354"
FT   CDS_pept        452927..453502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDBDRAFT_0169480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40741"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSU7"
FT                   /protein_id="ABX40741.1"
FT                   /translation="MSSCTDILLISSVACRIAECLDDNELALLAADLLFLSDALNAIAV
FT                   RRAVCKDICEKKAANTAKNSKDSNANSGNNNSNNNNSNNNNSSENNGSNDNRGNKGNKD
FT                   GNGNKVGKNNKDSKSNNGNSASSGSSIKQISDEKNVITPVKREQSSEMKTSGSSNMKAT
FT                   FTKNDNSMKMGDNKIVDMSEDINHSNKK"
FT   gene            complement(453674..454273)
FT                   /locus_tag="Cphy_0355"
FT   CDS_pept        complement(453674..454273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0355"
FT                   /product="protein of unknown function DUF340 membrane"
FT                   /note="PFAM: protein of unknown function DUF340 membrane;
FT                   KEGG: cbf:CLI_1203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40742"
FT                   /db_xref="GOA:A9KSU8"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSU8"
FT                   /protein_id="ABX40742.1"
FT                   /translation="MVLLTVIALLIGIVYGLSGIDITIINFVTEHTHYILYLLMFLVAI
FT                   SIGLNRGIIQKIKEYHVKVFIIPFGIIIGSLLGGIICSFITGISMNTSTAMASGLGWYS
FT                   LSGVMVSEFAGASFGSITFLSNLMREIFSFFSIPLIAKYLNFPTCIAPAGATSEDTTLP
FT                   MLIRYTNEETVVLSVINGIICSAAVPILINLCYQIF"
FT   gene            complement(454276..454560)
FT                   /locus_tag="Cphy_0356"
FT   CDS_pept        complement(454276..454560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40743"
FT                   /db_xref="GOA:A9KSU9"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSU9"
FT                   /protein_id="ABX40743.1"
FT                   /translation="MDILIIMGIGIFIGSRFFPEKHKKKNEKMQIVCTILIIFSMGVML
FT                   GKREHFLQEISTLGLTSFLYFFIPTVFSTLIVYLLTRLFMKKKLKEKED"
FT   gene            455633..457405
FT                   /locus_tag="Cphy_0357"
FT   CDS_pept        455633..457405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE2422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40744"
FT                   /db_xref="InterPro:IPR032583"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSV0"
FT                   /protein_id="ABX40744.1"
FT                   /translation="MAFGGEDVDTYEVAYDVPGKGNIVEATVTRCKNGIVVNYPDDYMR
FT                   RRDPDCLLVADKNDTDKPKYDDVYNQDFEPLRQETFQWLKKQKLIVFAFKSGGEEYGYD
FT                   TLLVSPANAGFFACAVADLQGFTSMHDISEDFNPKAVIFLAPPFRHTHFDGKQIVIHNR
FT                   LTGIHELFSYNLYPGPSAKKGIYGVLLNIGENEGWTTVHASTVKVITPYDNEIVIMHEG
FT                   ASGGGKSEMIEHVHREMDGRILLGKNTVTGEKTFIELSESCELRPVTDDMAICHPRMQN
FT                   DSKKLVVKDAEQGWFLRCDHIKSYGTAPQHEKIFIHPQEPLVFLNIQGVPNSTCLVWEH
FT                   TLDSNGKPCPNPRVVLPRRLVPNVIDEPVEIDVRSFGVRTPACTKKNPSYGILGMFHIL
FT                   PPALAWLWRLVAPRGYNNPSITSSEGMTSEGVGSYWPFATGKMVEQANLLMEQILNSSH
FT                   TRYLLIPNQHIGAYEVGFVPQWVAREYIARRGSAKFKPEHLVEARCSILGYGLGSLKVD
FT                   GQYIRKAFLQPEMQQEVGIEGYDAGSKILLDFFKEEVQKFLTPELHEMGRKIIELLLSD
FT                   ASVQEYNDLLPMRY"
FT   gene            457661..458350
FT                   /locus_tag="Cphy_0358"
FT   CDS_pept        457661..458350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0358"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cpf:CPF_1192 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40745"
FT                   /db_xref="GOA:A9KSV1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSV1"
FT                   /protein_id="ABX40745.1"
FT                   /translation="MKKILVVEDDLNINNMLREALEEAGYEVVQAYSGTEAMLNVGMTE
FT                   FDLILLDLMLPGMSGEEFLKLFNKKERTPVIVLSAKDELDSKVDVLSCGADDYITKPFQ
FT                   LKELLVRIEVALRRVNRNIEKSQDETNQCLSHKDLLLNRSSYEVRLAGNLISLTKQEYK
FT                   ILELLLLHPNKVFSKQEIYNYAWEEYFIGEDKTINVHISNIRMKLKKVTEDDYIDTVWG
FT                   IGFKLSK"
FT   gene            458494..459414
FT                   /locus_tag="Cphy_0359"
FT   CDS_pept        458494..459414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0359"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cbe:Cbei_3668 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40746"
FT                   /db_xref="GOA:A9KSV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSV2"
FT                   /protein_id="ABX40746.1"
FT                   /translation="MNDILLRSSVLTKKYKNYAAVNQVNLTIKRGDIYGFIGRNGAGKT
FT                   TFLKMISGLAKQTSGNIELFGADCNKQKELFSRIGVLIEAPGLFPNMTAFENLKMKCIS
FT                   HGIQDDNYIHEIIELIGLKDVNKKKTKNYSLGMKQRLGIGMALIGDPDLLVLDEPINGL
FT                   DPQGIVEVRDTIQRLNKERNMTIIISSHILEELSKIATRYGIIDKGVLLQELTCEELME
FT                   RCSERIQITLTGVKEACTILEEKLGIKDYKVINPSTIYVFEHLDNPALINMTLCNNGVL
FT                   VSSFHVANDDLETYFINLTGGVSHA"
FT   gene            459407..460231
FT                   /locus_tag="Cphy_0360"
FT   CDS_pept        459407..460231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC2733 uncharacterized conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40747"
FT                   /db_xref="GOA:A9KSV3"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSV3"
FT                   /protein_id="ABX40747.1"
FT                   /translation="MLKTIKMDLYRMFRSKSFYVTLFITFILVVVSVITIKIVLNNDNL
FT                   KNIYDQGMDVSDSVIVGIGTGPMNVDSIELTLGDLFSSSVGGASLAVVAVIFAIIFVCS
FT                   EHNSGYIKNVISRKGYRDYFTISKAICMAIYLLITLLGAAILIGISSSLLLDTFRLGNI
FT                   SEFASYFFTQYLLHFALVMLVIFLCNLSRNMAISMAVGICICSGMLALLTGLLDRLKLN
FT                   IVFSNYLVTTNMKLLPIPYDATIYTRAILVSLVVTIVFGISSIILMRKQDVR"
FT   gene            460345..461238
FT                   /locus_tag="Cphy_0361"
FT   CDS_pept        460345..461238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0361"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: cbf:CLI_0866
FT                   sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40748"
FT                   /db_xref="GOA:A9KSV4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008358"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSV4"
FT                   /protein_id="ABX40748.1"
FT                   /translation="MTWIIVIALCIAVGYFIAVLQYKKQIRTWNQNLSFILSNNSNMRL
FT                   EQLVPSKDVSKLLDLLNELMQRHRKLKVEYEVKDEAFKQLITNLSHDIRTPLTSLDGYF
FT                   QLLTKAKEPEVREHYITIIEGRIRQLSEMLDQLFLYMKLQNDCYELSIEKCNLSQILCE
FT                   CILDFYEQFTNRGIEPVIHLPEEEMIMLGNPSALIRILQNMIKNALEHGNEHFQITLEK
FT                   EEEIVVTCKNGYANGEEVDFSLIFERFYKADKARTRSSTGLGLAIAKELTEKLGGSIEA
FT                   INEGTEFLIKVHFPVG"
FT   gene            complement(461569..463122)
FT                   /locus_tag="Cphy_0362"
FT   CDS_pept        complement(461569..463122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0362"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bsu:BG12964 ABC transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40749"
FT                   /db_xref="GOA:A9KSV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSV5"
FT                   /protein_id="ABX40749.1"
FT                   /translation="MSILNVSNLNHGFGERMIFHDVSFRLLKGEHIGLIGANGEGKSTF
FT                   MNIITNKLMPDEGTIEWSKNVRVGYLDQHSVLEKGMSIRDVLKSAFNFLFELESKMNSI
FT                   CNELADASDEKMAELMEEFGTIQDLLDAHDFYIIDSKVEEIGRALGLTDIGLDKDVTDL
FT                   SGGQRTKVLLGKLLLEKPDILLLDEPTNYLDVEHIEWLKRYLQEYENAFILISHDIPFL
FT                   NSVINLIYHMENGELNRYVGDYDKFQEVYAMKKSQLEAAYKKQQQEISELQDFVARNKA
FT                   RVSTRNMAMSRQKKLDKMDVIELAKEKPKPEFHFKEARAASRYIFQTEHLVIGYDEPLS
FT                   QPITLSMERGDKIILKGANGIGKTTLMKSILGIIPSLSGNVTLGDYLYQGYFEQEMTGA
FT                   KNNTCIEELWREFPSWTQYEVRSALAKCGLTTKHIESQVRVLSGGEQAKVRLCKLINRD
FT                   TNILLLDEPTNHLDVEAKDELKRALSEYKGSILLICHEPDFYENFATKVIDCSNWSTKI
FT                   "
FT   gene            463437..463946
FT                   /locus_tag="Cphy_0363"
FT   CDS_pept        463437..463946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40750"
FT                   /db_xref="GOA:A9KSV6"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSV6"
FT                   /protein_id="ABX40750.1"
FT                   /translation="MTIQEFLNQLRDSLDGELPYNEIVSNINYYRDYMNSKKGEQSEEE
FT                   ITAGLGDPRLIARTIIETYQMNHDNKVHYQSYSYSDGGNYQSTNSSNTNYDRDRDRKKE
FT                   RDHSVFKTIGIQGWLGCLVSLIILFIVLGAVFWIGAIAFKVFIRFVLPIILIVAGISYL
FT                   SNRFKK"
FT   gene            complement(464091..464651)
FT                   /locus_tag="Cphy_0364"
FT   CDS_pept        complement(464091..464651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0364"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /note="PFAM: GPR1/FUN34/yaaH family protein; KEGG:
FT                   ypi:YpsIP31758_3467 gpr1/fun34/YaaH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40751"
FT                   /db_xref="GOA:A9KSV7"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSV7"
FT                   /protein_id="ABX40751.1"
FT                   /translation="MSTETKATIANPAPLGLLGFGMTTCLLNLHNAGIIPLSIVTVAMG
FT                   FALGGAAQIIAGIMEFKKNNTFGATAFTAYGFFWWSLILIWMNPTKSIASSDSISLGYY
FT                   LLLWGIFTLFMFIGTLKHNIASRIVFGSLALLFFLLAAANFTDSHSIHTIAGYVGIFCG
FT                   LSAIYNSVAQVINEEYKKTILPL"
FT   gene            465733..466035
FT                   /locus_tag="Cphy_0365"
FT   CDS_pept        465733..466035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0365"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: tde:TDE0839
FT                   rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40752"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSV8"
FT                   /protein_id="ABX40752.1"
FT                   /translation="MYFEGVRLDEISRYIDRKDAIIVDLRKKEDYDKGHIPNAVSVPYT
FT                   SSEELAEKVRYFKVIILYCYRGNLSMLAARDLSGIQGKVYHICGGIHAYPYRLER"
FT   gene            466188..467330
FT                   /locus_tag="Cphy_0366"
FT   CDS_pept        466188..467330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0366"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; KEGG: cno:NT01CX_2091
FT                   nucleic acid methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40753"
FT                   /db_xref="GOA:A9KSV9"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSV9"
FT                   /protein_id="ABX40753.1"
FT                   /translation="MSRYEYIAPCHFGLEAVLKREITDLGYEIVSVEDGRVIFAGDETA
FT                   ICRANMFLRTTERILIKVAKFKAETFEELFQNTKEVPWEQYIPKDGKFWVAKATSIKSK
FT                   LFSPTDIQSIMKKAMVERLKGVYKVEWFEESGNEYPVRVTFMKDEITIGIDTSGVSLHK
FT                   RGYRKLISKAPITETLAAALIMLTPWNKDCVLIDPFCGSGTFPIEAAMIGARIAPGLNR
FT                   SFLAENWTDLIPKKAWYEAAEEANGMILHDIEMNIQGYDIDGEVIKAAKQNAEVAGVDQ
FT                   YIHFQKRSVSELSSPKKYGFIITNPPYGERLEDKSAMPPIYHEIGQAMKRLDTWSSYLI
FT                   TSYEDAEKHIGRQADRNRKIYNGMLKTYFYQYMGPKPPKR"
FT   gene            complement(467424..468344)
FT                   /locus_tag="Cphy_0367"
FT   CDS_pept        complement(467424..468344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0367"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: tde:TDE2146
FT                   hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40754"
FT                   /db_xref="GOA:A9KSW0"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSW0"
FT                   /protein_id="ABX40754.1"
FT                   /translation="MKATSTIVVQKDGYETVLYPQLCQTEPVKGTILLLHGMAEHHKRY
FT                   QTFTDYLNSCGYDVYRYNHRGHGMDQKLEDLGYIADDDGYKLLISDALNVLTYLKENNR
FT                   TNKLILIGHSMGSLVSRNVLQFFKDLDCAVLIGTAFNPRTKSRIGIACAHTIKKFKGAR
FT                   HYSPFLNKQMFETKHYTSLSERTNFDWLSRNNPNVGAYIHDPYCGFQCSISFYEDLANL
FT                   DYHAGLPKRIKLVRKDLPILFTSGTKDPVSRYGKDVERLFMLHKRLGFQKVDCIMYKDC
FT                   RHELLNELNAEEIMKDIEDWVTKHI"
FT   gene            468619..470043
FT                   /locus_tag="Cphy_0368"
FT   CDS_pept        468619..470043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0368"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   csc:Csac_1532 cell wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40755"
FT                   /db_xref="GOA:A9KSW1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSW1"
FT                   /protein_id="ABX40755.1"
FT                   /translation="MPEDRILKRAAAYSVLLMACVLLIPFVLKLEKGKVTYAGVFPMLP
FT                   TTISTMLPIGEKESLKYLSHQEDSDCKQNIKQQIPGGISENLKERLGNNFIVVEKPCHL
FT                   SNSAMVELIDEAVDRKIRFIITDSYEIKIEDNQIHRMYQGNYYKGKPESEAPKATTVPE
FT                   NQKEQLVENQPLTSASAGKEKVDSVTSDNTKDTASNQASTTGSNESSPEKEESESITFT
FT                   DCIKSIQINSYAYPDNESFKTEITLELDKTYAYVLFEDDHNYYISLVRPKDIYDKIIVV
FT                   DAGHGGYDSGTYSRDFVYHEKDMNLSMVLELKKLLDKEDIKVYYTRTTDRGLTLNQRVT
FT                   LANDVEADLFLSFHCNANEERGVHGTEVLYNEKQNDWTRMNSKSFATLCLEEVLNEIGL
FT                   EDRGLVPRSKDVYIVGEANVPVALVEAAFMSNQGDLNFLASKDGKQKVAKGAYNAILSA
FT                   YKELEQEDKGQKTVMR"
FT   gene            470342..470923
FT                   /locus_tag="Cphy_0369"
FT   CDS_pept        470342..470923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0369"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   cth:Cthe_0189 non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40756"
FT                   /db_xref="GOA:A9KSW2"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSW2"
FT                   /protein_id="ABX40756.1"
FT                   /translation="MRKIIFATSNEGKMREIRMILKDLDYEVVSMKEAGIDISIEETGT
FT                   TFEENAIIKAKTIMEMTGEIVLADDSGLEVDYLEKAPGVYSARYLGEDTSYDIKNNHIL
FT                   SLLEGVAEEKRSARFVCVIACAWPNGEIKVKRATIEGNIGYEIAGENGFGYDPIFVVPE
FT                   YGCTTAELTAEQKNTISHRAKALNAMKEEL"
FT   gene            470940..471434
FT                   /locus_tag="Cphy_0370"
FT   CDS_pept        470940..471434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0370"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: tte:TTE0621 predicted
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40757"
FT                   /db_xref="GOA:A9KSW3"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSW3"
FT                   /protein_id="ABX40757.1"
FT                   /translation="MNILIVSDSHGRYTNLERAIKKVSPIDMLIHLGDYEGDASYIKEI
FT                   ADCPVEMVSGNNDYFTDIPREKFLEIGKYYVMLTHGHRYGVNYGTEQLKEAAVLNGADI
FT                   VMFGHTHQPLIDLKDDSLAVINPGSITQPRQAGRIPTFILMEIDSKGEAHYTLNYIEDS
FT                   L"
FT   gene            471589..471663
FT                   /locus_tag="Cphy_R0038"
FT                   /note="tRNA-Pro1"
FT   tRNA            471589..471663
FT                   /locus_tag="Cphy_R0038"
FT                   /product="tRNA-Pro"
FT   gene            471684..471754
FT                   /locus_tag="Cphy_R0039"
FT                   /note="tRNA-Gly2"
FT   tRNA            471684..471754
FT                   /locus_tag="Cphy_R0039"
FT                   /product="tRNA-Gly"
FT   gene            471791..471864
FT                   /locus_tag="Cphy_R0040"
FT                   /note="tRNA-Arg2"
FT   tRNA            471791..471864
FT                   /locus_tag="Cphy_R0040"
FT                   /product="tRNA-Arg"
FT   gene            471894..471970
FT                   /locus_tag="Cphy_R0041"
FT                   /note="tRNA-His1"
FT   tRNA            471894..471970
FT                   /locus_tag="Cphy_R0041"
FT                   /product="tRNA-His"
FT   gene            472023..472094
FT                   /locus_tag="Cphy_R0042"
FT                   /note="tRNA-Gln1"
FT   tRNA            472023..472094
FT                   /locus_tag="Cphy_R0042"
FT                   /product="tRNA-Gln"
FT   gene            472117..472189
FT                   /locus_tag="Cphy_R0043"
FT                   /note="tRNA-Lys2"
FT   tRNA            472117..472189
FT                   /locus_tag="Cphy_R0043"
FT                   /product="tRNA-Lys"
FT   gene            472247..472326
FT                   /locus_tag="Cphy_R0044"
FT                   /note="tRNA-Leu3"
FT   tRNA            472247..472326
FT                   /locus_tag="Cphy_R0044"
FT                   /product="tRNA-Leu"
FT   gene            472399..472473
FT                   /locus_tag="Cphy_R0045"
FT                   /note="tRNA-Pro2"
FT   tRNA            472399..472473
FT                   /locus_tag="Cphy_R0045"
FT                   /product="tRNA-Pro"
FT   gene            472717..473262
FT                   /locus_tag="Cphy_0371"
FT   CDS_pept        472717..473262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0371"
FT                   /product="DJ-1 family protein"
FT                   /note="TIGRFAM: DJ-1 family protein; PFAM: ThiJ/PfpI domain
FT                   protein; KEGG: bld:BLi00848 putative intracellular
FT                   protease/amidase, ThiJ family; RBL01553"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40758"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSW4"
FT                   /protein_id="ABX40758.1"
FT                   /translation="MAKVYVFLADGFEEIEALTVVDLLRRAGVDVTTVSITENNLVHGA
FT                   HGIDVMADILFKDDLSEADMLVLPGGGLGTRNLLDHEGLKDLLIDYEKKGRYLAAICAA
FT                   PSILGTHGLLKGKRAICYPGFEDKLTGAVVTNDKVVVDGKIITSKGAGTSIEFSLELIK
FT                   ILCGEEASNQILNGIQYQ"
FT   gene            473354..474736
FT                   /locus_tag="Cphy_0372"
FT   CDS_pept        473354..474736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40759"
FT                   /db_xref="GOA:A9KSW5"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSW5"
FT                   /protein_id="ABX40759.1"
FT                   /translation="MRMVSAGMGDKMKEIKEEYSYIVSRNKESEHKSRVKKAIAIFATL
FT                   SFLVGAFLLFDQLAPRIAFSKEEDTESVDQANVKSVREISLLDNKEVTVPAALTKIEPI
FT                   TEGTMVNIILDYANDKITVKPGTSTSTKLYFSQDKMKTWEKMTGNNVNNGLDIDLSIFL
FT                   KTSDNTIYFKGDKDKAIAAVTLPKEDKDFKVSYYVENGAGKLKFENQTRLVEYRKGANG
FT                   IWTQCDSNLVLSSYEITGYTLQFRLKATTAERAGKIVNVKIPKREAPPKITIDYSKMEV
FT                   SGLKAGSTMYQKNGESAFRLFAPADSKVKTLSLYDLLFTSTVAPNTQFSAVSIEFYTAG
FT                   SDKKVASSTVVVEFQAQPAAPTGNVVTLDKTTVTFPAATKTAPYEYVVLHQGENLDLSK
FT                   VKWTKVTTNKPFEIKKVGKATPAPHDVIYFRLASTIDKETKVVTPASVYLKIEIQNVPI
FT                   TK"
FT   gene            complement(474739..476121)
FT                   /locus_tag="Cphy_0373"
FT   CDS_pept        complement(474739..476121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0373"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: dsy:DSY4985 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40760"
FT                   /db_xref="GOA:A9KSW6"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSW6"
FT                   /protein_id="ABX40760.1"
FT                   /translation="MNNLLKSIQTINHYLWGGPMLFLLFGTHLYFTFRLRFIQKELKKG
FT                   IRNSVSTKTDAHGNSSSFKTLTTTLAATLGTGNIVGISTAVALGGPGAVLWCWLTGIFG
FT                   MATTYAECYLGMWYRKQKPDGTYSGGPMYALEYGLHSKWLAVIFCIATLFVAFSMGGFT
FT                   QARSITDATKSLGISPILTGIIAAFLIGLVIVGGVNSIQNVCMKLVPAMAIFYVAGCVI
FT                   ILFVNLPYVLPTLSTIVKTAFSTKAVTGGVLGGSIGIAARYGISRGLFTNEAGLGSAAI
FT                   AAGGSAITDESSISESVPSSSKAKSTQNHSDSLDLRYKNQALVSMSATFWDTVVMCALT
FT                   GLIIVSTILKNPDSIKGLSMGELTTAAFAQIPFGVFMLRISLVAFAVATLIGWSYFGEK
FT                   AVEYLFPKKGIDIYRLVYILMIFFGSIMSLELVWESSDLINAFMTIPNLIALWLLRKKI
FT                   KC"
FT   gene            476696..476917
FT                   /locus_tag="Cphy_0374"
FT   CDS_pept        476696..476917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0374"
FT                   /product="small acid-soluble spore protein alpha/beta type"
FT                   /note="PFAM: small acid-soluble spore protein alpha/beta
FT                   type; KEGG: cbf:CLI_2367 small, acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40761"
FT                   /db_xref="GOA:A9KSW7"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSW7"
FT                   /protein_id="ABX40761.1"
FT                   /translation="MTSSNQGTSGSNRMAVPEAKEAMNRMKMEVASELGVPLTQGYNGN
FT                   LTSAQNGSVGGEMVRQMIKRQEESMSGK"
FT   gene            477102..478448
FT                   /locus_tag="Cphy_0375"
FT   CDS_pept        477102..478448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0375"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: bcy:Bcer98_0150 phosphoglucosamine
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40762"
FT                   /db_xref="GOA:A9KSW8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSW8"
FT                   /protein_id="ABX40762.1"
FT                   /translation="MGKYFGTDGFRGEANKTLTVEHAYKVGRFLGWYYGKDHKAKVAIG
FT                   KDTRRSSYMFEYSLVAGLTASGADVYLLHVTPTPSVSYVVRSEGFDCGIMISASHNPFQ
FT                   DNGIKVINGGGYKLENEVEKLIEDYIDGEIPEIPFAFGENIGKTVDYSMGRHRYIGHLI
FT                   SLATRSFKGIKVGLDLANGSATTVAKGVFDALGAKTYVIHGEPDGVNINSDCGSTHIEQ
FT                   LQKFVVEQGLDIGFAYDGDADRCLAVDELGQVIDGDAILYLCGCYMKERGELRNNTVVT
FT                   TIMSNLGLYKSLDAKEIGYAKTAVGDKYVFENMMEHGHSIGGEQSGHIIFNKHATTGDG
FT                   VLTSLKIMEVMLEKKEKISVLLRELKIYPQLLLNIPVVDKKMAKNDPDVMEAAKAVELE
FT                   LGDEGRILVRESGTESVIRVMVEAGSNEVCQKYADNVVVVLRQKGHIKA"
FT   gene            478875..480161
FT                   /locus_tag="Cphy_0376"
FT   CDS_pept        478875..480161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0376"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: peptidylprolyl
FT                   isomerase FKBP-type; trigger factor domain protein; trigger
FT                   factor domain; KEGG: cth:Cthe_2739 trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40763"
FT                   /db_xref="GOA:A9KSW9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSW9"
FT                   /protein_id="ABX40763.1"
FT                   /translation="MSFKVEDLGKNMVKLTIEATAEDFDKAIEQAYQKNKGKMNVQGFR
FT                   KGKAPRAIIEKMYGVGVFYEDAANFIIPEAYEQAIEESKLDVVARPEIDVVQVEKGQPF
FT                   IFTAEVAVKPEVTLGAYKGVEVSKSEIEVTEDEIMAELDKVREQNSRTITVEDRAVMDK
FT                   DIVTIDFEGFVDGVAFEGGKGEDYALTIGSHSFIDTFEDQLVGKNIGEDVEVNVTFPTE
FT                   YHAADLAGKPALFKVKVKEIKAKELPAADDEFAGDVSEFNTLEEYKADLKKSLTEKKDK
FT                   AAKTAKEDAVVDKVIENATMEIPDAMVDTQKRQMAEDFAQRLKMQGLSLEQYFQFTGLN
FT                   PNTFMENLGPQALKRIQSRLVLEAVVKAENITVSVEEIDKELAEMASAYQMEVDKLKEL
FT                   IGEKEKEQIVMDMAVQKAIDLVASEAKEV"
FT   gene            480272..480853
FT                   /locus_tag="Cphy_0377"
FT   CDS_pept        480272..480853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0377"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: cbf:CLI_3370 ATP-dependent Clp protease,
FT                   proteolytic subunit ClpP; TIGRFAM: ATP-dependent Clp
FT                   protease, proteolytic subunit ClpP; PFAM: peptidase S14
FT                   ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40764"
FT                   /db_xref="GOA:A9KSX0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSX0"
FT                   /protein_id="ABX40764.1"
FT                   /translation="MSLVPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVTDVSASVIV
FT                   AQLLFLEAEDPGKDISLYINSPGGSVTAGMAIYDTMNYIKCDVSTICIGMAASMGAFLL
FT                   AGGAKGKRFALPNAEVMIHQPSGGAKGQATDIQIVAENILKIKKKLNTILSENTGKPLE
FT                   VVEVDTERDYYMSAEEAKNYGIIDSVIASR"
FT   gene            480918..482219
FT                   /locus_tag="Cphy_0378"
FT   CDS_pept        480918..482219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0378"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="KEGG: cth:Cthe_2741 ATP-dependent Clp protease,
FT                   ATP-binding subunit ClpX; TIGRFAM: ATP-dependent Clp
FT                   protease, ATP-binding subunit ClpX; PFAM: zinc finger C4
FT                   domain protein; ATPase AAA-2 domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40765"
FT                   /db_xref="GOA:A9KSX1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSX1"
FT                   /protein_id="ABX40765.1"
FT                   /translation="MANRTEDRKQVRCSFCGKSQEQVRKLLAGPGDVYICDECIELCYE
FT                   IVEEEFDDDVAESASGINLLKPKEIKEFLDQYVIGQEEAKKVLSVSVYNHYKRVLSEKD
FT                   LDVELQKSNILMIGPTGSGKTYVAQTLAKILNVPFAIADATALTEAGYVGEDVENILLK
FT                   IIQAADYDIERAQYGIIYIDEIDKITRKSENTSITRDVSGEGVQQALLKILEGSVASVP
FT                   PQGGRKHPHQEFIQIDTTNILFICGGAFDGLEKIVEARIGQKSIGFNAEIAHGQKENIG
FT                   DLFRQVLPQDLIKFGMIPEFVGRVPVNTALDLLDEQALVRILTEPKNAITKQYRKLFEL
FT                   DGVELVFEEDALKEIAKRSFERKTGARGLRAIMESVMMDSMFKVPTDTSVLKCIITKES
FT                   AEGKEEPRLVTAENGQQRKIAQKKVAKKSSNEIA"
FT   gene            482373..484802
FT                   /locus_tag="Cphy_0379"
FT   CDS_pept        482373..484802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0379"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: amt:Amet_1072 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: peptidase S16 lon
FT                   domain protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40766"
FT                   /db_xref="GOA:A9KH99"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KH99"
FT                   /protein_id="ABX40766.1"
FT                   /translation="MSEYTRQLPVVALRNMAVMPGMLIHFDVNRKVSIEAIEAAMLLNQ
FT                   QVLLVSQIDAETENPTADDLYRVGTIAEIKQMIKLPGNVIRVLVTGLERATLDSLVSEQ
FT                   PYLKAQLTSKEAELLNLTEAEEEAMVRALRDLFEVYTTENNKLNKDIIRQVEASREIEK
FT                   MVEQLSIHIPMTLEDKQLLLAASDLMEQYERLCLILADEIEVMRIKRELQNKVKDKVDK
FT                   NQKDYIMREQLKVIKEELGETSSVSDIMQYLEQLKELVASDEVKEKIKKEIERFQNVAG
FT                   SNSESAVARGYVETLLSLPWDKVSEDFMDLAYAKEVLETEHYGLKKVKERVLDFLAVRQ
FT                   LTEKGDSPIICLVGPPGTGKTSIARSIAKALNKEYVRISLGGVRDEAEIRGHRRTYVGA
FT                   LPGRIITGLKQAKVKNPLMLLDEIDKMSSDYKGDTASAMLEVLDSEQNCNFVDHYVEIP
FT                   VDLSEVMFIATANTTQTIPKPLLDRMEIIEVSSYTENEKFHIAKNHLLNKQIEKNGLKK
FT                   SQISISEKALRKIISDYTREAGVRGLERKISEVCRKIARELLEQESKENQNLIKSAKNK
FT                   SNNKNQSHSEVAAAVEAEEISVTTKPSKIKVTEKNITTYLGKPKFRNEIASQKDEVGIV
FT                   CGLAWTSVGGTTLQIEVNSLPGKGALILTGQMGDVMKESAQLGISYIRSLSKEYKISEE
FT                   YFQKNDIHIHIPEGATPKDGPSAGITMATAMLSAITGKKVHAKVAMTGEITLRGRVLPI
FT                   GGLKEKLLAAKNTGIKKVLIPEKNRPDLEELEQEITEGMEVICVATMDEVLKHALV"
FT   gene            485065..485670
FT                   /locus_tag="Cphy_0380"
FT   CDS_pept        485065..485670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0380"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   cdf:CD3300 probable GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40767"
FT                   /db_xref="GOA:A9KHA0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KHA0"
FT                   /protein_id="ABX40767.1"
FT                   /translation="MNVNQVDLETVCGVTSVLPENTQPEFAFAGKSNVGKSSLINGLMN
FT                   RKSFARTSSQPGKTQTINFYHLNEKLYFVDLPGYGYAKVSSELKAKWGKMIEKYLRTST
FT                   QLKVIFLLIDIRHEPSANDKDMYEWIVHNGFEPVIIATKLDKINRSQRDKHIKMVRTGL
FT                   CAGANTKILPFSSLSKEGKDDIWRCIEQFLEVPDTENK"
FT   gene            486104..487459
FT                   /locus_tag="Cphy_0381"
FT   CDS_pept        486104..487459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0381"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: pfu:PF0824
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40768"
FT                   /db_xref="GOA:A9KHA1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHA1"
FT                   /protein_id="ABX40768.1"
FT                   /translation="MRMKENKDYLLKGTLWKAILMLAIPIAVNNFIQTMYNLTDSYWLG
FT                   KIGTDPQSAITVVTPIQSIIVNFGTGITVAGAILISQYLGAKDEKNAKSMVGQLFASCM
FT                   IFSVVCAAICFLLTPALVGWLAGGESFSSMAVTYLRIVILDMPFLFTINIFTAVNQSQG
FT                   DTVRPMFLNLLGIVLNMILDPLFMLGFGWGVAGAALATLLAKVPCAIIALYSLCNNKKS
FT                   LYITKESLKIQKDKLKSIAKIGLPTAIGGSTMQLGFLLMTSSVIKYGSTAVSAYGIGNR
FT                   VNGLVTMPANAMGSAVATIVGQCIGARDQVRAQKAYLMARRIAVIFLFIGGLILSRNTV
FT                   SEPIVRIFSNDPDVIRLGTQFLQLMAFWCFTNGIYTTTNGLHQGSGHTMINMTIDATRL
FT                   WVFRLATLFICERLLHMGVQSIWYAVVVSNGISAVILWIIYKMGVWKKQVIS"
FT   gene            488237..489733
FT                   /locus_tag="Cphy_0382"
FT   CDS_pept        488237..489733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0382"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   cbh:CLC_0609 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40769"
FT                   /db_xref="GOA:A9KHA2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHA2"
FT                   /protein_id="ABX40769.1"
FT                   /translation="METKERKFIYAEEEKRLLRTNLTNYICVMLVQIVMIALFAMDQIT
FT                   VEKDNINLIAIGLCFANMLIITVAFLRLKSSNRFRYIMMIGFSIVYGFVMALGANLLVF
FT                   MYIFPILISLILYNDKRCIIIFSSYMAIGNVARVIIILNIEDILINKSNYILIAVLGII
FT                   ITFVLIYTTLFSEVFAADAQGALKEKQLEQENMVKDILTIASTVREGSLSANQMMNQVE
FT                   EDTKQMQLSLDEISSSTQSNAESIGQQTVMTQSIQSAIEEARILSSEMVAAAKDSSEVL
FT                   KKSMQVVYELKDKASLIANSSEDVVDSMDLLQNKTRDVQEIAQIIFKISGQTNLLALNA
FT                   SIESARAGEAGRGFAVVADQIRQLAEQTKQATENISSIIAELDINAQDVSNKIHSTMDA
FT                   TGQQNTLIQQTSEHFAKMNENVNLLSQNVKNIDERIYELMNSNDSIVDNISQLSATSEE
FT                   VSASSEMAAESSQRSIQNVISAKDHLDEVVRSAERFEAYL"
FT   gene            complement(489955..490506)
FT                   /locus_tag="Cphy_0383"
FT   CDS_pept        complement(489955..490506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40770"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHA3"
FT                   /protein_id="ABX40770.1"
FT                   /translation="MYEWKNKNIKSQFEMQKMVAKNNGVSSFTEEELSALNLKTKNFTS
FT                   IHDPQVKRLVELAFIRGTLNGLQLADTQSEAVSDDKKSAVVITKQVEVQKAVNEERLYF
FT                   VACKIRNRQDKVVYTNLMLKARTDAEVESMASSECSIKHQTLIQCKIIKSYGTDTMQFQ
FT                   FGIGTKDQTALAALGKKMLQ"
FT   gene            complement(490581..491561)
FT                   /locus_tag="Cphy_0384"
FT   CDS_pept        complement(490581..491561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0384"
FT                   /product="protein of unknown function DUF939"
FT                   /note="PFAM: protein of unknown function DUF939; KEGG:
FT                   cbh:CLC_1112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40771"
FT                   /db_xref="GOA:A9KHA4"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="InterPro:IPR021062"
FT                   /db_xref="InterPro:IPR038323"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHA4"
FT                   /protein_id="ABX40771.1"
FT                   /translation="MKKFNKVSKIAVGSTLAILLANAIGLNYSISAGIITLLTIQDTKK
FT                   ETIFISLKRLVAFMFATILALLLFPNFGFTTIPFGLFLFLFVGGCSIVKLQDGIAMNSV
FT                   LATHYILSESISISMITNEALLLFIGAGIGTLINLFMPSNVAKIREVQERIEADLRKIL
FT                   FRMAYFLRESDKSNYKDHCFTPLKEDINLGLTYAYTNMNNTLFQESEYFIRYMEMRKHQ
FT                   LQILAEIYEKIISLHAVPKQVLPISQFIESIANSLAESNNAKGLLQLEKTLEEEYRQSP
FT                   LPTTREEFEDRAVLFMILKDFKMFLLIKEQFADTLTKDQIQKYWS"
FT   sig_peptide     complement(491490..491561)
FT                   /locus_tag="Cphy_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.677 at
FT                   residue 24"
FT   gene            491883..494183
FT                   /locus_tag="Cphy_0385"
FT   CDS_pept        491883..494183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0385"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bcl:ABC1143 transcriptional regulator,
FT                   AraC/XylS family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40772"
FT                   /db_xref="GOA:A9KHA5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHA5"
FT                   /protein_id="ABX40772.1"
FT                   /translation="MLLRNFKLKKSSVYVVFFFSYILILIVALSCGFAYYAQITAKITK
FT                   QTENTKQLLLTELRTSVESSTQYIEELCNEFTFNTKLEQFAKGLPSVTLHEAMQELTLR
FT                   QKPGALLFDYFLYIKETDEIITPNIRMKADKFFDIMYSFEDIDYKEFAEQLKGNYFKNY
FT                   LPIMKVNQYDKNPVEILPLIQTFPVGTKQKPLGQVIIFINAEKLFSMVEQFHVATESDV
FT                   YVYNKNNVCILSSSGAPELPVELVTDKSAGNNTKDSIVFRQLSDTLGWKFIISTPKDLF
FT                   YSENYEFLLRMVGVAVVYLIIGIVLVSFLAEYSYKPIREIRKYIDKNTKVDGIVKNEYE
FT                   VIKTTLKEQITNGRELSDLLESQKPIVKREVLGKLLHGMVTDYSSLKERFVPLGITFTT
FT                   NLFYTVALEVSEGCEFFRMDKAENDQSMILAKFISENVGVDLFQEKFNYYYLDMGQNTA
FT                   VLLLNLRKEEELEEADEIVYQKVSELIQFLKKYYSLYIYTGISKQHHTLKGIQLCFDES
FT                   RKALEQHKLYGGFEPYCFYELENLEADYYYPSEMEYQLLRYIKTGESDKAKQLLQSILD
FT                   INARKKKISTSAARGLLFEISISLKKLFDGAMISRGKETSNLLDLDNYLKTPNLLVAFD
FT                   DFCSLIDWYQKERAEVPVSNKTKRLVDSIAEFIEQNIGENWLDLNGLSSEFGVTPQYIS
FT                   NIFKKYKDENIKDYISKLRLAKAKELLRDTELPIKEIANQLGYVGEIGVIRLFKKYEGI
FT                   TPGDYRNQIHNVN"
FT   sig_peptide     491883..491996
FT                   /locus_tag="Cphy_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.790 at
FT                   residue 38"
FT   gene            494649..497018
FT                   /locus_tag="Cphy_0386"
FT   CDS_pept        494649..497018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40773"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHA6"
FT                   /protein_id="ABX40773.1"
FT                   /translation="MQKQSMENQGEVVQSKSVLRREVTRRQAIKTIGTGGLLIACAPFL
FT                   FGKTASAASGKDKEVKGVKDVLSLTDVESLKRLTKTERKDGMIVNLLGYYGAGDGGQKS
FT                   LVYLSKSKEKENGGTVHHPNDGVGAWHVLHDGIGQFRWFGIFDESIPADHALDSLVNDE
FT                   SFHRIEASSDLLLIKRHVFHQSNLELDFQNHIMYTYGAENANRDNPFAAMMFFQGVKVG
FT                   SPITVTLPYVRNENGTLMQTDFSEDSDYLYVGNNKKFAENEWYYVETDVRPMEEVPGRL
FT                   PIGGGSSDKEIQKLLRVTKVGKSASDTEYVAFNYLNAWPLKSKRKITYQKIEPVFHVNV
FT                   KNLKFEGQGHSDTTGTSPVAHEFCVDCNITNIQATKVFWPLNLRRYCTQYEVRDCLLIN
FT                   PEEVTLGGTGYLIQQIGCLYGSVINCKAHNVRHLNDFTGCAYSLVENCHCTGDENGAFV
FT                   THGQYDHDLTYIGNSGFLSFANSALNAKDSHTWGGFHKRIVVKKHQAPRVVFENKMNRV
FT                   IDMTLEDCYVYRNTERYGGNGGSVWANVDGLVMRNCVLMGPLALGEDSSMSHRPTIIEG
FT                   CTIHMLDGHYLTRHRGSTYEVERDITFKNCVFKNIGQNFIVKGETIRFYDCHFYADPNA
FT                   PISRLNVESKHVIISGGGFHNVCFAFDKGGTTTEAVGDQSLVVCGGAVMEGNNASGALI
FT                   DIKNNARVRLDFSQAEFAPGYQMKMISHTPEDGTVSTGTLSLQMQGTTLKGTELSISES
FT                   SLGKDSYIMVQSCLLKNSRLDLPSGSQCLVMNNLTL"
FT   gene            497116..498111
FT                   /locus_tag="Cphy_0387"
FT   CDS_pept        497116..498111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ckl:CKL_0518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40774"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHA7"
FT                   /protein_id="ABX40774.1"
FT                   /translation="MNRKSNKLHVINRVIALLAMLCIVTGLFGNQVSAAKVTIAKELKI
FT                   GQYVTFGTYNKEPILWRVIDLDKGGNPLLYAENILTYKAFDDQLWVANTAKNYGNNYWA
FT                   SSDLRAWLNGVGDEIAYDASGAPKSGTTKDGWNAYDEEQGFLTEFTKEEQDAIVLMKHK
FT                   QLIDEVNSTASSVENKDAKLHRYESNIKDCLTNYEVARYLITEEKVFLLDIKEFYTLVY
FT                   QAGFPVIKEPTKSAKEKNEAKSTLAFSPYWLRTPRASYAEETADPKYGGVSAKPDGASV
FT                   RVVYGKDYILAKDAYDGSVGVIPALYLDKDYVLSQGNGTVTSPYHNQRKK"
FT   sig_peptide     497116..497220
FT                   /locus_tag="Cphy_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.916 at
FT                   residue 35"
FT   gene            complement(498254..499144)
FT                   /locus_tag="Cphy_0388"
FT   CDS_pept        complement(498254..499144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0388"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   bth:BT_3586 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40775"
FT                   /db_xref="GOA:A9KHA8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHA8"
FT                   /protein_id="ABX40775.1"
FT                   /translation="MIRIGILGSDNSHALAFSKLANLPDEAGNYLYDDVRVTSIYGLDK
FT                   ERTQVVAREGQIDTIVEHPIDMFSHVDAVMVVFRHGNLHYKHALPFIEAGIPTWVDKPF
FT                   TILPSEAIHLIDAAKKNNTLLAGGSTCKYCPDVLTLQQEFQHLHQNQSVISANFNFPGE
FT                   LVSPYGGIYFYGGHAIEIMTTIFGKNPISVKTDVHCGNLIALFKYEDFAVTIHFAEVSE
FT                   FFATIYSGDKVITHPINISTVYRQGFQKYVDALKKGQMPEDFDSLLRPVLLLEALEKAI
FT                   NTGEEITIGNLRLDG"
FT   gene            complement(499306..500217)
FT                   /locus_tag="Cphy_0389"
FT   CDS_pept        complement(499306..500217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0389"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: fjo:Fjoh_4335 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40776"
FT                   /db_xref="GOA:A9KHA9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHA9"
FT                   /protein_id="ABX40776.1"
FT                   /translation="MITLLLVLSITFFILQSVSMKFVKADTLPQKMLVHGVFTLVAGIG
FT                   MSFFLLFSRESFSLSKNTILFGILFGFLFAFTILFYNLAINSGPLSYTAFYFSSSMLLP
FT                   TFFGLLFLKEELRWTLLIAIILFLMAFYFLNVTKESKKEAVSPTHRKQKKQWLFYCILT
FT                   FIGNGCLAIVQKLHQQLQHGTEASGLILLGFAFASLCYFIAYPVAKSKASEVKITTSSS
FT                   VKQLKTNLLPILFLAAGSLLGNLLLTSLAGKIPSSYLFPLVQGSIILGITIISTLFFKE
FT                   KLSNRGKIGILLGVLAIVFINV"
FT   sig_peptide     complement(500140..500217)
FT                   /locus_tag="Cphy_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.536 at
FT                   residue 26"
FT   gene            complement(500301..501620)
FT                   /locus_tag="Cphy_0390"
FT   CDS_pept        complement(500301..501620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0390"
FT                   /product="amidohydrolase"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; KEGG:
FT                   cno:NT01CX_1200 putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40777"
FT                   /db_xref="GOA:A9KHB0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB0"
FT                   /protein_id="ABX40777.1"
FT                   /translation="MNLIKIKALDAITKHSNKIISIGEEIFRNPELGYKEHNTSNLVKQ
FT                   IWEELGLEDITNVGLTGWRGYLKEKNYTATPITIAVMGELDAVISPKHPFADKQTGAAH
FT                   ACGHHAQIAAMIGCAIGLSAVKDALDGNVCFLATPAEEYIELGYRSQLKQDGLISYFGG
FT                   KQQMIAEGVFDDVDMALMVHSETNQSKPHISINSHSTGFIGKNIRFLGKEAHAGGAPWD
FT                   GVNALNAATLAISAIHAQRETFRDCDSVRVHPIITKGGDLVNTVPSEVTMESYVRAASI
FT                   EAIKAANTKVNRAIKGASYAIGTDVDITDSAGYLPLMQNTRLSSIFSKNATQLLPNVTV
FT                   EENLPFCGSTDAGDLSYLLPVIQPTISGFSGDLHSCDFHVEDVELAYLVPAKLMAMTVI
FT                   DLLIKEASIAKEIKSASPRKKKEDYILLWNTLLKEKEEEI"
FT   gene            complement(501779..502831)
FT                   /locus_tag="Cphy_0391"
FT   CDS_pept        complement(501779..502831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rba:RB7999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40778"
FT                   /db_xref="GOA:A9KHB1"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB1"
FT                   /protein_id="ABX40778.1"
FT                   /translation="MNRQETALHNLKEGTVIPAIPLTLHSDRTFYEEGQRKLVKYYLHA
FT                   GVGGVAVAVHTTQFEIRKPEINLLEPVLKVAAEEITKYEQETGKTIIRVAGACGRTEQA
FT                   VSEAKLAKSLGYDAVLLSPGGLSEESEEYLIERTQAVAAILPVIGFYLQTACGGRRLSY
FT                   EYWRAVADTPNVVAIKCASFNRYQTIDLVRGVAASKRSNEIALYTGNDDNIVVDLLTPY
FT                   RFTMDGKQVEKRFVGGLLGHWSLWTNNVVKQFSELKKYQTESMIPSDLLSLAIEVTDCN
FT                   GAFFDVANNFAGCIPGVHEILMEQGLMEGIWCLDEEEVLSKNQLEEIHRVQSMYPHLTD
FT                   DEFVKSFLAK"
FT   gene            complement(502831..503847)
FT                   /locus_tag="Cphy_0392"
FT   CDS_pept        complement(502831..503847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0392"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   rba:RB7998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40779"
FT                   /db_xref="GOA:A9KHB2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB2"
FT                   /protein_id="ABX40779.1"
FT                   /translation="MWTEERLDTLLTNPSSALIEDMKKITGDIMILGAGGKMGPTLSLL
FT                   AKRACESAGITKRIIAVSRFSDPIVKKLLSDHQIEMISADLLEPGAIASLPKVENIIYM
FT                   AGKKFGTNGNEYQTWAMNATVPSHVMEHFKDSRIVVFSTGNIYPKVAIYSGGATEETHP
FT                   EPVGEYAMSSLSRERIFEYGANTYGTKLAIYRLNYAVDLRYGVLYDIAENIMNDRPISL
FT                   ESPCFNCIWQGDANEVAIRLLLHADSSVFRLNVTGPETIGVKETALKLAKKLGKEVSFV
FT                   GEESSTAYLNNASKMTELFGYPTVSINTLIDWQAEWILSGGRSLGKPTHFEERKGNF"
FT   gene            504230..505210
FT                   /locus_tag="Cphy_0393"
FT   CDS_pept        504230..505210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0393"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC3119 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40780"
FT                   /db_xref="GOA:A9KHB3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB3"
FT                   /protein_id="ABX40780.1"
FT                   /translation="MGLKRDKRKDGRARPSKEVRARMRHQSRVLIKRNWALYLFILPAF
FT                   LYFLIFAYAPMYGVQIAFKDFIATKGFGGSPWADPIYKHFKTFFSSVNFSQIFMNTITL
FT                   SLYYMAVSFVTPILLALMINEVGNKYFKKTVQNITYMPYFISTVVLVGMIDLFLSRNGL
FT                   FNQIGAALFHSEPTMFLMKDSLFNDIYVWSGVWQVTGYGAVIYIAALSGVSPELHEAAI
FT                   MDGAGRMQRIRHINLPAIMPTIVVMLIMTVGGIMNLSFEKVLLMQKDGNMMVSEVISTY
FT                   VYKLGIQRAQYSLSSAVGLFNNVINLILLVTVNKISRKVSENSLW"
FT   gene            505226..506137
FT                   /locus_tag="Cphy_0394"
FT   CDS_pept        505226..506137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0394"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC3118 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40781"
FT                   /db_xref="GOA:A9KHB4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB4"
FT                   /protein_id="ABX40781.1"
FT                   /translation="MKRKNKMKQSRGDKIFVIVNYTLLTVILLLCLYPLWFVMISSVSN
FT                   PDLVNSGKVWLLPKEISFTGYKNLFHDKSIIRGYINTLIYTGGGTMLNLAVTLPAAYAL
FT                   SRKDFVGRKFFTLMFLFTMFFSGGLIPTFMTVKNLGLYNSPWVMVILGATSMTNIIISR
FT                   TFFMTNIPNELHEAAQIDGCGNVRLFLQVVLPISTAICAVMALFFAVNHWNGYFTALIY
FT                   IRDDRYKPLQIIMREVLMRSKFNAEMLQQGGDSAGLLQEELRAAEQIKYALIVIASLPV
FT                   MAIYPFIQKYFVKGVTVGAVKG"
FT   sig_peptide     505226..505360
FT                   /locus_tag="Cphy_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.575 at
FT                   residue 45"
FT   gene            506211..507890
FT                   /locus_tag="Cphy_0395"
FT   CDS_pept        506211..507890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0395"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bcl:ABC0358 putative multiple sugar transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40782"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB5"
FT                   /protein_id="ABX40782.1"
FT                   /translation="MKFKKLVAMGLCTCLAVTLLAGCGKKNEDQANNNVTATPSEGQST
FT                   PSGGDSGKDEMPENVNAVGVYPIVKEPITLKIMGRKDPGATDWGELEVFKRLTKITNIN
FT                   FEFELSEGDTFVEQKNIALVGGEYPDLILRADTSSITDEETYGPQGVFLDLTDLIDKYA
FT                   PNIKALLQERPDIKAAITSMDGKIYGLPYAFQTATTQGHTGFFDSKWMDNVGITKVPET
FT                   TDELYDMLVKFKEMDANGNGDLNDEIPFSCSGLNTTIRRLLIPAFTGTAEGLGFDIKNG
FT                   EVVYAPALPEYKEFLIYTNKLYSEGLLDPEFSTQTSQQWQAKVKAGMCGVYSASPTLLD
FT                   PEVTITQQLSLPPLTSSTNDKKVVIQPDNLYPARGFITDKCKDPVAAIRLLDMFYATPE
FT                   NAVEGFSGQTLFLGWEGEHWEYTNGMKDFYRWIDPITGFGDINKSISVNMELPGYLNFT
FT                   AGPAGNPLMEMKVEQVNNMQKPYYTTAYPINARFTADESERGNVIENDLYTYVTMMTTK
FT                   FIIGEVSIDKFDEYIDTLNKTGLPELLEIKRAALARWNEAMN"
FT   sig_peptide     506211..506276
FT                   /locus_tag="Cphy_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.813 at
FT                   residue 22"
FT   gene            507971..509302
FT                   /locus_tag="Cphy_0396"
FT   CDS_pept        507971..509302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40783"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB6"
FT                   /protein_id="ABX40783.1"
FT                   /translation="MQKEKTSFETDFSRFGILDGSVSADTALEEMLSDETIRVIHAYTP
FT                   LNFTKRHLIKRSNITFDFHGNMVTAIGIEHANHNDPFSALFHITGERLSDIRSVSLSHP
FT                   LQELYDIFEVDDSDQFELDSWWIVTCNALCGREEKEIDKMLQVTEIIDKTHVRFNYKMG
FT                   WPFEAGRVLTYQKVKPIFDVSVNNMRFTGNQEGEETGVEPLAYEYAVNCNASNIHARFT
FT                   YWPVILRRHNTGYVTERCSLHNPIEVVVGGTGYLTQQIHCLYGKVRDCEASNARHLNDF
FT                   TGSAYCMVENCHGDGDFHGAFVTHGQFEHDLTYTGNSGLLSFANSGPTWGSSAKRITVI
FT                   RHVGCWGLAFAKVSDLTLQDVVIQKTEKYEECGNLLLNADGLQVRGCTAERLVLTQRSN
FT                   RSKRPVVIENSYFTEGVEITKTGEAAVKTKIRIINTIDKDGKEC"
FT   gene            509392..510393
FT                   /locus_tag="Cphy_0397"
FT   CDS_pept        509392..510393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0397"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: sco:SCO0663 2-hydroxyacid-family
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40784"
FT                   /db_xref="GOA:A9KHB7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB7"
FT                   /protein_id="ABX40784.1"
FT                   /translation="MLNILVTIPTLSAVFPTFFDDKRKRELESIGNVIWNVSDKQFSKE
FT                   EFTEKLKDIDICVTGWGTPVMEEEVLTYANRLRFIAHTGGSVKPYVTDACYERGIRVVS
FT                   GNSVFAESVAEGVIAYALSSLRDIPRFSYELKQGIWPAQFYNRGLLERKVGIVGYGMIA
FT                   RYVVSMLKPFHCGIKVYSRHIANEELEQHQMEKATLDEIFSTCDIISIHSGMTPENHHL
FT                   ITEELLNQMKPGALLINTARGAIIDEEALIKVLDKKEIYAALDVYETEPLPSDHPLLEC
FT                   ENALLLPHMGGPTIDRRLSVTSSVITDIHNFIDEKPLLCEISASYAAKMSMY"
FT   gene            510532..511797
FT                   /locus_tag="Cphy_0398"
FT   CDS_pept        510532..511797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0398"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bca:BCE_1902 oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40785"
FT                   /db_xref="GOA:A9KHB8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB8"
FT                   /protein_id="ABX40785.1"
FT                   /translation="MEKIKLALVGAGERGQNSYAPYAKLHGYEIEFVAVAEPDFGRREQ
FT                   FCKDYGVSKEHAYESAEDFLSQGKIADAVLICTQDKDHFDYACTAIHLGYDILLEKPIS
FT                   PDPLECIQLEELAVKHGTTIVVCHVMRYTKFYRKIKEIMESGVIGDVVSITHTENVAYW
FT                   HYAHSYVRGNWHRREDSSPMILAKCCHDMDILAWLLDSRCKSISSYGDLTYFKEENAPV
FT                   GSPKRCMDGCPHSSTCPYYAPKIYLTEDTKWPTSCLGTDTSYEARKKALQEGPYGVCVF
FT                   HNDNDVVDHQVASILFENGVTVAFTMCAFSNACDRTIKFMGTKGEIRASMEKNTIEVTE
FT                   FGQGIMTGTTNVYTLIPGDTGHSGGDEGIMEEFVSILKGVRKNTNTISQSVHSHIMAFA
FT                   AEESRLQGKTIEIVDYEKKFRS"
FT   gene            511866..513032
FT                   /locus_tag="Cphy_0399"
FT   CDS_pept        511866..513032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0399"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cpf:CPF_1025 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40786"
FT                   /db_xref="GOA:A9KHB9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB9"
FT                   /protein_id="ABX40786.1"
FT                   /translation="MEYKTGNGYPIEKFIEFGNEVFGDEVLPGGFECLLPKLKKDTELP
FT                   KHFRVIEEEGELKAMLLSLPLTLNVYDQMLSIRYIGLVAVHESARGKGYMTFLMEQVIK
FT                   EMKEEKTMLSVLGGQRQRYEYFGYEPAGLEFHCAVNKTNLKHSMLSKPMDSGITIDLLK
FT                   QESVEVGQAYKLFMCIPVRTLREEDSFYELLQSWRSTPYVIYKDGDFKGYLSVSVEGET
FT                   GQIRELYRKDDSVSITDICYLCMEKCKVEKLEFALSLPEIKKDKELQNLCETYEITCNH
FT                   SFCVFDFEAVIKAYLPFLSQTNTVLEGEARFYIEDELYTICVDEGYQTVRRESTLRDVK
FT                   LKDVPSYTHKEAVRLLFTPLSSLQGNENSEELRKWFPLPLYLSILDAC"
FT   gene            513123..513443
FT                   /locus_tag="Cphy_0400"
FT   CDS_pept        513123..513443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0400"
FT                   /product="sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /note="PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: lip:LI0589 sec-independent protein
FT                   secretion pathway components"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40787"
FT                   /db_xref="GOA:A9KHC0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHC0"
FT                   /protein_id="ABX40787.1"
FT                   /translation="MFNIGLSEFLLLLLIAFLVVGPKDLPKIARAIGKGVRYLGNLKEE
FT                   FGEILNIEEEINAVKNDFEEIKDITKEAEQASRDIIDVMNEAKKDLKDIDGAISEAKSV
FT                   VE"
FT   gene            513617..513796
FT                   /locus_tag="Cphy_0401"
FT   CDS_pept        513617..513796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0401"
FT                   /product="sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /note="PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: pth:PTH_1709 sec-independent protein
FT                   secretion pathway components"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40788"
FT                   /db_xref="GOA:A9KHC1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHC1"
FT                   /protein_id="ABX40788.1"
FT                   /translation="MRIGTTEVLLILALALVLFGGGKLAGVGKALGTSIKEFKKEVHSE
FT                   DSISEAKGNSSHEN"
FT   sig_peptide     513617..513697
FT                   /locus_tag="Cphy_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.685) with cleavage site probability 0.562 at
FT                   residue 27"
FT   gene            513786..514592
FT                   /locus_tag="Cphy_0402"
FT   CDS_pept        513786..514592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0402"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: chy:CHY_0863 sec-independent protein
FT                   translocase protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40789"
FT                   /db_xref="GOA:A9KHC2"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHC2"
FT                   /protein_id="ABX40789.1"
FT                   /translation="MKTKRMEKRNQGYMDSKELGESKTLMEHLLDFRKVLIFSTAVIVL
FT                   FFLVIWLCCSEWLLNIVAKPLIDRNITIVYTAIAESFSAQMKVSFLFAVILAFPFVLGK
FT                   LWRFVAPSLYRREKFVYGGVFFIVLLLFVLGILFAYLIVFHMAINFFVFSSGALAKPMI
FT                   SIESYVGFMIRFMIPFGITFELPLVILILTKLQIVKLSQLMKSQKYVILLLFVLAAILT
FT                   PPDVISQIMLGLPLTLLYEIGVLGAAIVTARRKRRESYEAESCSQA"
FT   gene            514812..515024
FT                   /locus_tag="Cphy_0403"
FT   CDS_pept        514812..515024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0403"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: cth:Cthe_2979 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40790"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHC3"
FT                   /protein_id="ABX40790.1"
FT                   /translation="MLPKVKRKAEVVKNHCVACGVCANVCPKDASTIYRGIYAVVNEEL
FT                   CVGCSKCSKACPAGTIRMIEREVSQ"
FT   gene            515021..515602
FT                   /locus_tag="Cphy_0404"
FT   CDS_pept        515021..515602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdf:CD0628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40791"
FT                   /db_xref="GOA:A9KHC4"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHC4"
FT                   /protein_id="ABX40791.1"
FT                   /translation="MKMKQQTKWYEKLWIASSIYLILSPFNILFAWLGLLCFFIPLLIS
FT                   MFKGSKVYCNRYCGRGQLLTILGDRFKLSRNKATPRWMRSNYFRYGFLIFFLTMFVNML
FT                   MNTYYVLRGAKGLKQVITILWTFKLPWNFATYSYASSWIVQFGFGFYSIMLTSTILGLI
FT                   TMLLYKPRSWCVYCPMGTMTQGICKLKDKM"
FT   gene            515791..516495
FT                   /locus_tag="Cphy_0405"
FT   CDS_pept        515791..516495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0405"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   cth:Cthe_1903 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40792"
FT                   /db_xref="GOA:A9KHC5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHC5"
FT                   /protein_id="ABX40792.1"
FT                   /translation="MSVGYLTMDDGPSDITRDIIDYLTGRGIKPVFFFTGQNIEKRMEE
FT                   GVYAIKKGAIIGNHSYSHPNFEQLTLEQCISEVEKTEELINELYKKAGEVRKFKLFRFP
FT                   YGARKLNESKEFQEYLKNQRFCKLDDMHITSEWYDREGLIEGVDVLWTYDFTEYRIQND
FT                   TSLTYDDLVARIHEKKQGSSDSLLNEGSRHIVLLHDHEETNAVISRYYQKFLDYVMLHG
FT                   VDFIEPEFRYLS"
FT   gene            complement(516832..517254)
FT                   /locus_tag="Cphy_0406"
FT   CDS_pept        complement(516832..517254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0406"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   cbe:Cbei_4080 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40793"
FT                   /db_xref="GOA:A9KHC6"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHC6"
FT                   /protein_id="ABX40793.1"
FT                   /translation="MLDPNCAYCAEGELVAKFGIKICELPASKVYLFKEQSHKGRCIVA
FT                   SKFHVSEMIELSEEERNAFFADVNKVANAIHNAFHPDKVNYGAYGDTGHHLHFHLVPKY
FT                   KDEFEWGGTFAMDPKQKTLSDQEYEELIETLKANLK"
FT   gene            complement(517327..517848)
FT                   /locus_tag="Cphy_0407"
FT   CDS_pept        complement(517327..517848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdf:CD3250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40794"
FT                   /db_xref="InterPro:IPR025374"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHC7"
FT                   /protein_id="ABX40794.1"
FT                   /translation="MQAETLMLYKLIVLYILDKVDFPLTNGQLTNFILEKEYTNYFSIQ
FT                   QTISELIDDQYISAETIRNSSLYQITDSGKETLSFFCNTIAQAIRDDIDIYLKEHKYSL
FT                   REEVSTLADYFEVKKDEFITHLRVMEGSSAIIDLKLSVPTEREANLICNNWKQKSSDIY
FT                   TYVISSLIAD"
FT   gene            complement(517863..518804)
FT                   /locus_tag="Cphy_0408"
FT   CDS_pept        complement(517863..518804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0408"
FT                   /product="conserved hypothetical radical SAM protein"
FT                   /note="KEGG: cno:NT01CX_1004 radical SAM protein, TIGR01212
FT                   family; TIGRFAM: conserved hypothetical radical SAM
FT                   protein; PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40795"
FT                   /db_xref="GOA:A9KHC8"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHC8"
FT                   /protein_id="ABX40795.1"
FT                   /translation="MNLWQGKRYYSLDAYYKEQFGDKIYKLSLNGGMTCPNRDGNLGTG
FT                   GCIFCSSGGSGDFATSMKLSITEQIEAAKERVAKKAKSNRYVAYFQAYTNTYAPVDYLR
FT                   SIFTEAMGHEDIVALSIATRPDCFPDEVLRLLAELNQRKPIYIELGLQTIHENSAKLIR
FT                   RGYTLPIFEDALNRLSNLNIPVIVHVILGLPGESREMMLSTIDYLAKLPIHGIKLQLMH
FT                   ILKNTDLETFYRKEPTLFSLLQLEDYINALVECLEHLPPHIVIHRITGDGPKNLLIAPL
FT                   WSGNKRNVLNTIQKELKERNSYQGKYIRTNLE"
FT   gene            complement(518974..520125)
FT                   /locus_tag="Cphy_0409"
FT   CDS_pept        complement(518974..520125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0409"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic protein domain protein; malic protein
FT                   NAD-binding; KEGG: cbf:CLI_0318 malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40796"
FT                   /db_xref="GOA:A9KHC9"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHC9"
FT                   /protein_id="ABX40796.1"
FT                   /translation="MTLNEKALKLHEEWNGKLETTSKCQVKSREDLALAYTPGVAEPCK
FT                   VIANDSEAAYRYTIKANTVAVVSDGSAVLGLGNIGAHAAMPVMEGKCVLFKEFGGVNAF
FT                   PICLDTQDTEEIIKTIIHIAPAFGGINLEDISAPRCFEIEARLKEQLSIPVFHDDQHGT
FT                   AIVVLAGIINALKVTNKKKEDCRVVVNGAGSAGIAITKLLLNYGFCHLTLCDKVGILSN
FT                   QTENLNWMQKEMMEVTNLEGATGTLADALKGTDIFIGVSAPNIVAPEMVSSMNKDSILF
FT                   AMANPVPEIMPDLAKEAGAKVVGTGRSDFPNQVNNVIAFPGIFKGALEGRATQITEEMK
FT                   LGAAKAIADLVSNEELNEDYIIPEAFDERVCEVVSNAVKAYIK"
FT   gene            520544..522496
FT                   /locus_tag="Cphy_0410"
FT   CDS_pept        520544..522496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0410"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: cth:Cthe_2174 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; SMART: AAA ATPase; Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40797"
FT                   /db_xref="GOA:A9KHD0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHD0"
FT                   /protein_id="ABX40797.1"
FT                   /translation="MSNLYETKSLSELRDIAKEKGLKSISALRKQELIDALNALEKGQG
FT                   SVASINKSTDDKPIKLGTEEVKLATEDTKQSVENRGMESSHMQGNRNNVIRRLPEQNRQ
FT                   HELVKAPDQSKGNDNSRMSESYRSNEGRNMDNRLENRNNDNKNNDNRNNENRNNENRNY
FT                   ENSRNYENRSNENRNNENRNNENRNNENRSNEMLRNYDNNRRTMDNRRPMDNRRLNENR
FT                   GYNESDRVVRINPTGDISGNQATELGYNTTSSSDRFLSQANQQEEKLPIDMEQLDSGET
FT                   KEGILEVLSDGYGFIRCDNFLPGENDVYVSPAQIRRFNLKTGDIIVGNTRIRNQNEKFS
FT                   ALLYIKLINGLHPSEAVKRKKFEDLTPIFPNERIHLETPGCQVAMRMVDLISPIGKGQR
FT                   GMIVSQPKTGKTTLLKQVAKAITRNHPEMHLIILLIDERPEEVTDIKESIEGGNVEVIY
FT                   STFDELPENHKRVSEMVIERAKRLVEHKKDVVILLDSITRLARAYNLTVQASGRTLSGG
FT                   LDPAALHMPKKFFGAARNMREGGSLTILATALVETGSRMDDVVFEEFKGTGNMELVLDR
FT                   NLSEKRIFPAIDLPKSSTRRDDLLLNSAEVEANYLMRKALNGLKSEDAVERIIQMFVNT
FT                   KNNAEFVEMIKKTKI"
FT   gene            522664..522876
FT                   /locus_tag="Cphy_0411"
FT   CDS_pept        522664..522876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0411"
FT                   /product="ribosomal protein L31"
FT                   /note="PFAM: ribosomal protein L31; KEGG: bpu:BPUM_3350
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40798"
FT                   /db_xref="GOA:A9KHD1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHD1"
FT                   /protein_id="ABX40798.1"
FT                   /translation="MKIMQEAIQPKYYQAKVTCNCGNEFVTGSTKPEIHVEVCSKCHSF
FT                   YTGQQKAAAARGAIDKFNRKYGLNN"
FT   gene            522996..524594
FT                   /locus_tag="Cphy_0412"
FT   CDS_pept        522996..524594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0412"
FT                   /product="protein of unknown function DUF1385"
FT                   /note="PFAM: protein of unknown function DUF1385; KEGG:
FT                   sth:STH72 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40799"
FT                   /db_xref="GOA:A9KHD2"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHD2"
FT                   /protein_id="ABX40799.1"
FT                   /translation="MKSSGIGGQAVLEGVMMKNKEQYAVAVRKPDNEIAVEIKEYQGIG
FT                   NGNKIIKAPIIRGVIAFADSMVLGVRALTYSASFYEEEEEIKKDSKKKDGVLSFLVVLL
FT                   SICIAIGLFVALPMFLSDLFSKVITSSIVLGFIEGIIRVLLLVGYIVSISFMKDINRTF
FT                   MYHGAEHKTINCIERGYDLTVSNVRKQSRKHKRCGTSFLLFVAFISIIVFLFIRVDQIW
FT                   LRVVLRVLLVPVVAGISYELIRYAGSHDNVLVTIISAPGMLMQRLTTKEPDDKMIEVAI
FT                   ASVDAVFDWQGYLEGIKGKSAKRKHSNKKGKNQSKSNQKIKEDTEEIEEIEDIEAEVFA
FT                   ANLEEDLNINTKQETNKVEKKSKQTTTNSTKINSKNNQNKAHQAVKDENKEEIKTKENN
FT                   KVSQGSKSTQNSKNTQSGENAQSSKNAQGGKNTQSGENTQSGKNTQESKNTQNDTLTSN
FT                   VDSSEEFKNLDKLLYEMPEVAVEEKQNKLKERARNQEQVVLSSTEIAASLESTEEEDDE
FT                   ILRALDKYFSSGKDA"
FT   gene            524625..525464
FT                   /locus_tag="Cphy_0413"
FT   CDS_pept        524625..525464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0413"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="TIGRFAM: modification methylase, HemK family;
FT                   protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific; PFAM: methyltransferase small; KEGG:
FT                   amt:Amet_0330 modification methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40800"
FT                   /db_xref="GOA:A9KHD3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHD3"
FT                   /protein_id="ABX40800.1"
FT                   /translation="MSKITYESALREGCTLLQASSIQDAELDAWYLLEHVTGLRRIDYM
FT                   IRAKEDMSIEVYERYQQLLKKRALHIPLQYLTGSQEFMGLSFRVNESVLIPRQDTERLV
FT                   EEVLKVSKDKDVLELCTGSGCIIISLAKLGNIKNAVAVDISSDAIKVAKENAKDNEVLV
FT                   TYLLSDMFSNVSGTYDVIVSNPPYIESEVIEGLMPEVKDHEPRIALDGDADGLKFYRIL
FT                   AKESGRFLNKNGRLYLEIGCNQAAFIGELLSQNGFAQIKVVKDYAGLDRVVSAVYEG"
FT   gene            525835..526911
FT                   /locus_tag="Cphy_0414"
FT   CDS_pept        525835..526911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0414"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   cdf:CD3484 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40801"
FT                   /db_xref="GOA:A9KHD4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KHD4"
FT                   /protein_id="ABX40801.1"
FT                   /translation="MFDKLEDLLIRFQEIQNELNEPTVTNDQARFRKLMKEQNDLGEIV
FT                   DKYLEYKQTKKNIEESLELLDEESDEEMRELAKEELSTSKANLVVIEEQLKILLLPKDP
FT                   NDSKNVIVEIRGGAGGDEAALFAAELFRMYSKYAETMRWKIDMMNLNENGIGGFKEVIF
FT                   MINGQGAYSKLKYESGVHRVQRIPVTESGGRIHTSTVTVAIMPEAEEVDVELNMNDCRF
FT                   DVFRSSGNGGQCVNTTDSAVRLTHMPTGIVISCQDEKSQLKNRDKALKVLRARLYELEL
FT                   EKAHDAEAAARKSQVGTGDRSEKIRTYNFPQGRCTDHRIKLTSHRLDDIMNGDLQEVID
FT                   SLTAADQAAKLSNMQDEY"
FT   gene            527112..528479
FT                   /locus_tag="Cphy_0415"
FT   CDS_pept        527112..528479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0415"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: cation transporter; KEGG: lsl:LSL_0068
FT                   potassium uptake protein KtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40802"
FT                   /db_xref="GOA:A9KHD5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHD5"
FT                   /protein_id="ABX40802.1"
FT                   /translation="MFQKKRRFSTTRMIATGFLAGIMLGALLLSLPIATKAGIVTPLED
FT                   SFFTATTSICVTGLTTVTTGEHWSFFGQLVILLLIQFGGLGVVTFTTTIFLLLGKRVKL
FT                   SDRLVIQNAYNIDTLSGLVKLTKKIIKFTLIVEGIGAFCYLFQFVPEFGVVDGVWYSIF
FT                   HAVSAFCNAGIDLVGGNSFIPYRDNLWINLVTMGLIVLGGIGFPVWWDVFHISKQAVKK
FT                   DIKVRSMFRRLTLHSKIAITVTVVMIVLGAVLTFILEFNNPATIGELSIGKKMLSSLFQ
FT                   SVTTRTAGFATIPQQNFKDATSIVYLVWMFIGGSPSGTAGGIKTVTVAVILLSTISIVR
FT                   GKKDIEIFQRRISDQYLKKGLAVVMVSFLVLMVTTISLSAIQNSSFLDTLYETTSAIGT
FT                   VGLTRNMTGSLMTAGKIIVMITMYLGRIGPITMALAINAGKHQGEKSLPEGKILVG"
FT   sig_peptide     527112..527225
FT                   /locus_tag="Cphy_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.642 at
FT                   residue 38"
FT   gene            528520..529173
FT                   /locus_tag="Cphy_0416"
FT   CDS_pept        528520..529173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0416"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: cpf:CPF_2142 putative potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40803"
FT                   /db_xref="GOA:A9KHD6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHD6"
FT                   /protein_id="ABX40803.1"
FT                   /translation="MARKEFVVFGLGRFGKSVATTLAEGGCEVMVVDNDEDKIHEIADY
FT                   VTYAVRADVTEAESLESLGLRNFDGAVIAIGENLEASVMVTILVKELGVPYVLAKAQNE
FT                   LHAKVLKKVGADMVVFPEKETGIRIANNLMMGNFFDAIELSSTSSMMELDILQEWIGHS
FT                   LRELNLRAKNKINVIGIKRDDQLNINPDADMPLERNDVLVIIGKNEILNKLANQ"
FT   gene            529257..530051
FT                   /locus_tag="Cphy_0417"
FT   CDS_pept        529257..530051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0417"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
FT                   ribose methyltransferase substrate binding; KEGG:
FT                   cth:Cthe_1222 RNA methyltransferase, TrmH family, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40804"
FT                   /db_xref="GOA:A9KHD7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHD7"
FT                   /protein_id="ABX40804.1"
FT                   /translation="MITSSSNSQIKNLIKLQKQSKVRNELKVFVCEGKKMFEEVASQQR
FT                   NQIKKVYLAESYYHQYTKQNPEYLKGLDFEVLSDQVMKEASETITPQGILAIVKQPIYT
FT                   LKDMTSGDSIRLLLLEDIRDPGNLGTMVRTAEGVGMTGIVLSKDSVDMFNPKVIRSTMG
FT                   AIFRVPFFYAEDFYACLNQIKNEEIAIYAAHLQGAVWYDKVSYQGKSAILIGNEANGLS
FT                   DKATSLSTQRIKIPMEGNVESLNAAIAAAVLMYESYRQIRNH"
FT   gene            530556..532223
FT                   /locus_tag="Cphy_0418"
FT   CDS_pept        530556..532223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB_0232136 villin"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40805"
FT                   /db_xref="GOA:A9KHD8"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHD8"
FT                   /protein_id="ABX40805.1"
FT                   /translation="MKCCLLYGYARLIRASESMATTNTNWMKNMKMRFETSYQLKIGVN
FT                   NVDIFVDKHVNRSKFCGILLSTWENLSGQTITLCLAIGTFAGISGLVYNCGTGRVLFTF
FT                   FVGAWTAIIVNIVDNVVNIPAHRQLLRLNLKDYFENYLKTRMEQEHLNAEIRKQTRREY
FT                   LYEITNSVASQTAATLQDPELAKRLEDAKREVEEALLVTPVKVVNPRPVVVKQALSKSA
FT                   PLKVEKEFENKIDKKEDKIDKKEQKNQLKLLKTMEMEREKELREEKKRLEALSKESTKE
FT                   KKKEDKKIAKLDKKNEKLALKESFKQEKFQKKEELEQAKLQAFHEERQEKLAKKEEKKQ
FT                   VKQGKKQSKIDASIAKKEQKEKEKDLEKQALMAKQQEREEKKQAILERKATIKQEKIDK
FT                   KEENRLAKLKAKEDAKISKYVHKQQKLQEKIAKASNPNVNMMEKEEKSNGSKVSQKAYM
FT                   EKMRLKEEKQRSQVRLEEERRIKALNSEKNANLPETNLYEAAQDIIDELVKQKKEDSIN
FT                   LKQAMENESEMKQEANECLATSKEDDELIEEVLREFFM"
FT   gene            532429..533778
FT                   /locus_tag="Cphy_0419"
FT   CDS_pept        532429..533778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0419"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   gka:GK2924 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40806"
FT                   /db_xref="GOA:A9KHD9"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KHD9"
FT                   /protein_id="ABX40806.1"
FT                   /translation="MAKVNFDYSIAKQFFSKEELSYMKGAAEAAKQILLEKTGAGNDFL
FT                   GWIDLPVDYDKEEFERIITSAKKIQSDSEVLLVIGIGGSYLGARAAIEFLRHSFYNSVS
FT                   KEVRKTPEIYYVGNNISSTYLSHLIEVIGDRDFSVNIISKSGTTTEPAIAFRIFKKLLI
FT                   QKYGKVEAAKRIYATTDKSKGALKNLATEEGYESFVVPDDVGGRFSVLTAVGLLPIAVS
FT                   GADIKQLMDGAASMRERCLNNKFEENDSLLYASIRNILLRKGKNIEILANYEPALHYVG
FT                   EWWKQLYGESEGKDKKGIFPASVDLTTDLHSMGQFIQDGQRTMFETVINLEKSTCEVIL
FT                   EEEDVDLDGLNYLAGKSVDFINKSAMKGTLLAHTDGDVPNLIVNIAEQSEFCLGELFYF
FT                   FEFACGVSGYILGVNPFDQPGVESYKKNMFALLGKPGFEELSKKLQERLQ"
FT   gene            534111..535304
FT                   /locus_tag="Cphy_0420"
FT   CDS_pept        534111..535304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0420"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: amt:Amet_4656 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40807"
FT                   /db_xref="GOA:A9KHE0"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHE0"
FT                   /protein_id="ABX40807.1"
FT                   /translation="MEGFDFSKEYGIVLEGGGAKGAYQIGVWKAMRELGIKIKGISGVS
FT                   VGALNGALICMGDFDKAIKLWESITYDRVMEVDNEQMEHLIKRELKQLKLVDLTKTGMR
FT                   VLASRGFKVAPLKSMIEEVVDENKIRESNIEFYLGTFCISDMKQLEICAAEAEPEKLKD
FT                   YLLASAYFPAFKNEKLHGLSYVDGGVMNNVPIDTLIKNGYKDIIVVRIYGIGVEKRVKI
FT                   PEDVRVTTVAPRVDLGSILEFDGKKTQRNITIGYFDAMRVFKFLKGKIYYVDAMLNERD
FT                   CLELFLECHPSVTMAYHEYYKLDYSNEALYTRDMLETILPLIAEELKLAKDWSYFDLYL
FT                   ALLELCAKYMHVQKYYIYTEQELVNKIKIKYELRKKRHDSKEIPPFVQLALGFITIQ"
FT   gene            535450..536388
FT                   /locus_tag="Cphy_0421"
FT   CDS_pept        535450..536388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0421"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: bld:BLi04164 ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40808"
FT                   /db_xref="GOA:A9KHE1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHE1"
FT                   /protein_id="ABX40808.1"
FT                   /translation="MNLKGRSFLTLKDFTPEEITYLLELAATLKEKKKQGITGNSLKGK
FT                   NIALIFEKPSTRTRCAFTIGCIDEGGHPEYLGKDDIQLGHKESVEDTARVLGRMFDGIE
FT                   YRGFSQETVEKLAKYSKVPVWNGLTDEYHPTQILADFLTLKEQFKTLKGLKLVFVGDGR
FT                   NNMANSLMIGSSKMGIHFTILAPKSLWPKDELVSLCLSYAKDSGSKITITEDLEAVSGA
FT                   DAIYTDVWCSMGEEDKAAERVALLKPYQVNEELIKKSGKESTVFLHCLPAVKGNEVTEE
FT                   VFEKFADVVFDESENRMHTIKAVMVATLGEE"
FT   gene            536737..537597
FT                   /locus_tag="Cphy_0422"
FT   CDS_pept        536737..537597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_3902 heavy metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40809"
FT                   /db_xref="GOA:A9KHE2"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHE2"
FT                   /protein_id="ABX40809.1"
FT                   /translation="MKKNHSSYIWGGLLVLFGVLLAARAVDIFTFDIFFDGWWTLFLII
FT                   PCFISLFNHGGDKTANLIGLSIGIFMLLSAQGFITWRMFGPLCFAAILVFIGLNMIMPK
FT                   KHRDQDYSSQNYKTYQGSGSTDQTYDRTYTYEQNFDGTENGQQSGNYGSTQNTGGSNDA
FT                   NSGYQNTYQGARQSGQFACTAVLSGRELRFDNEVFQGAMLSALLGGIELDLRNAIIREN
FT                   VVIECKTILGGIDIYVPSYVRVVVNCNPILGGVDNKTITPLGANEQTITIYLNATCVLG
FT                   GIDVK"
FT   sig_peptide     536737..536814
FT                   /locus_tag="Cphy_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.852 at
FT                   residue 26"
FT   gene            537817..538140
FT                   /locus_tag="Cphy_0423"
FT   CDS_pept        537817..538140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40810"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHE3"
FT                   /protein_id="ABX40810.1"
FT                   /translation="MENVILCVSSSYDRKYYLDDKFAGLPEQIKDELKIMCVLYTEDVG
FT                   GILTLEFEEDGTLTFQVTNDERDFLFDEIGSVLKVKQLQHTKRELLESLETYYKVFFLH
FT                   EEI"
FT   gene            538204..538971
FT                   /locus_tag="Cphy_0424"
FT   CDS_pept        538204..538971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0424"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: cth:Cthe_2588 putative
FT                   transcriptional acitvator, Baf family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40811"
FT                   /db_xref="GOA:A9KHE4"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KHE4"
FT                   /protein_id="ABX40811.1"
FT                   /translation="MLLVIDVGNTNITLGVFDEDKIVGTYRITTTIPRTSDEFGLLFCD
FT                   LLHVKGIERTSIDSVIIASVVPAIMYSLTSAIIKYLGITPLIVGAGTKTGIKVLTANAK
FT                   EVGADRIVDLVAAYEEYGGPVFVIDFGTATTYDLVTEDGKFTAGITSPGIRISANALWN
FT                   DTAKLPEIEILKPDSILAKDTVSSMQAGLVYGNIGATEYIIKKVKEESKLGSLKVVATG
FT                   GLGKIIADATDMIDIYDPNLTLKGLRYIYQKNR"
FT   gene            539001..539975
FT                   /locus_tag="Cphy_0425"
FT   CDS_pept        539001..539975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0425"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: tte:TTE0344 predicted
FT                   TIM-barrel enzyme, possibly dehydrogenase, nifR3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40812"
FT                   /db_xref="GOA:A9KHE5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHE5"
FT                   /protein_id="ABX40812.1"
FT                   /translation="MSFTIGNVNINGNLVLGPMAGVTDLPFRLLCKEQGADLIYTEMVS
FT                   AKGIYYNNKNTEVLLEVEEKERPVALQLFGEDPYIMSEMAKRIEHRNFDFLDINMGCPV
FT                   PKVVNNGEGSALMLKPERIGEIVSAISKAIKKPVTVKIRKGFTKDNINAVEVAKVIEQS
FT                   GGAAIAVHGRTREQYYSGEADWDIIKAVKEAVSIPVIGNGDVQTPEDVKRMMSYTGCDA
FT                   VMIARGVRGNPWFFSQAKHYLNTGEILAKPSVPEVIEMILRHGRLAIEVKGEFTAMHEM
FT                   RKHVAWYTMGYPKSAKLRNQVNEIETYEDLIVLMKKYEEMLDL"
FT   gene            540343..541431
FT                   /locus_tag="Cphy_0426"
FT   CDS_pept        540343..541431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0426"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: lsl:LSL_0313 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase NAD -
FT                   binding; Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40813"
FT                   /db_xref="GOA:A9KHE6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHE6"
FT                   /protein_id="ABX40813.1"
FT                   /translation="MSKLRVGILGATGMVGQRFISLLENHPWFEVTTLAASPRSAGKTY
FT                   EEAVGNRWKMVTPMPEAMKSLIVKNVNEVEAVASEVDFVFSAVDMTKDEIKAIEEAYAK
FT                   TETPVVSNNSAHRWTPDVPMVIPEVNPEHFEVIASQRKRLGTKRGFIAVKPNCSIQSYT
FT                   PALNALKEYGPKVVVATTYQAISGAGKNFADWPEMVDNVIPFIGGEEEKSEQEPLRIWG
FT                   KVLDGEIVKADAPLITTQCIRVPVTDGHTAAVFVSFEKKPEKEEIIRAWNEYKGLPQEL
FT                   NLPSAPKQFIKYFEEDNRPQAALDRDYENGMGICLGRLREDTVYDYKFVGLSHNTVRGA
FT                   AGGAVLNAELLKALGYIEAKEN"
FT   gene            complement(541638..542369)
FT                   /locus_tag="Cphy_0427"
FT   CDS_pept        complement(541638..542369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40814"
FT                   /db_xref="GOA:A9KHE7"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHE7"
FT                   /protein_id="ABX40814.1"
FT                   /translation="MATKETRLDDNAEIYKKREKMTERQKIGEMNTAEKWDYFKQYYFK
FT                   KLLATLIIIGFVSYLLYEVLSPKPDTVLSVAMVNYPLDEETLTLLENELNELLDVNPET
FT                   QKILIDTTYDLNNNDYASAEKLSVYSFSGELDLFIAPESQFEKYAFSNSLTPLTDALPT
FT                   DVYSALSDRLFGCRTRLNDEELPSEAQGPVGVYGIYAEDLPMFKAYKGYMQDPPVIGII
FT                   VTSKHSENAVATIRHLYGLDK"
FT   gene            complement(542541..544196)
FT                   /locus_tag="Cphy_0428"
FT   CDS_pept        complement(542541..544196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40815"
FT                   /db_xref="GOA:A9KHE8"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHE8"
FT                   /protein_id="ABX40815.1"
FT                   /translation="MSDLDESKVTNETPGNSIERPEFETVNTEETNIVEEPTTNFLGGN
FT                   TPNKPKKNNRTAGIIALVAGIAACIVIAIFAVPRIIEAVSRSSSSPKERFESAIENYLL
FT                   DEAKSYEKTLSNKVSTDLKNSTISVDFNVTVNNMLTSMIKQTDPDLFADLKLDNIGGNF
FT                   VIKNKEDKHNVDATLSANNTKLFNVESYFEKAADTLLFRIPELSSDYLSTPLNLSALES
FT                   DTSLPQFNIESYKTPDAKEVTSLLTDSAKILTKDINDVSVVKDVKIVASDVSATYDKLT
FT                   AKISEQDAKNILVKLMKRVYDVESYKNLLDSALLNSDSVNTFDEFISILETAEASNNTV
FT                   AEFSIFVDKKNELHGCGISMSADGSNMVLSFLTAKGSKNGIELNVAVNDQNLMSLTSNY
FT                   TKSSNGYQGFVKLFVNELDSTSSIANSDVSLTIDFENVKVVDEKNGHFTGSFYLTSPQL
FT                   SGTSIELTFGVTGKKQDVTFNVSAASMSLFSLTASYQVTEGAEIVIPAAGANVYDTETE
FT                   MNDYMSNAFMGLLELVGTVGDAIGVDLTSMMYGM"
FT   gene            complement(544531..545874)
FT                   /locus_tag="Cphy_0429"
FT   CDS_pept        complement(544531..545874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0429"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: sth:STH226 uracil
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40816"
FT                   /db_xref="GOA:A9KHE9"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHE9"
FT                   /protein_id="ABX40816.1"
FT                   /translation="MTKEQNTIGTVGIYDARALGLPKMILLGLQHAFAMFGATVLVPLL
FT                   TGLNVSTTLLMAGLGTLLFHILTKGKVPAFLGSSFAFIGGYLAVAPFIETEVNGQIIRT
FT                   PNTELLPYACGGVVIAGLVYVVLAALIKVFGVNKIMRFFPPVVTGPIIISIGLILAPTA
FT                   IANCQQNWLLAFVALAVIIICNIYGKGMVKIVPIMLGIIVSYIVALITGAVDFTAVTSA
FT                   NWIGNPVPLSGFAKFSVSSIISIVPISLATMMEHIGDISAISATTGKNYMTNPGLHRTL
FT                   LGDGLATSMSAIFGGPANTTYGENTGVLALTKVYDPKVMQIAACFAVFLSFFPKFSAII
FT                   NTLPVAIIGGVSLILYGMISSVGIRNVVENRVDFTQSRNLIIAAIILGCALGFTGINGL
FT                   TFMVGSYEITLSGLAVAAIAGIVLNAILPGNDYVFSTEEKHDELTFKL"
FT   gene            547250..549745
FT                   /locus_tag="Cphy_0430"
FT   CDS_pept        547250..549745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0430"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: putative carbohydrate binding;
FT                   glycosyltransferase 36; glycosyltransferase 36 associated;
FT                   KEGG: cth:Cthe_0275 glycosyltransferase 36"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40817"
FT                   /db_xref="GOA:A9KHF0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037825"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHF0"
FT                   /protein_id="ABX40817.1"
FT                   /translation="MKFGFFDDLNKEYVITTPETPYPWINYLGSQAFFSLISNTAGGYS
FT                   FYKDAKLRRITRFRYNNVPLDLGGGRYYYLYDNGDFWSPGFAPAKKELEYYECRHGMGY
FT                   TKITGRRNGIETKITFFVPLDYNGEVHKVSIVNTSNQVKNVKLFSFLEWCLWNAQEDST
FT                   NFQRNFSTGEVEVKGSVIYHKTEYKERRDHYAFFSVNAPISGFDSDRESFLGTYHGFDN
FT                   PQVVARGESNNSVADGWSPIASHCVEISLQPKESKELVFILGYAENKLEEKWEYQVGEV
FT                   DTDGLLLSSVAPNGTNVINKKKAEEMIAKYATVKAVDQALLELKDYWDKLLSKYNVKSH
FT                   DDKLNRMVNIWNQYQCMVTFNLSRSASYFESGIGRGMGFRDSNQDLLGFVHQIPDRARE
FT                   RIIDLASTQLPDGGAYHQYQPLTKKGNDEIGGNFNDDPLWLILAVTAYIKETGDYDILE
FT                   VNTPYDNKLELAKPLSDHLKRAFNHVIENLGPHGLPLIGRADWNDCLNLNCFSMDPGES
FT                   FQTVTSKDGKVAESVMIAGMFTYIGEEYAILMDKVGNNEESIRAMKEVENMRDVIMKHG
FT                   YDGSWFLRAYDDFGRKIGSDECEEGKIFIESQGFCVMGKCGLNDGKAQKALDSVEKRLG
FT                   TKFGLVLNNPAFTRYYVEYGEISTYPAGYKENAGIFCHNNAWIMCAEAVIGRGDKAFDY
FT                   YTKIAPAYTEEYSEIHRLEPYVYAQMVAGKDARRFGEAKNSWLTGTASWNFVAISQYIL
FT                   GIKPEYDGLMIDPAIPTDWEVYQITREFRGDRYDITIVNPYHVSKGVKKLVVDAKEVEG
FT                   NIIPVFGDGLEHKVKVILG"
FT   gene            550144..551712
FT                   /locus_tag="Cphy_0431"
FT   CDS_pept        550144..551712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0431"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: fnu:FN1359 dipeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40818"
FT                   /db_xref="GOA:A9KHF1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHF1"
FT                   /protein_id="ABX40818.1"
FT                   /translation="MKRRKQLFFLGLLLSCMIALCACSGSTENKGNDQKEAENGEASKN
FT                   GGSVIVGITNDLDSLDPHKAVAAGTKEVLFNIFEGLVKPDKDGNLVPAVASDYKISEDG
FT                   MTYTFYLREGVKFHNGALVTVDDVIYSLKRATGLLETSDPEVRVESVFSCVESINAITT
FT                   EDGKQAVEVKLNQPNIELLSYFTISIIPKDYTEQATKPVGTGPFRFVSYSPLVSIVMEK
FT                   NPDYYVKGVPYLDEVTFKISANTDAAFMELRAGTIDIFQQLTYEQSNQLKDLYNIEIGH
FT                   MNLVQALFLNHKAAPFDNLKVRQALSYAIDRQMILDIVAGGNGTIIGSNMFPGFGKYYD
FT                   ESLASYYTYDVEKAKQLLNEAGYPEGFHFTITVPSNYQAHVDTAQVIVEQLKKVGITAE
FT                   IKLVEWASWISDVYQGRNYESTIIGLDSNLSPSDIVKRYESTSKNNFLNYSNSQFDSLY
FT                   PKAYASVKEEEKVDLYHQLQRILTEDVASVYLQDPANLVAVNKKLAGYQFYPVYVQDMS
FT                   TVYYK"
FT   sig_peptide     550144..550218
FT                   /locus_tag="Cphy_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.488 at
FT                   residue 25"
FT   gene            551801..552742
FT                   /locus_tag="Cphy_0432"
FT   CDS_pept        551801..552742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0432"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:RL0227 putative
FT                   transmembrane component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40819"
FT                   /db_xref="GOA:A9KHF2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHF2"
FT                   /protein_id="ABX40819.1"
FT                   /translation="MKFYIKKLITLIITLVFVSFITFFAFQVIPGDSAIAKLGMDATEE
FT                   QLQELRESMGLNDPMFVRYGRFLKSTVTGDFGTSTQYNVSVASLVADRLPVTAWLAVLS
FT                   VLFMVVISLPLGLICARKEDGFIDRFITFLSQTFMAVPPFFLGILISLLFGIILKWFVP
FT                   GRFVPVSQNFGAFISYMVFPALAVSIPKVAMLTKFLKTSLLRELSYDYVRTARSKGLKK
FT                   KQIMTKHVLKNALIPVITFFGMLTADALAGSIVVEQVFNLPGMGRMLVSAIANRDFSVV
FT                   SAAVLYIAGIVIIINFIVDMTYQKVDPRVRIS"
FT   sig_peptide     551801..551884
FT                   /locus_tag="Cphy_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.788 at
FT                   residue 28"
FT   gene            552764..553552
FT                   /locus_tag="Cphy_0433"
FT   CDS_pept        552764..553552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0433"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB3067 oligopeptide ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40820"
FT                   /db_xref="GOA:A9KHF3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHF3"
FT                   /protein_id="ABX40820.1"
FT                   /translation="MRKQKNRFNFIVGLSLVSFALLLVIVGIFYTPYDPNEMNVLAKNQ
FT                   APSLFHLFGTDYMGRDVLSRVMDGAFTTFFVGIATVIIGATVGSILGAVTGYFGGVVDE
FT                   ILMRINDAVASFPSILLALVFVSIFGTGKYNVILALGILFIPSFARVVRSEFIIQKEMD
FT                   YVKSARLLGASHIRIIFLHIFPNTKAILRSAITIGFNNAILAEAGMSYLSLGVRPPDAS
FT                   LGRMLSESQTYLFGAPWMALAPGLMIVITVLGFSLLNEGV"
FT   sig_peptide     552764..552835
FT                   /locus_tag="Cphy_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.833) with cleavage site probability 0.269 at
FT                   residue 24"
FT   gene            553633..555201
FT                   /locus_tag="Cphy_0434"
FT   CDS_pept        553633..555201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0434"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: chu:CHU_0463 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40821"
FT                   /db_xref="GOA:A9KHF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHF4"
FT                   /protein_id="ABX40821.1"
FT                   /translation="MNSKTDLLLVQDLSISFGEKKKKEVVHNITFSINKGEILGVVGES
FT                   GSGKSVTAHSVLRLLAEGGKISNGSIWFDGVDLTKLPEEEMVKIRGDEISMVFQEPMTS
FT                   LNPVLTVGVQIEEMLLLHTKKSSEERKASVYEMMDEVGLQNPESLYSKYPHQLSGGMRQ
FT                   RIMIAMAMICKPRLLIADEPTTALDVTIQAKILELLKELNRKHGTTILFISHDLTVVRN
FT                   LCDRLLVMYDGRIVESGISGELFQNPKEEYTKKLLAAAEIVHDSSLAMDSKDSSVTNRI
FT                   LEVKDLKVYYTENAKKLFQKKQRKEVVKGISLEVMQGESVGIVGESGCGKSTLAKAITN
FT                   LVNDMEGRIILREEKPQMVFQDPYGSLNPCKRIGWLLEEPLKLQKVLSKQEREQRVEEI
FT                   LQKVNLPIEYKNRYPRDLSGGQRQRVAIARAMILHPKFVVLDEPVSALDVTVQAQVLTL
FT                   LKNLKQEFQLSYLFISHDMGVIHSMCDRVCVMYQGEIVESGKTEEVFQNPTHEYTKKLL
FT                   SSVPK"
FT   gene            555303..555656
FT                   /locus_tag="Cphy_0435"
FT   CDS_pept        555303..555656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_2981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40822"
FT                   /db_xref="GOA:A9KHF5"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHF5"
FT                   /protein_id="ABX40822.1"
FT                   /translation="MILLERMKYMNCHDNNNNSNNGKKNEKGHKRHLSHIFMMLICCGA
FT                   PIILLMLIPLLKRVGIGAGANGILSLLASLACPLMMMVMIPMMMKGLKNKEDNHNSISS
FT                   ASTEQMEIGQMKE"
FT   gene            555968..557662
FT                   /locus_tag="Cphy_0436"
FT   CDS_pept        555968..557662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0436"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: mba:Mbar_A0989
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40823"
FT                   /db_xref="GOA:A9KHF6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHF6"
FT                   /protein_id="ABX40823.1"
FT                   /translation="MFNTIRKKLIAGFSLILIIIIASTVYNMYIYNNSRTHIISIRENA
FT                   VTSYKYASEMKNNVIQVGQFLTDVSASKDTAQLKEAEEQYNSYKSNSEELASLNPEYTD
FT                   QLNALNIEVDKFYTIGKEMADTYVKSGHEVGNIMMVDFDKAADKIYAEVDEIQKKSEAA
FT                   MDDSLMTIQMHMDMNQNISTVLAIITIIIALLTAILLAGSITKPINNLLEIFKDLERGQ
FT                   GDLTSRINIKSKDELSRLARSFNTFMDSLESMMINIKKNSVRVSQGSELLSEGGMQTSS
FT                   GVVTINTHMEKMVKDTQIINTSINQITDSIYEMTQASQDSANDAQRISVEVDRVNMLAQ
FT                   ESGKLALDTKLEMENTEKISSYTIDIAEKLGNEAEEIGKIIGTIKSITDQTNMLALNAA
FT                   IEAARAGEHGRGFSVVAEEIRNLAESNSQSAKTIEDIVKNIQDMIQKTMAATMDVGGDI
FT                   KRSSTMVENVYTQLNHIIDGVKNINNRIQNIAAITEEQSASTEELSATMESINDSNTAI
FT                   TSAMQEVAASISTQTDTITGLSTTASDLNESAKQLNELVSKFKFRES"
FT   sig_peptide     555968..556051
FT                   /locus_tag="Cphy_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.623 at
FT                   residue 28"
FT   gene            557869..558348
FT                   /locus_tag="Cphy_0437"
FT   CDS_pept        557869..558348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0437"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: cbf:CLI_2623
FT                   transcriptional regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40824"
FT                   /db_xref="GOA:A9KHF7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHF7"
FT                   /protein_id="ABX40824.1"
FT                   /translation="MDIDKKLYLKQTVGGEFMNTGKKYNTKQKESILECIKKNSEEYIT
FT                   IQKIYDDLIKKGQKVGLTTIYRNLDKLEADKEIVAINIEGYNGTCYKYLSDKKDNILFY
FT                   IKCEECGNLIHIKCPELSSLYVHLQEEHHIQINPVKTMFYGRCESCLIGYCGDKS"
FT   gene            558894..559904
FT                   /locus_tag="Cphy_0438"
FT   CDS_pept        558894..559904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0438"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   lmf:LMOf2365_0168 zinc ABC transporter, zinc-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40825"
FT                   /db_xref="GOA:A9KHF8"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHF8"
FT                   /protein_id="ABX40825.1"
FT                   /translation="MKKWNKAWYLLFFFILSVVSLTACNMKNKKEASGTLSIVCTSFPQ
FT                   YDFVKQIIGENPAGIEVTYLLKNGIDLHNYQASAEDMVKIRSSNLFLYIGGESEKWANE
FT                   VVKQVESTDFHALALINVVQAKEEEIVEGMETEHLEGEDHEGEVQEGVEHKEEYEYDEH
FT                   VWLSLKNAEVIVNEICEELSNIDSSNSEYYKNNAASYIQELKELDEQFYNFTKKTARDT
FT                   ILVADRFPFRYFVDDYNLRYYAAFVGCSAETEASFETIAFLAKKVEELGLPVVLIIDGS
FT                   DGSIAKTVIENSKQENASVRTLNSMQSVSMENIASGASYLSIMKENLQILKEALD"
FT   sig_peptide     558894..558965
FT                   /locus_tag="Cphy_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.760 at
FT                   residue 24"
FT   gene            559906..560619
FT                   /locus_tag="Cphy_0439"
FT   CDS_pept        559906..560619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0439"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sun:SUN_1062 Mn2+/Zn2+ ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40826"
FT                   /db_xref="GOA:A9KHF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHF9"
FT                   /protein_id="ABX40826.1"
FT                   /translation="MALISCSDTVLAYDEKVVVSNLNFHVREGEYLCIVGENGSGKSTL
FT                   IKTILGLKTVSSGTITYGDGIRANEIGYLPQQTEIQKDFPALVKEVVLSGGLNGCGLRP
FT                   FYNKYEKSKARRNMELLNIENLENKCYRELSGGQKQRVLLARALCASKKLLLLDEPVTG
FT                   LDPNATKDMYDLIEKLNKENHVTVLMVSHDISAAVKYATHILHIGNTPLFYGSKGEYLE
FT                   SEIGRIYTGKAGTLL"
FT   gene            560616..561461
FT                   /locus_tag="Cphy_0440"
FT   CDS_pept        560616..561461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0440"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; inner-membrane translocator;
FT                   KEGG: gur:Gura_0048 ABC-3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40827"
FT                   /db_xref="GOA:A9KHG0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHG0"
FT                   /protein_id="ABX40827.1"
FT                   /translation="MMEKLVYYFEFPFVRYALLVGVLISLCTSLLGVPLVLKRYSMIGD
FT                   GLSHVAFGATAIAAIFHITTNVYITLPITVICAVLLIRNGENKRIKGDASIAMLSVGAL
FT                   AIGYLFLNIFSTSTNLSGDVCSTLFGSTSILTLSKTDVVLSMVLSVVVLLVFTIFYNKI
FT                   FVITFDESFSKATGVKTGVYNLMLAIITAIVIVLAMNLVGALLISALIIFPATSSMKVF
FT                   KSFRTVILSSAIIAVLCATLGILTSILLGTPVGSTIVAANIIVFVCIEIMTRSFKIIKG
FT                   "
FT   gene            561500..562153
FT                   /locus_tag="Cphy_0441"
FT   CDS_pept        561500..562153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40828"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHG1"
FT                   /protein_id="ABX40828.1"
FT                   /translation="MKRSLIITLVALMCLTFSGCGNGNSKVFDVLDENTRDKGPQNNSD
FT                   SKEKEESQQAEEGAQVPEGNYGSMIDLAEEYLNNESFPEENSDVTSDLEFDTDKKDLSV
FT                   DVDLTQMSSIMIYSEVYNMMTNPEAYIGKTIKIRGPYYTSYWEDTGKYYHFVIISDATA
FT                   CCSSGLEFIWEENSHKYPDEYPEDETEIELVGRFDSYEELGQTYYFLATDSLDY"
FT   sig_peptide     561500..561571
FT                   /locus_tag="Cphy_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.536 at
FT                   residue 24"
FT   gene            562582..564438
FT                   /locus_tag="Cphy_0442"
FT   CDS_pept        562582..564438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0442"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: tte:TTE0836
FT                   ABC-type multidrug/protein/lipid transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40829"
FT                   /db_xref="GOA:A9KHG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHG2"
FT                   /protein_id="ABX40829.1"
FT                   /translation="MIGKYIKRYKWSYLLGIITLFAVDLLGLLIPEYTGKITDGLKDKT
FT                   MDFQGVLYMIGLILAVGGLMALGRFLWRIFIFGGARKIEYALRNDMFEHLTTLSTRYFN
FT                   ENKTGDFMAHFTSDLSAIRMALGPAVVTTFDAIIMTIMVVVKMVFYVDLRLTLLACIPM
FT                   TFIMIGGIYFGSKVEKRFTKKQEAFSNMTDEVQESISGVRVVKAFVQEEKEIVSFSKTN
FT                   LKNKKANLQVVKLQATVLPLLDLLIGLSSVITLLFGGKLVLDGVITAGKFVAFISYIGM
FT                   LVWPMIAAGESINLLSQGFASIKRVRTIFMEQPEIVDGPECDNKVTKLLGEIALNHLTF
FT                   SYKEGNTPVLQDISVKIPKGNTLAILGRTGSGKTTIANLLLRLYDVEDGMITFDRNSIR
FT                   KIPLHVLREQIAYVPQDNFLFSDTIQTNIAFGVRKLRDIEEEEEKMKLFPSKKERMEAH
FT                   LESDFMKTESKADGIYQDLDMVQEAAKTACIHDNIMDFPKQYSTMVGERGVTVSGGQKQ
FT                   RSSIARALMKDAPILILDDALSAVDTNTEEQILRNLKENRKDKTTIIIAHRISTIQNAD
FT                   NILVLEEGRVAEYGNHENLLAEQGIYAKLYEKQQLEKQLERE"
FT   gene            564450..566216
FT                   /locus_tag="Cphy_0443"
FT   CDS_pept        564450..566216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0443"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: tte:TTE0835
FT                   ABC-type multidrug/protein/lipid transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40830"
FT                   /db_xref="GOA:A9KHG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHG3"
FT                   /protein_id="ABX40830.1"
FT                   /translation="MSRKEIEYEKSIHGSVFLRLMKYATPYFPMMILAFILVLALTGLE
FT                   LLRPALIGRVVDLFKVDGTLDEIKFIAVIYGAALVLSFVFNILQTWILQLTGQNIIYNI
FT                   RQELFEHIHKLSLRFFDITPVGKIVTRVTNDVEALHEMYANILVKLLKNIVKIIGLAIV
FT                   MLFMNVRIALFGFSLLPLIIGLTWIFKRTSRLTYRITRTKITAINTYLSEHLSGMKLIQ
FT                   IFAREKEKNAEFGQKSKGLYRANYREMMVFAIFRPLMYILSIIALVIIVAVGGDSVLKG
FT                   TVTVGTLITFIQYISLFFEPIQELAEQFGTLQSAMASAEKIFTILDEPIIVKNPENPTL
FT                   VEEIKGRIEFEHVWFAYEGENWILKDVSFVIEPGQSVAFVGATGAGKSSILNLIGRYYD
FT                   IQQGRILVDGIDIKELKTEDLRKAIGQVQQDVFIFTGDVMSNIRLKSDTITEEEAIKAA
FT                   KYVNADHFIENLNNTYYEAVTERGATFSAGQRQLLSFARTLAYNPSILVMDEATANIDT
FT                   ETEQLIQEALEKLMQGRTTIMVAHRLSTIQHANKIIVMHKGELREMGTHQELLENNGIY
FT                   KKLYELQLAGEH"
FT   gene            566471..567052
FT                   /locus_tag="Cphy_0444"
FT   CDS_pept        566471..567052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0444"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cbe:Cbei_1948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40831"
FT                   /db_xref="GOA:A9KHG4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHG4"
FT                   /protein_id="ABX40831.1"
FT                   /translation="MLQHRILNEEEISKVYEEHLIKDFPPEELKPLSLLLSLKKQGIYC
FT                   CYGLYDNEEFVAYAFFAKPETIDYLLLDYLAVCKNHRSKQYGSKFLKLLQKELKEYQGI
FT                   LFEVESGADAKNEKEKQICERRIAFYLRNGLTKTKINVKLFGVDMILLYLEIQGTPSEK
FT                   ILSESLNHIYDLVFGEETHRREIFCKIVEE"
FT   gene            567284..568786
FT                   /locus_tag="Cphy_0445"
FT   CDS_pept        567284..568786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0445"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG: cth:Cthe_0779
FT                   copper amine oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40832"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR029410"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHG5"
FT                   /protein_id="ABX40832.1"
FT                   /translation="MSKKLLLISVLALFLTACGNTKETSKEISDALQSKDAEIINNLDE
FT                   TNQQVTNSPENQNINESDNDKLTQNLPGENQDVPSIQNQQDGSEGNLSDKVTTYDNSQT
FT                   DNSTNSRTDNPQNKDSSTGNTGDQSPSIGNDSSNKDDNEASTVPTGVPKTPEVTSTPTK
FT                   APDIVPIHTPVPTRTPIITPTRIPTPTKTPQPTKVPTVTVAPTKVPVATPSPTKVPAPT
FT                   KTPTVTPPSNVSGADSISVRGKTISIGDSKSDVVSAFGSPNRTDDTEYNYDFMVYNDNY
FT                   KKFMMIAIADSKVVGWYTDSTDFSYQGLSTSSKVSSINSVFGKSSSLSDTISISDSGNK
FT                   ITFFMDSIGDGTIDGISVFDNSVSKGSTSKTVLKAWEKEILDLTNSFRARNGLSALSWS
FT                   DAAGTSARLHSEDMAKNNYFNHTGLDGSSPGDRMKAQGISYRSNGENIIGGYGNALFSS
FT                   NGWMNSSGHRSNMLNKGFTYLGVGYALGGSYGNYATQNFYSN"
FT   sig_peptide     567284..567343
FT                   /locus_tag="Cphy_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.773 at
FT                   residue 20"
FT   gene            569177..570013
FT                   /locus_tag="Cphy_0446"
FT   CDS_pept        569177..570013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0446"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   cbf:CLI_2342 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40833"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHG6"
FT                   /protein_id="ABX40833.1"
FT                   /translation="MKITALIENISKGGLLNEHGLCVHIAYEGKNYLLDTGASDLFIKN
FT                   AEALNINLEEVDAGILSHAHRDHSGGYEAFFKYNQKAKVYLRKESREQYYIKKLCIKKY
FT                   IGIPDDILIKYPKRFTYVTGDYRIDKGVSLIAHKTNDMEKRGKAMNMFRKVDGHFQLDD
FT                   FSHEQSLVFEAEKGLVILNSCSHGGIENIIKEVKESYPNREILAVIGGFHLMGLLGTST
FT                   MRLSEGEVRKLGKDLLDSGVKNIYTCHCTGNKAFALLKEELGDRLHYFQTGDCLEF"
FT   gene            570388..570882
FT                   /locus_tag="Cphy_0447"
FT   CDS_pept        570388..570882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0447"
FT                   /product="translation initiation factor IF-3"
FT                   /note="TIGRFAM: translation initiation factor IF-3; PFAM:
FT                   initiation factor 3; KEGG: lsl:LSL_0495 bacterial protein
FT                   translation initiation factor 3 (IF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40834"
FT                   /db_xref="GOA:A9KHG7"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHG7"
FT                   /protein_id="ABX40834.1"
FT                   /translation="MINEQIRDREVRLVGEDGEQLGVMSAKDALKMAQDANLDLVKIAP
FT                   TAKPPVCKIVDYGKYRYELARKEKEAKKKQKVTDVKEIRLTPNIDDNDLNTKANQARKF
FT                   ITKGDKVKVSLRFRGREMAHINSSKQILDSFFEKLQDVAVVEKPAKMEGRSIFMFLTEK
FT                   R"
FT   gene            570973..571170
FT                   /locus_tag="Cphy_0448"
FT   CDS_pept        570973..571170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0448"
FT                   /product="ribosomal protein L35"
FT                   /note="PFAM: ribosomal protein L35; KEGG: cbf:CLI_3194
FT                   ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40835"
FT                   /db_xref="GOA:A9KHG8"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KHG8"
FT                   /protein_id="ABX40835.1"
FT                   /translation="MPKLKTSKAAAKRFKVTGTGKLKRMKAGKQHILTKKSQKTKRNLR
FT                   KATMMDPSNEKNMKKILPYL"
FT   gene            571198..571554
FT                   /locus_tag="Cphy_0449"
FT   CDS_pept        571198..571554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0449"
FT                   /product="ribosomal protein L20"
FT                   /note="TIGRFAM: ribosomal protein L20; KEGG: cdf:CD0687 50S
FT                   ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40836"
FT                   /db_xref="GOA:A9KHG9"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KHG9"
FT                   /protein_id="ABX40836.1"
FT                   /translation="MARIKGGLNAKKKHNKVLKLAKGYRGARSKQYRVAKQSVMRALTS
FT                   AFAGRKERKRQFRQLWIARINAAARMNGLSYSKFMYGLKLAEVSVNRKMLAELAVNDAE
FT                   GFKALVEVAKSKLA"
FT   gene            571881..574442
FT                   /locus_tag="Cphy_0450"
FT   CDS_pept        571881..574442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40837"
FT                   /db_xref="GOA:A9KHH0"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHH0"
FT                   /protein_id="ABX40837.1"
FT                   /translation="MYCQHCGKFTENVDGVCESCRDTLEVTKELVEESRDLTENTQDSK
FT                   AILGENQNGEKTLEGKITSNRESFLETKEFILEEKTDENGLEQKGEKDDTGGLKKELPP
FT                   RLKKIQKIGTDKWNDFIENTGKEMITVSTIKESTFFLVLTLCVSMLLSVVIMLIANTIF
FT                   KNQINSIWGQMVGSYMGKSQGGFLTAYRLFRMSYLHSLKLTASAIGVRTVMHMNVHLLI
FT                   LALIPFVSILISWKLLSHQKIRASLKFIFSDDTVFNKRKVLPITLNVSFTLAILFFITS
FT                   FIPSNLIKNELLSLKLSYGAFSSIVGTILITLLFCYLITGILKLREGKKSTSSILWCLR
FT                   QYYMKYSIGVIVVSILLMLIALIRSNMWKQIGAFLLALPNIILILANALSFGGLQTINS
FT                   GDVYNLRSSLSGFQVACSVILALTWCIFLWYVLYQIYLKLEKSNAKDYIKNVGIISGIT
FT                   LVIQSVFYYLSKVEISLRALGEAEVGTAIKTNIFLSLFVLALISAGAAACAYYFPNLLY
FT                   KKGSKEEVLLLGSWKRLDMAVLIALSIFVSITFLSMTKVLNRSVESSSIIGGNNSSVKE
FT                   SYSMVHLDEIRVFNGGIVFRDYDKMYTYQKEKVKKINFDEYLTSYYSNTEYYYSKTSDR
FT                   ILKVNQNDAMLVDSKGKELYKQKVNFDRLLSATKEFDKLLFLVDDEITLYSKKESNFSI
FT                   LDGITYYEYSDFYFDDSEEYIYLVGNSISRYDLKSKKLEVVKEQTPEYILDSEEKLTAK
FT                   LYIFKEGKLVPPVGDSNKKYYVKDMIREYQTYSVIIENGKDSPVSLPDMVSAEAIDTEG
FT                   TKFLVTFTEYGDYYLYDAAKAELTNISTQIRYLTSNGKVEA"
FT   gene            574524..576572
FT                   /locus_tag="Cphy_0451"
FT   CDS_pept        574524..576572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00245510 Phage tail fiber repeat
FT                   family protein Pfam: Drf_FH1 PROSITE: ASN_RICH HIS_RICH
FT                   THR_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40838"
FT                   /db_xref="GOA:A9KHH1"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHH1"
FT                   /protein_id="ABX40838.1"
FT                   /translation="MKKIQLFLVSLFCMLVLSACGAEITTTTNLNKDGSGELIVTAVAS
FT                   SSDEKYLNGGYEALNQLLLEKAPEGLELSVVYDETNSNYTYSYKIGFQDANDYNNKIAA
FT                   LFGTQGLAEFSDTTDNLTHTTKYQDLTDKALFIDWALNAIDESGICSYASSEIYSWGYR
FT                   YLNYNGEEVNYGYKDPSMKKTTTVGVLKVKCFSEYDIYSDATKTIEIYLNTSDLVGIEE
FT                   EDILSYFRKFDQDVEYNATAGTIIYRFDSLEKINQFLLSVMNSDGETNITESPVKLSIT
FT                   DSSIFSFTFELEEYYNLGNLFKTLRMDTDYIDVYLSIPEDLAYGWYHFTSYKDASEVAD
FT                   AKYNFQGACYYDSSFNSSFKVNQSVTVKNIDVKCILENDMSGKLTTEFSFLPNGCNIDE
FT                   AKCKEFYKDLGQELTYREQGDTVVVAFTKNFHKGESYIDKSNVIQLKESSLSNRKTKIY
FT                   TLDHVFMLSGLVPMKDCEVNYKIMVPDSLKVTFLHSNDDILTGKKIEKIQKNGYYTESL
FT                   STYRGTVSVSVAIEKTNVLYYVIVIAIVVAAVAGVAITTVIIIKNKKGLKREAATTSDT
FT                   APTNEVAPTDEATPTNEVAPTDEATPTNEVAPTDEATPTNEVAPTDEATPTNEVSPTHE
FT                   ATTMNETATSNEAAPTKEAAVTSDTATTYETVIPNETVAAKDTANNP"
FT   sig_peptide     574524..574589
FT                   /locus_tag="Cphy_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.900 at
FT                   residue 22"
FT   gene            576883..577551
FT                   /locus_tag="Cphy_0452"
FT   CDS_pept        576883..577551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbf:CLI_0630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40839"
FT                   /db_xref="GOA:A9KHH2"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHH2"
FT                   /protein_id="ABX40839.1"
FT                   /translation="MRYRISNVLWGLFWMSLGVIIAGNVFQWWDISLFFPGWWTLFLIV
FT                   PCSISIIRNGFGGFSLIGLVVGIMLLLNSQGIFLADTVRKLIVPVVLIIIGLNILMRSA
FT                   FNGSSKVKIPIPKECSYAATFSGNTVQFPNQRFEGAELNSIFGGVRLDLRSAIIEENVC
FT                   IDATSIFGGIDIFVPENVRVKVSSSSFFGGVSNHRRRISGEVPTIYINATCMFGGVDIR
FT                   "
FT   gene            577548..578456
FT                   /locus_tag="Cphy_0453"
FT   CDS_pept        577548..578456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE1862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40840"
FT                   /db_xref="GOA:A9KHH3"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHH3"
FT                   /protein_id="ABX40840.1"
FT                   /translation="MSPFQKIIKYFAMGFAAFLMVGILTSIVAVVSGLGSGIDTYEINK
FT                   NYVSFTKDFDNVKNLNFSNGDKKLTLVSGDTDKVIVEAKNVPDSLEVKVTSDGTLTIKD
FT                   RDRFHISWIIGWSGNWNSDMEIIVTVPRDFTVGKVELDSGSANMEVNDLTADNMIIDGG
FT                   SGSFIGRNLSAKKANISLGSGSTRLDYVKFEKGKMDCGSGDVKIENAIFRDVDFDGGSG
FT                   SISYSGQLSGKTSLNCGSGRISFELEGKREDYNINSDSGSGGIWIDGTRADNYKERNSD
FT                   VNNEIKIDGGSGRVLINFYSE"
FT   sig_peptide     577548..577637
FT                   /locus_tag="Cphy_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.355 at
FT                   residue 30"
FT   gene            578474..578797
FT                   /locus_tag="Cphy_0454"
FT   CDS_pept        578474..578797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY4222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40841"
FT                   /db_xref="GOA:A9KHH4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHH4"
FT                   /protein_id="ABX40841.1"
FT                   /translation="MLIPKDKYEKASGMDSFSRNLVTVSSPMLAAVILSTFGMGGIILI
FT                   DLISFLFAVIVLIFFIPIKEERAVSVKKKEPFFAGFQEGIDFLKKHKILFYNRTMERKE
FT                   PNC"
FT   gene            579149..580342
FT                   /locus_tag="Cphy_0455"
FT   CDS_pept        579149..580342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0455"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   cbf:CLI_1497 aminotransferase, classes I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40842"
FT                   /db_xref="GOA:A9KHH5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHH5"
FT                   /protein_id="ABX40842.1"
FT                   /translation="MSKYNFDKWIERAGTNCVKYDFAKESGYSGEELSLWVADMDFETV
FT                   PEITEALVERAKHGIYGYTMPKEDYWNTVISYMEKEHNYKTKIEWYVNAPGIVFAIALA
FT                   IRALTKEGDSVIIQRPVYHPFTRMVEANNRKLINSPLKEVMLNGSIHYEMDLIDFEEKI
FT                   KRHNVKLFILCNPHNPVGRVWTKDELIAIGEICRRNGVVVVSDEIHFDFVYPGFTHTCF
FT                   ASISKEFEDMTITCTSPTKTFNLAGLQISNVIIENQEIREKVSEEIKKSGYDEPNIFGM
FT                   VACKAAYEFGKPWLEELNEYLLGNLKFVREFVKEHLPKISLIEPEGTYLTWLDFRAYQL
FT                   TKDELEQKIVKEAKLRLNAGSMFGEEGEGFARVNIATPRAYLEKAMKQLEQAFVDLR"
FT   gene            580553..581356
FT                   /locus_tag="Cphy_0456"
FT   CDS_pept        580553..581356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_1076 glycoside hydrolase, family 48"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40843"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHH6"
FT                   /protein_id="ABX40843.1"
FT                   /translation="MKKEREKSFLWNHKLKCIIALFTFMVVFAITGCSDKKNKQTSVDD
FT                   TLITPEANNNITTTPLPTPVAMTPAPGITLTPTPEVTVTPTPTKTPLGDISEEEAQKLV
FT                   LAKLDTSKYSIDLSDDHLSIDGETYYVYVVSDSNGILEPAIIVNKKSRNLYSYDVNGNV
FT                   TPFTKFPLDNVESVNQNEDTITQAEALEQLKKVKKEKLGLVNTLSHYNVVADTWTTVVA
FT                   GEDCYCFNVFEGRAENQLVGMYYVSVSGENIYRFEEESSDFIKIN"
FT   sig_peptide     580553..580642
FT                   /locus_tag="Cphy_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.435 at
FT                   residue 30"
FT   gene            581798..585355
FT                   /locus_tag="Cphy_0457"
FT   CDS_pept        581798..585355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40844"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHH7"
FT                   /protein_id="ABX40844.1"
FT                   /translation="MKEKIEQLAKGVFIYNLPEVILSEESLELYVECGSIYRGSFTIQN
FT                   NQNTRMKGVLYSSNQNLHIENDRFIGEVSTIEYYFTAEYLETLTSYEETIHIISDCGEF
FT                   VLPVIIHITSPSCESSVGKIKNLFEFAGLAQTNWEEAKEVFQSEKFGQVIAYYDNQYLL
FT                   LYQALKKSSSASQALEEFLIATHKKVPASYQVDKTELQYEAGSYNFMDKLLIKKEGWGH
FT                   SEVIIKSDAKFLQPQMNTLRMESFADGEAELNFVVQTEGMKEGLHYGNITIDVALQRFV
FT                   IKVSVHCRRQNVVRRITLQKEKSCYVKLTKNYLDFRLDRISLSKYVSDAESILLTLLSG
FT                   EKESIFYELFHLHLKLISGKEGMVTSTFEALEQKEEELKKTEPVAYGIYLYLKTLRKKS
FT                   NQDALSVFQEVMELSEQYPKELFLFWCQLYLNKSYTSNPAQKLKDLKDRFQQGIHSPIL
FT                   YYEAALLLREDTLLLRELDSFELQVISFALRNHFLKKETATTVAYLASKCKVPHRHLLR
FT                   ILDEIYEQYGLKDALYAIISILIRGHKRETRYHRYYRLGMEKQLRITELPEYYIYSMGE
FT                   EYQEIHPAVISYFTYENKLPDRKRAFYYACLLTKHRENMTIMEHHRVEMLQFLKRQLFA
FT                   GVFHRHLTVIADALLPDTSVDTELAELIPKISFVHEVVCENPKIKSVAIVHKELQEECI
FT                   VPLTEGQAFINLYTEQAQIFFIDHKEQRYYTLASYTLKKLTHLTPLLENCYAINPDQAE
FT                   LIIYLSEKDQFYQKFDEYTIELRKRIVQQSTLTKEYRREFVQTLIHYYYDNFEGEILES
FT                   YLKNIDLKVFEQQSRYKMIEFMILREMYPLALRAMEELGYEGVEIKRLQRLCNHLLASP
FT                   DEVSRYQEILLQIAFYLFTKGYYEEVTLSYLVKYFYGTTAQMYDLWKMAKEKSIDTLDL
FT                   EERLLGQMLFAESYLGNAIQVFLSFYNKGCNRKLTRAFISFYSYKYLLRDRVTEPELFE
FT                   VIRKELNYEENDVALRALLKHYSTKEQLTDDEVKFIDYHLSRLVQKGVVLPFFKEFKRN
FT                   MRIPQHMYDKCYVEYHTNPKNRVVIHYSYGYESGEKDFAVEEMQNQCYGIFVKEFILFY
FT                   NEELQYYITEITEQGEEVTESKTIIGTMEEEASGEDCYIQLNHIMEAKELKDDATVLRL
FT                   LDNYVKQKFTIDTLFKAID"
FT   gene            585371..586633
FT                   /locus_tag="Cphy_0458"
FT   CDS_pept        585371..586633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40845"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHH8"
FT                   /protein_id="ABX40845.1"
FT                   /translation="MGENKQLLIGFEITNETSQIYYYQAQTGDAVPIFLTQNQSNPLFP
FT                   TCLAVKESNKEWMIGEEAIRISSLGGSFLIENLLENLEHQESITIYGAIFTPVMLLTKF
FT                   FKKAFMVVRQQFLNSSIQELVITVPNLTPNMTEMIYLSLEELGLLRDRVHIISQVQSYM
FT                   YYVLSQKPEIWMHDVSLFTYDETGLFYYNLTVNRRMQPFTVIVDLMDLSNELTHEIFEQ
FT                   EPIERILYRLEKLMNQVLYRRLTSAVFVTGRGFEGNWVRDVLVRLSSSRRVFLGQNLYA
FT                   KGACLAAKGFLDDSFQNYLFLNDEMITSNISLRLYENAKEVDFCLVKAGIPWRKANNTV
FT                   TVILDQTKELAFIVTNLLNREPLYEVLSLDGLMERENKTIRLSVTVHFIDRETAIVTVR
FT                   DVGFGVFYETNYRIWEQTLTL"
FT   gene            586714..587550
FT                   /locus_tag="Cphy_0459"
FT   CDS_pept        586714..587550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40846"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHH9"
FT                   /protein_id="ABX40846.1"
FT                   /translation="MGKLILCAGRTAEKPYCFKLTGTPVYTIEELCYYIYHNLESVSEE
FT                   LFNQELIDFIGEDLGLKERANFLEELLRKKSGIKDLVVSILCSCDLYDKTEINQLLAEI
FT                   DILFRLTPIQRKKRQADFCLSHHKYKEAMKEYLAILNSREFTDLTSEEYGDILHNMGVL
FT                   EARTGAFTVAADKFRGAYERNHNEKSLKQYLYALKCSKQETLYEREVKILVGNRELLMQ
FT                   MEEELYHAWDASEYTGLYAEVVRLSELKENGKYTEFYERLNELVKQLKIEYRKDSI"
FT   gene            587565..588851
FT                   /locus_tag="Cphy_0460"
FT   CDS_pept        587565..588851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mst:Msp_1095 DNA double-strand break repair
FT                   protein Rad50"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40847"
FT                   /db_xref="GOA:A9KHI0"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHI0"
FT                   /protein_id="ABX40847.1"
FT                   /translation="MGLFSSRKKNKEDKRINNTDFVQMSVEEALEKLSGSSVAQTPFNI
FT                   EEENLSFLEKKRRKKEQAKNKKSNNVEGKGINPYQGEIKEENINDVIKGHKSQILELTA
FT                   QLEETKQEYEAVTSYLSDIQKIEQIPDGQKKPYLDAANKIINFEKERKKYLNIDRKLSE
FT                   AQFAEMNRLEDDIKRELPKLKDQEHYQQLIKEDLRQLEGEKGVLNYDREQAISKVKFLK
FT                   QLAIGGFVMILLLFAGLFLLDNAVEADLSLPILMTVFLGVILVAYIIYDTRRCSYKQKM
FT                   AELKLNRAVSLINKVKLKYVNCTAMLDYSYEKYHTTGHQELMARYQLFLKEREELERLE
FT                   QNTELLGYYQEELVIELRKHGIDDAEVWGYQAEALLDKKEMVEVRHRLNGRRQKLREHI
FT                   DLCAKQLDLVRNSLEGIRTRNPEYESEMV"
FT   gene            complement(589088..589747)
FT                   /locus_tag="Cphy_0461"
FT   CDS_pept        complement(589088..589747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0461"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: bha:BH0719 transcriptional regulator
FT                   (TetR/AcrR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40848"
FT                   /db_xref="GOA:A9KHI1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHI1"
FT                   /protein_id="ABX40848.1"
FT                   /translation="MAEKNNQRVKLSKMLLKNSLIQIMHEKPVEKITIKELCENAGINR
FT                   STFYLYYTDPVSLLAELENEVLDNAKIFLGKVDSNQDSLPYLITFLDYIKDNSMIFNTL
FT                   LRPQENLSFQTKFMKDILAHLKAAVMLNCPPDISEYIYNYVIMGSLSVIQHWIQCDYNI
FT                   KSNEMATLIYQLSNTAIMNYVPNNSKVNQATASNPTIRTSSQTNQTSRTISQSMTT"
FT   gene            590029..591552
FT                   /locus_tag="Cphy_0462"
FT   CDS_pept        590029..591552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0462"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: pdi:BDI_2305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40849"
FT                   /db_xref="GOA:A9KHI2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHI2"
FT                   /protein_id="ABX40849.1"
FT                   /translation="MRKTRILLTGATGTMGYSVLKELVNELDKFELILLVRDTDNKKEL
FT                   IQPYKKLSGVTIYWGDLTNYKDVFECVRHADIILHVAAFVSPAADYYPLLAMKTNYGST
FT                   KNILTAIREQGRMEKVKLVYIGTVAETGDRIPPIHWGRVGDPIKPSIFDYYAVSKVAAE
FT                   RIVIESGLTYWVSLRQTGIMGPAMSKINDPILFHNGLDNVLEYVSDRDSGRLLRNLCSL
FT                   DYEEELSPEFWNHIYNIGGGESCRVDTYSMFEDIFGAIGIKDLDYVISPRWFATKNFHG
FT                   QYYLDSDKLEEFLHFRQDSMQYFYEEYIKNLGVTASLSKVICKIPGGQKIMGSILKKVF
FT                   LKMARTEHGTVHFVENNMENQISAYWGSKDKWKQLPTSIHDLERPKDWNRVIVLDHGYE
FT                   EEKPENKLDLSDIKEAAVFRGGKVNSISMQVGDLRTPLTLTCAFGHTFEASPRLILEGG
FT                   HWCPVCERESWNYGRRAKIDPFFAQVWDPLHEGEASFMEYKKEVNELMV"
FT   sig_peptide     590029..590091
FT                   /locus_tag="Cphy_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.767) with cleavage site probability 0.662 at
FT                   residue 21"
FT   gene            complement(591657..592304)
FT                   /locus_tag="Cphy_0463"
FT   CDS_pept        complement(591657..592304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0463"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ctc:CTC00894 putative peroxiredoxin, alkyl hydroperoxide
FT                   reductase C22 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40850"
FT                   /db_xref="GOA:A9KHI3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHI3"
FT                   /protein_id="ABX40850.1"
FT                   /translation="MEINHLSIGMTAPDFTAVTTFGPLKMSDFKGRWVVLFSHPGDFTP
FT                   VCTSEFLAFAQNAPEFDKLNANLVGLSIDSNPSHLAWVNSIYLNTGVQVPFPVIADRSG
FT                   DIARLYGMLAPDVSTTQTVRNVFFIDPKQIIRAILIYPLTNGRCISEILRLLQALQTTD
FT                   EFNVVTPACWQPGEPAMVPAPATYEQLVERESNPTGEGLECKDWYWCYKSIE"
FT   gene            complement(592816..593595)
FT                   /locus_tag="Cphy_0464"
FT   CDS_pept        complement(592816..593595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0464"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: cbe:Cbei_2657 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40851"
FT                   /db_xref="GOA:A9KHI4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHI4"
FT                   /protein_id="ABX40851.1"
FT                   /translation="MKLFYENKSRTFNLYQGTNMTFPPHLHKEIEILICQKGVVEATCN
FT                   GQTLLLEESDIMIALPNTIHSYETKEYCEYILCILSPSTLPLFKPYFQKEFTTPFLQMD
FT                   QTKKITPFVRMLLEEWENDRNQELMISYLSVIFSLILKNTTFTEKATSTYEDILPSILL
FT                   YVDEHYLEQFSLEDLASHLGFNPSYVSRLFSERVHCTLTHYVMELRVNYAKHLLQNTEK
FT                   SITEIAYECGFATQRSFNRVFLQLVNTTPREYRKTYL"
FT   gene            593931..594581
FT                   /locus_tag="Cphy_0465"
FT   CDS_pept        593931..594581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40852"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHI5"
FT                   /protein_id="ABX40852.1"
FT                   /translation="MKKVLMVQGGWDGHEPVLVSQVFQKMLEKEGSSVEVHDTLECLSD
FT                   AEKLKSYDLIVPIWTMGTIPSNYVHNVSVAVASGTGLAGCHGGMCDAFRNEVEWQFMTG
FT                   AQWVAHPGNDGVEYMVHVSNDDYFTKGLSDFKVCSEQYYIHIDPAIKIYATTTFPVVDG
FT                   PHASNGNVEIPVVYTKMWGEGKVFYTSLGHHADIFDIPEAYEIMRRGFLYAVR"
FT   gene            594661..595767
FT                   /locus_tag="Cphy_0466"
FT   CDS_pept        594661..595767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0466"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   rca:Rcas_4405 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40853"
FT                   /db_xref="GOA:A9KHI6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHI6"
FT                   /protein_id="ABX40853.1"
FT                   /translation="MEKVNVAVIGCGNISDIYMQNITNLFVNLNLYAVCDLEVEKAKAA
FT                   AEKFQIENVLTYDEIMQSPEITVILNLTTPKSHYSICKDALLAGKHVYVEKPLSLKLEE
FT                   GKELVSLAKEKKRLLGCAPDTFLGAGIQTCIKAINDGYIGEVIGATAFMMCHGHESWHP
FT                   DPEFYYQIGGGPMFDMGPYYLTALVSMIGPVKEVVGMNSISFPTRTITSEKKFGEIVPV
FT                   EVPTHVTGLLRFENGAIGNIITSFDVWGSTLPRIEVYGTRGSLIVPDPNCFDGEVLIKQ
FT                   YFSKSFEAFPLSSIYNMNSRGAGLSEMANCIINQTDNNRASGELACHVLEIMHALHTSQ
FT                   ETKSFVELSTCCESPRPLEMNLIKGSIS"
FT   gene            596301..597020
FT                   /locus_tag="Cphy_0467"
FT   CDS_pept        596301..597020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHI7"
FT                   /protein_id="ABX40854.1"
FT                   /translation="MKVTYIYHSCFTVEEKDVVLIFDYFKGDLPKFDSEKKIYVFSSHK
FT                   HADHFSRIIFDLVKGYKNISFLLSNDIKMNEKYMERVQIPEEARDKIQNLRKNETYQIT
FT                   EDLKVETLTSTDQGVAFVVTLFGKTIYFAGDLNWWTWKGETEEEYQDMTKRFLTEIEKL
FT                   KGRHLDLAFLPLDGRQEERFYLGFDHVMREAEVINAFPMHYWEKPDVIQRLKEMEVSKD
FT                   YRDRIFDVMEPGQVFEC"
FT   gene            597010..597909
FT                   /locus_tag="Cphy_0468"
FT   CDS_pept        597010..597909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0468"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: cpf:CPF_0871 transposase,
FT                   IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40855"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHI8"
FT                   /protein_id="ABX40855.1"
FT                   /translation="MSVNRSIHVIFLYQLDLSGKSKVGLNFPKNNKTDFKIERHKINIP
FT                   TLKWVRLKEFGYIKANANVISGTVTEQAGKYYISIVCEIEEVKNSLPKAEPLGLDLGIK
FT                   AFVIFSNEIVKKNINKTSRVKKLEKKLKREQVRLSRKYECLKKQNKIGKGETTRQNIHK
FT                   QIVRVQRLHQRLANIRTDYINKCVSEIVGQKPSSITIEDLNVKGMMKNRHLSKAVAGQK
FT                   FYKFRTKITNKCKQNDIELRIVDRWYPSSKLCSCCGNVKKDLKLSDRIYVCKECGLVID
FT                   RDLQASINLREAKTYKIA"
FT   gene            598077..598439
FT                   /locus_tag="Cphy_0469"
FT   CDS_pept        598077..598439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0469"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: dsy:DSY4986 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40856"
FT                   /db_xref="GOA:A9KHI9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHI9"
FT                   /protein_id="ABX40856.1"
FT                   /translation="MNFKFAHNNFNVLNLEKSLTFYEEALGLKEVKRHESKDFTLVYLG
FT                   DGSTTHCLELTYLHDRTEAYNLGENEFHLAFVVDDYEAALKKHKEMDCVIYENEAMRIY
FT                   FIVDPDGYWLEVVPGK"
FT   gene            598623..598913
FT                   /locus_tag="Cphy_0470"
FT   CDS_pept        598623..598913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40857"
FT                   /db_xref="GOA:A9KHJ0"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHJ0"
FT                   /protein_id="ABX40857.1"
FT                   /translation="MEYSNEKNIGVIISIMILCTAGYVIQRNNRAHEDIEVIHMEVDRV
FT                   VYHNLTELMNASDLVVIGEYCQDTEQLIEYSFSNEFNKNVITDMISTISYR"
FT   gene            599021..599428
FT                   /locus_tag="Cphy_0471"
FT   CDS_pept        599021..599428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40858"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHJ1"
FT                   /protein_id="ABX40858.1"
FT                   /translation="MNKGEQWIFFLSYDEINETYWCTGDYTGRHPVPNEKIISICDDAS
FT                   SLIKERNEILNTKERISDSQLESSNEYVYTDLNGINYCLQTNEEAEKVISMDNKILACK
FT                   NKLKASNFGLFRQNLINIELYCDILNELNVH"
FT   gene            599953..602631
FT                   /locus_tag="Cphy_0472"
FT   CDS_pept        599953..602631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0472"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: cth:Cthe_0324
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40859"
FT                   /db_xref="GOA:A9KI25"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI25"
FT                   /protein_id="ABX40859.1"
FT                   /translation="MQKELAKTYDPKDIEGRLYEKWLEKKYFHAEVDKTKKPFTIVIPP
FT                   PNITGQLHMGHALDNTMQDILIRFKRMQGFNALWQPGTDHASIATEVKIIEALKKEGID
FT                   KDQLGREGFLKRAWEWKDEYGGRIIGQLKKLGSSCDWDRERFTMDEGCSKAVEEVFVKM
FT                   YEKGMIYKGSRIINWCPVCHTSISDAEVEYEDQAGHFWHIKYPVVGTDEYLCFATTRPE
FT                   TMLGDTAVAVHPEDGRYMHLIGKKVKLPFVDREIPIIGDSYVEKDFGTGVVKITPAHDP
FT                   NDFEVGKRNNLPEINIMNDDATINANGGKFEGMDRYAARKQIVKELDEMGLLVKVEDYS
FT                   HNVGTHDRCNTTIEPLIKQQWFVKMDELIKPAVEAVKNKDIELVPERMEKVYFNWTDNI
FT                   RDWCISRQLWWGHRIPAYYCDKCGKVVVSKTTPTTCECGHDHFTQDPDTLDTWFSSALW
FT                   PFSTLGWPEKTEDLEYFYPTDVLVTGYDIIFFWVIRMIFSGYEQMNEKPFKTVLFHGLV
FT                   RDSQGRKMSKSLGNGIDPLEIIEQYGADALRFMLITGNATGNDMRFYMERVEAARNFAN
FT                   KVWNASRFIMMNMQQMEEAGMDAKVDSVDMSTLTDADKWIISKVNTLTKDVTEHLEKFD
FT                   LGIAAQKVYDFIWEEFCDWYIEMVKPRLYGDDQATKTAAIYTLRTVLDSALKLLHPYMP
FT                   FITEEIFCTLKEMEGRLSADESVMISKWPEYKEEFNFAKEEEAVEIIKEAVKAIRNART
FT                   EMNVPPSRKAKVIVVSDSEKVREIFANSKVFFASLGYASEIVIQSDKNGIDSDAVSIVT
FT                   ATATIYIPFADLVDIEKEIERLSKEKDRLAGELKRVNGMLANPNFVSKAPEAKLAEERA
FT                   KLEKYASMMAQVEERLAHFKK"
FT   gene            602764..604167
FT                   /locus_tag="Cphy_0473"
FT   CDS_pept        602764..604167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0473"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   cth:Cthe_0498 protein of unknown function DUF342"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40860"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI26"
FT                   /protein_id="ABX40860.1"
FT                   /translation="MSDWSRPTKELMYKKTKVDLRYDKMEAYITLYAPVGKDRYTKEMI
FT                   YEILRFHHVIYGIDEEVVNKLCEKPCYGKEILIAKGKEEVDGKDGYFVYFFDTRVDTKP
FT                   RILEDGSVDYFAMTRIVTVSQGEIIVRYHKAIQGSNGIDVCGSIRYGNIGRDLPPLKGK
FT                   GFKLSDDRLIYTALITGKIEVSEGRITISNVLEIKENIDYLQGDIYFKGDLMIYGDISS
FT                   GKVVESEGSIVVRGHVEGATIRAGKNVILENGMQGAGKGSITCGGSISGKFFEQVEMKA
FT                   KENITANTIMNCTMTAGNEIIVTGRRGILLGGSAYAGRKITASIIGNHTHINTELVVGV
FT                   RRSFHRKFAYLERKISELKERLSQVEAAIAMINERELPDVISPLRDQKMRLLRTKININ
FT                   SEIAEMVDEWSDLMDFIKNSKSAKIIVNKMIYPGCKLAINGLSMGIKQEIVSSYFLRNG
FT                   DDIDMIPFI"
FT   gene            604694..604831
FT                   /locus_tag="Cphy_0474"
FT   CDS_pept        604694..604831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40861"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI27"
FT                   /protein_id="ABX40861.1"
FT                   /translation="MINFDEEIAKFQPSLEVDQAEEAIFNNDLTDITDMIESILNEKKG
FT                   "
FT   gene            604922..606331
FT                   /locus_tag="Cphy_0475"
FT   CDS_pept        604922..606331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0475"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cth:Cthe_1383
FT                   tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40862"
FT                   /db_xref="GOA:A9KI28"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI28"
FT                   /protein_id="ABX40862.1"
FT                   /translation="MNCPKCGNVVAVRRNRCEFCGKDLTIVRKTDRLSNTYYNRGLEKA
FT                   KVRDLTGAIIMLKKSLEMNKRNTNARNLLGLVFFEMGETVAALSEWVISKHFQAKDNDA
FT                   DVYIGAVQANPTKLDSMNQAIKKYNIALDSAKQGSDDLAIIQLKKVINLNPHFIRALQL
FT                   LALIYMKNNEFERARRCLVKANKIDLANTTTLRYLSELNQLVSGGETTSTPYWSDGEVN
FT                   PDPLGKPLSPISSYREEKPNVWLFINLILGVVIGVSVLFFLIVPTVKKNAQSEYLQKQR
FT                   DFDSDLLVYRTKLTSSEKEVEDLKAKLADKQKELDNIDIPEYDKTMYDSILSAVYRYME
FT                   LESTNSLTPENTMEVADLLSKVDPSKMENQDAVKLFEMVKEKVSPIAAKEAYQQGRAAF
FT                   EKKDYEKALTLLTQAYSFGDPDDNTLYYLGKTEQELGQYEEAKAYYNQMLESFPNSSLA
FT                   KYAKQRVNDLE"
FT   gene            606468..606851
FT                   /locus_tag="Cphy_0476"
FT   CDS_pept        606468..606851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0476"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; anti-sigma F factor
FT                   antagonist; PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: amt:Amet_2212 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40863"
FT                   /db_xref="GOA:A9KI29"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR014237"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI29"
FT                   /protein_id="ABX40863.1"
FT                   /translation="MNSKDEFMWLDYQKVGCADFEIRKSTLIIHMKEDLDHHSAIFIRE
FT                   QADKLIEQKNVKNVIFDFNKVSFMDSSGIGVIMGRYKKLLHVGGGTLAVIGVSDRIDRI
FT                   LRLSGLYKIMNRYQDMQEALNCM"
FT   gene            606901..607374
FT                   /locus_tag="Cphy_0477"
FT   CDS_pept        606901..607374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0477"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: ckl:CKL_3155 SpoIIAB; TIGRFAM: anti-sigma F
FT                   factor; PFAM: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40864"
FT                   /db_xref="GOA:A9KI30"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010194"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI30"
FT                   /protein_id="ABX40864.1"
FT                   /translation="MEQNLQNKEMRDIIEMECDNEMVLEFDALSKNESFARTVVAAFAA
FT                   QLNPTIEELADIKTAVSEAVTNCIIHGYDNKKGKIKLYCAITGIELVIEVSDYGVGIEN
FT                   IPLAMEPMFTSRPELERSGMGFSFMDAFMDELTVNSTVSIGTTVRMKKRISTT"
FT   gene            607410..608126
FT                   /locus_tag="Cphy_0478"
FT   CDS_pept        607410..608126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0478"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   family"
FT                   /note="TIGRFAM: RNA polymerase sigma-F factor; RNA
FT                   polymerase sigma factor, sigma-70 family; RNA polymerase
FT                   sigma-70 factor, sigma-B/F/G subfamily; PFAM: sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70 region 4 type 2;
FT                   KEGG: amt:Amet_2214 RNA polymerase, sigma 28 subunit,
FT                   FliA/WhiG family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40865"
FT                   /db_xref="GOA:A9KI31"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014236"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI31"
FT                   /protein_id="ABX40865.1"
FT                   /translation="MDTLDLIRLSKQGDKVARDRVVTENVGLVWSIVRRFMGRGHEAED
FT                   LFQIGSIGLMKAIDKFDLSYDVKFSTYAVPMITGEIKRFLRDDGMIKVSRSLKETAGKI
FT                   RLMRETLESKNGREPTIEEIGEALELAKEEVVMALESGAEVESLYKTIYQGDGNAIFLI
FT                   DKIEQTDDASDEMIDHMALREVMDSLDEKEKDIIRLRYFKDKTQTEIAKQLGISQVQVS
FT                   RLERKILRTMRERMLG"
FT   gene            608639..609142
FT                   /locus_tag="Cphy_0479"
FT   CDS_pept        608639..609142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0479"
FT                   /product="stage V sporulation protein AC"
FT                   /note="TIGRFAM: stage V sporulation protein AC; PFAM: SpoVA
FT                   protein; KEGG: drm:Dred_1106 SpoVA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40866"
FT                   /db_xref="GOA:A9KI32"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="InterPro:IPR014203"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI32"
FT                   /protein_id="ABX40866.1"
FT                   /translation="MANDKNKVSASQVANEKDQQERDKLYNQYVKQVTPKHSWFTNMCK
FT                   AFVSGGIICAIGQGFINFYSSYGAEKELAGAYTTMSLVLLSIIFTGFNWYQKIAKFAGA
FT                   GILVPITGFANSVAAPAIEFKKEGQVFGIGCKIFTIAGPVILYGIFSSWLLGLVYYIFT
FT                   MFQK"
FT   gene            609211..610278
FT                   /locus_tag="Cphy_0480"
FT   CDS_pept        609211..610278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0480"
FT                   /product="stage V sporulation protein AD"
FT                   /note="TIGRFAM: stage V sporulation protein AD; PFAM: Stage
FT                   V sporulation AD family protein; KEGG: amt:Amet_2220 stage
FT                   V sporulation AD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40867"
FT                   /db_xref="GOA:A9KI33"
FT                   /db_xref="InterPro:IPR010894"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR038369"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI33"
FT                   /protein_id="ABX40867.1"
FT                   /translation="MTQTTAKQSKMVGKQSVQFSNPPAIIGCASVAGQKEGEGPLGAFF
FT                   DVIEEDPMFGQKTWEEAESKMLGMAVDVAIHNAGLKKSDIRYLVGGDLLGQLIATSFGI
FT                   ENFEIPLIGVYGACSTMGESIVVASMIIDGGFADRTLAITSSHFAGAEKQFRFPLAYGN
FT                   QRPKAASWTVTGSGAVILGHEPEKDSEFAKQFSPVMIKVKGITIGKIVDYGIKDSLNMG
FT                   ACMAPAACETIAQNLKDFSIQPDYYDRIITGDLGMIGKDILIDLLKEKGYDISSNHMDC
FT                   GIEIFDSEAQDTHAGGSGCGCSAITLTGYILQKLRKRDWNRVLFVPTGALLSTVSYNEG
FT                   QSVPGIAHAVMLESC"
FT   gene            610291..610647
FT                   /locus_tag="Cphy_0481"
FT   CDS_pept        610291..610647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0481"
FT                   /product="stage V sporulation protein AE"
FT                   /note="TIGRFAM: stage V sporulation protein AE; PFAM: SpoVA
FT                   protein; KEGG: tte:TTE1321 sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40868"
FT                   /db_xref="GOA:A9KI34"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="InterPro:IPR014204"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI34"
FT                   /protein_id="ABX40868.1"
FT                   /translation="MDYLISFLVGGAICAIVQVVMDNTKLMPGRIMVILVCLGALLGAI
FT                   GVYQPFAEWAKAGASVPLLGFGSVLFKGIKEGVDKEGFIGLFKGGFTSSAVGISSALIF
FT                   GYIASLIFNPKMKE"
FT   gene            611142..611612
FT                   /locus_tag="Cphy_0482"
FT   CDS_pept        611142..611612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_3238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40869"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI35"
FT                   /protein_id="ABX40869.1"
FT                   /translation="MQTIIRQIKGRIILDNANHCHIYNCEVYDVGMEGIHLRDNSSSNI
FT                   VDMCTITDTGKVNTGYSGANYADSFIDVKGNNAIIRNNTCNRNNNSNIVDAFQGSEQLS
FT                   GWGKNNDFYSNTVNLDQSSGYVLKITGNTTAKASNNTRIPAGNMYSGNITQY"
FT   gene            612076..612411
FT                   /locus_tag="Cphy_0483"
FT   CDS_pept        612076..612411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0483"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   ppr:PBPRB1735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40870"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025499"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI36"
FT                   /protein_id="ABX40870.1"
FT                   /translation="MAVYKELDSKYEVLVEGKSGRRIKGYDGSLMMVEVYFENHYISEK
FT                   HTHEHEQMTYCLEGTFEFYIGDKVERISAGDTIYFPSNIEHHCAVITETGRLLDVFTPI
FT                   RKDFIQE"
FT   gene            612448..613455
FT                   /locus_tag="Cphy_0484"
FT   CDS_pept        612448..613455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0484"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: cac:CAC0393
FT                   KDG operon repressor (gene kdgR), LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40871"
FT                   /db_xref="GOA:A9KI37"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI37"
FT                   /protein_id="ABX40871.1"
FT                   /translation="MDQTKITITNVAEFAGVSKSLVSSYLNGRFDNMSEATRKRIEETI
FT                   QSLGYEPKEQYRNFKKRERGIIGLILPDITDPFYSLCSKAIADGALNHDYMVLFANSDN
FT                   NVGVENTYLDKFSECTDGIIIATVGRNDQQIMQLKDKVPVVLLDRRMKEGMFDGVSSNN
FT                   YESTMDMMKYLISLGYEAFGFFVEELVEGMSRVIRYQSYMDFIKEHNLYDASFIYNVNL
FT                   YDEMTMISNLIEFREQTKGKKAVIICANGKTLLHVITGVDALKINVPNDIGICGYDDFE
FT                   AAALIHSGITTINQPTYDIGYACVKQLVKRINQNGDYTPKEINLRSKLVIRGSV"
FT   gene            613468..614448
FT                   /locus_tag="Cphy_0485"
FT   CDS_pept        613468..614448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0485"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_3564 AlgM1,
FT                   putative multiple sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40872"
FT                   /db_xref="GOA:A9KI38"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI38"
FT                   /protein_id="ABX40872.1"
FT                   /translation="MKDKRKKIATRKTPFAKGYIRSIKKDWRLWLLIIPLLLWLYFFAY
FT                   RPMYGIYIAFLKYSPFKGIEGSAFIGLENFRNLMFGPSSEYFWRAFKNTILISTYGLAF
FT                   SFPMPIIFALLLHEVKSNKSRKLVQTITYAPHFISEVIVCSLVLTMLSLNTGLFNVLLE
FT                   KLFALFGQEFTPIHFMAKSEYFRSIYTISGIWKEVGFSSIVFFAALCGIPNELYEAAKV
FT                   DGATRLRQIWSISIPGILPTIVIMLIIRVGNILNVGYEKVLLLYNPGIYDRADILSTYI
FT                   YRLGVQNNPNYGVSTAASLINSLIGFAMVIMANRIAKKFSQTSLW"
FT   gene            614460..615353
FT                   /locus_tag="Cphy_0486"
FT   CDS_pept        614460..615353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0486"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_3561 AlgM2,
FT                   putative multiple sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40873"
FT                   /db_xref="GOA:A9KI39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI39"
FT                   /protein_id="ABX40873.1"
FT                   /translation="MERVRKKKMKQSLGDKTFDFVKNFILIVLTIACLYPLIYVFSCSI
FT                   SSGSAVDSGKVLLFPKDINFESYKQVLTDKQFWVSYGNTFYYTIFGSLFSMLVSAPAAY
FT                   VLSKKRFRARKVINILLSFTMWFSPGFIPLYLNYSELGVTNNRFMILISFGIQAFNIIL
FT                   LRNYFESIPEEMEESANVDGSNDFITFVKIYLPLSKASMATVWMYYAMSRWNGYFWSTI
FT                   LIKDMKKIPLQVYLKQKIIDQSLVSEFANTIAGQKYSYNTIIYALVACSIVPVLIIYPF
FT                   IQRYFVKGVMVGGVKG"
FT   gene            615427..617103
FT                   /locus_tag="Cphy_0487"
FT   CDS_pept        615427..617103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0487"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: atc:AGR_L_3560 AlgQ1, putative multiple sugar
FT                   transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40874"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI40"
FT                   /protein_id="ABX40874.1"
FT                   /translation="MRLKKVMCVTLAAAMLMGSLAGCAKKDNKVDNPSVTQPATDENNK
FT                   GSDDNKENTDAPVANAEPVELKIHFHSNNKYTLLDENGKLLPVFALAGEKTNSIVESTA
FT                   NPVAQNSIEEFQLQAAEKFPADIYGGTSLRSSITSYAYQGAFLPLNDLIDQYAPNLKKF
FT                   LDENPDVKAAHTAADGNIYMLNYCPDGDVARVYFIRTDWLDKLGLSMPTTFEELENVLY
FT                   AFKNNDPNGNGLKDEVPVFNDKWEELIRLANLWGARVYGFDTFTERVVLDSNDKFYQAW
FT                   TAPEFKEALIGLNKWYKDGIIDQEAFTRKQNTARQTLWAKENTGGMTHEFFASTSAFNY
FT                   NTEVLAAVPDFKLEAFLPVNKNGAGFEEHQRAIAKQDGWAISASTKNAEAAIRYMDWFY
FT                   SEEGRRAINFGIEGESYTMVNGVPTFTEDVLKQGNVNTYLQSAYGAQLPIGYKQNYDYE
FT                   DQWVTKEGRDANELYSANKASVYTVPTTPVLSFTEEETAMYDQCLTAINEYQNEMVTAF
FT                   ITGKTDIESNWDAYIAKCKELGVDTLVELYETAYARYKAIK"
FT   sig_peptide     615427..615501
FT                   /locus_tag="Cphy_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.792 at
FT                   residue 25"
FT   gene            617267..619552
FT                   /locus_tag="Cphy_0488"
FT   CDS_pept        617267..619552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0488"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   atc:AGR_L_3558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40875"
FT                   /db_xref="GOA:A9KI41"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012364"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032518"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI41"
FT                   /protein_id="ABX40875.1"
FT                   /translation="MTKLIEPKSSILTIGYHPENEKILENPPRFTWMPESEKDILYRIQ
FT                   VSKNDTFDPDSTLTIHHIPYNFYTLDKELEPGDYYWRYTIDQEECSYSKVRKLSISDGL
FT                   VVTPLVSREKRYDNVDMSHPRIWLNKEKIDMFREELEKNPNYCGFQIFLERSVLIHVNS
FT                   EFVAEPPFYPGNIRVVELWRKNYQECQRGLEYIRSLSVAGVLLENSEYIEKAKLALLKL
FT                   ASWDTNGSTARDYNDECSFRVAYALAFGYDWLYSFLTKQERSIILESLSVRTRQVATHI
FT                   IKDSRIHLSLYDSHAVRSLSSVLTPCCIAMLGESAEAKEWLDYTIEYFNTIYTPWGGED
FT                   GGWAEGGLYWTTGMAFVSEALNTIKSFLNIDIYKRPFFQKTGDFPLYCMPVDTYRASFC
FT                   DQSNLGKYPGHKTAYNIRQFAGVTGNQNYQWYYEQVLEREKEIDQDFFNKGWWDFYFDD
FT                   MVYRHDYKDTTLKEEKLERVKWFKDIGWVAINKDMKDPKEHIFLLTKSSPYGSVSHSHG
FT                   DQNSFVLFAYGEPLIIKSGYYIGFNTTMHRNFRRQTLSHNSILINGKGQYAGMDKAKQL
FT                   SAKGHICEVKESDNLVYIKEDATAAYQLTAPELTKYTREIYFVDDSYFILVDTVESEDK
FT                   SDVEWLLHSLSKFQIEEETIEVNGKMAGMTAKIVYCSSNIESITQSDIFTEVDEKETDG
FT                   LDNQWHLTMKTGKAKKHIIVSVIVPYKMEQKKLVNSVRDDQGMDIYLYFSYEGKTFSLC
FT                   IDGTKRNE"
FT   gene            619572..621440
FT                   /locus_tag="Cphy_0489"
FT   CDS_pept        619572..621440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0489"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   ypi:YpsIP31758_3577 heparinase II/III-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40876"
FT                   /db_xref="GOA:A9KI42"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI42"
FT                   /protein_id="ABX40876.1"
FT                   /translation="MYFEYQNYLKNNENYHDMLTAMKQETEYFMERFKDDPRFLSGWGH
FT                   GYFCNEDGGRLIYDINKPYEHKCSICGKVYSEFIYDSYFITMFRNDAVVTAMKAALLYA
FT                   VYAEEKYLTFVKTIVGFYADNYEHFAVHAKEKINCNLNEDVGGAGKIMPQGLNEAIVAI
FT                   RFIIALELVKDSLDTTWIQEVNEKLFAPMVKLLLPQKMHIHNIPVWINSAIGSMGLFFQ
FT                   EEEWVKEATKNPYHVYEQIRKGVTDSGFWYEGSIHYNFFALEGLMSFLVFAKAYHLEIP
FT                   ADINETVFHMLEAAYEYAFDNDLFPNPSDGWPNISLKTYSYIYFMGYKVFGEKVLPFIK
FT                   HIENTPGERGKLPLSEPYYYKNKISLERILFGPDIMELKAEEIKSRGSKNFSGSNCAIL
FT                   RNNEFNVFLKYGHQTKSHAHPDKMNIEIMVGGKVLTKDLSNSGYASKLCNGWHRTIAAH
FT                   NTCVVNGMSTDITKSGEVTQFSDNLIEAKAMAYEGVMYTRKFELRDETLLDSFLVSCEK
FT                   SSVIDWFFHFETPIETEQLKLKEVNLFTEYPYVTKVSEIETEEKTLILKNDLVTMQLIL
FT                   EEGVKVYFTKTYNNPANTMRDTIILRKEGKEARFQNVITKLKNGLN"
FT   gene            621481..622278
FT                   /locus_tag="Cphy_0490"
FT   CDS_pept        621481..622278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0490"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   cbe:Cbei_3371 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40877"
FT                   /db_xref="GOA:A9KI43"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI43"
FT                   /protein_id="ABX40877.1"
FT                   /translation="MSTSFSLEGKIALVTGACYGIGFAIASGFAKAGATIVFNDIKQES
FT                   VDKGLLAYQEAGIKAYGYVCDVTKEEQVTEMVAKIEKEVGVIDILVNNAGIIKRIPMCE
FT                   MSAEEFRQVVDVDLNAPFIVAKAVIPGMIKKGNGKIINICSMMSELGRETVSAYAAAKG
FT                   GLKMLTKNIASEYGEFNIQCNGLGPGYIATPQTAPLREVSADGKRHPFDQFILAKTPAA
FT                   RWGEAEDLVGPAVFLASEASNFVNGHILYVDGGILAYIGKQPE"
FT   sig_peptide     621481..621579
FT                   /locus_tag="Cphy_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.759 at
FT                   residue 33"
FT   gene            622395..623030
FT                   /locus_tag="Cphy_0491"
FT   CDS_pept        622395..623030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0491"
FT                   /product="Ribose/galactose isomerase"
FT                   /note="PFAM: Ribose/galactose isomerase; KEGG:
FT                   cbe:Cbei_3370 ribose/galactose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40878"
FT                   /db_xref="GOA:A9KI44"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI44"
FT                   /protein_id="ABX40878.1"
FT                   /translation="MKIALINENSQAAKNEMIAKALTDVVTPMGHEVFNYGMYGAEDKA
FT                   PLTYVQNGILAAILLNSGAADYVITGCGTGEGAMLACNSFPGVLCGHVVDPSDAYMFAQ
FT                   INDGNAIALPFAKGFGWGAELNLTYIFEKLFQGESGQGYPKDRVIPEQRNKKILDEVKK
FT                   VTHVDMITILKNIDQELLKGAIAGEKFGEFFYANCKDDEIKAFIKSIL"
FT   gene            623046..627716
FT                   /locus_tag="Cphy_0492"
FT   CDS_pept        623046..627716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0492"
FT                   /product="Alginate lyase 2"
FT                   /note="PFAM: Peptidoglycan-binding LysM; Ig domain protein
FT                   group 2 domain protein; Alginate lyase 2; KEGG:
FT                   pau:PA14_41500 putative lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40879"
FT                   /db_xref="GOA:A9KI45"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR014895"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI45"
FT                   /protein_id="ABX40879.1"
FT                   /translation="MGCRHSKLRRITALIVLIAIVITGMPNTVHAQDKTYIMYQIKDGD
FT                   TIKKIADRYNTSIDSIMKLNNIKNSNVFYSGKETKVPIASVTYVVKKGDTLSKIARTHG
FT                   TTVDTIAKLNGIKDENKIQTGQKLIVVKEEHVESTTSVNNEETLVRTQKELLNALASKS
FT                   STVIRIATEKKITFEIPKKNYNAKVLIVDAKNSEVKNEGTFHHILIQAIKTSTFYEYGS
FT                   KNTIIIKASTAHLVMEKTAVPGKIIVEDTNKELTIDNYTKKQMTLQTSDTVLTVKAENS
FT                   VEVKQGIVKKESKLNQIKPTVAPTTKPTAVPTTKPTVVPTITPTGTPNPTTAMPEPTSI
FT                   PTDIPTPVPTTIPPTNVPTISPTPIPQLPSDIVDFSTWKLQLPIAGESGLSVKEVGPED
FT                   LNNGFVHDEYFYVDTDGGIVFHCPVDGFKTANTNYARTELREIIDGKNPAVNWGFQGTH
FT                   ILRTSESVEKVSSNGRTVVSQIHGIYPNGDNGPVLVKVQYEHDLKAVVVMLKTGTAPNA
FT                   AEQRGYFYGVELGQRFETEIKCVEGVLYVTIQSEGRKETYTINFMEMDPTWGGQLGYFK
FT                   VGNYIQDSDVNYENEAATVKVYSIETFHDDSYVEQVPIEGLAMKQTEVTLDVGETIGLE
FT                   PVFTPVDTTNKAVTWNVVSGQNKVAVNKHGVVTAIAEGEAIVRATSKENNSVFAECVLT
FT                   VTLDSKQEVIALYEQDFGKDMPYDIANASEWLLSTTGYGKVEVEQEGDNFILKLTDTDM
FT                   AGTAKSLVYFPEQYGTTTLSYRIRVDEILVKDPEGAKAQASYLYLPVGGQDGFMNAADE
FT                   MFRIRNGATYQGGTLINHRWQLSHSYSDATMNYAATEFKIGEWKEITVVITPDNGTANA
FT                   NKTDVYVDGYRVASQMNNNKINSYINQAEFYTGTKDQVSFSIDDVRIYSGEKVREAEDA
FT                   LPPTSITLGTAPSTMATGDSFKLTTYITPADAKEAVTYLITSGADLVSVSKDGLVTAIK
FT                   PGTATVRVHSTGHEEIFSEITLTIVEESSIVRVESIELPEKIINLAEGEEKQLFPILLP
FT                   LNATEQKVSYEVIHGFDVISVSAEGILSTKNTGVATVRITCMDNSRLYVDCDISVTRKT
FT                   NEGTVIFRDTFDETLDLTKWTLATSNFNDTITEVKDGSLHLVDNNTSGQPRAYVSFEPQ
FT                   ASTFSIEFKVKMSADTIYNSNKVSALCVAFGTGTITSTASETFRFKTSADVANGEVTNR
FT                   RFVYSKEEGASGFYDLSKNYELEEWYTVKLVTTPNDGSTRANTTDIYINDTLMIEGAAN
FT                   KTNAAIIDKLIFQTGTADLTEFWIDDVTITAGNSSSETPGENPGYQLVYEEDFENGSLP
FT                   EASSTTNPSIRPSWKLTTGESSLSEIALDTIDNSALKLFDSDTSSQPKAQLIFNPITDK
FT                   ATIEFRLKMESDKVYIDGTNQKASAFCVVFGSTSDGNIATKANEMFRFKTTATVDTASG
FT                   SAISYRKYQYENSDGKSFVTLDAPSYELNTYYTIKFVITLGDTQKTEIYIDGVKVAEGY
FT                   HKKNTNTVDTILFQSGSMDLTNYWIDNVKIYQGHNV"
FT   sig_peptide     623046..623141
FT                   /locus_tag="Cphy_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            627945..630125
FT                   /locus_tag="Cphy_0493"
FT   CDS_pept        627945..630125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0493"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: cbe:Cbei_0287
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40880"
FT                   /db_xref="GOA:A9KI46"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI46"
FT                   /protein_id="ABX40880.1"
FT                   /translation="MKKKRMQKVKKESKENTWGKSTEDSKSDNRKENTKVENTKKERTK
FT                   KEKTKFTIFWKICLGYLVPIFFILLLGIISYQKASEGLIHNYEEATSQTIRMTSNYLGL
FT                   ITDTVEAVAIEYINDKDLNNYVNGGKYDVTKFVEFMDKTTRKLSNVVTSNEYIMNAHII
FT                   PRESYNLFTSSKNGNKGFYSSLEGQGELAMFQDDAVNDAWIGSHPEIDRELGLNGNSYF
FT                   MSYVRSIRSFSQRNAVVVIDVSYEALHKQLSQLSFGENSIVGLVTRDGRELALDEHGDI
FT                   ISDVVFAGNVDVDILSDGDKERDTYVKYDGQDYFLMQQRVSDTNAFLCALVPKALIMRQ
FT                   ALEIKNIVLIIVSLACIAAIVVGIMISKGISQGVTKLNRKLQQIAEGDLTTRIDLKRRD
FT                   EISEVAHNTEKMVDSVRLLIKKVNEVCGRVLISSDQVISTSNSISSSTDKIAGAIHEID
FT                   IGISEQAVDSQNCLVQVDDLSNSILLINQHVNGTEILVSKTRESIHRSLEKMNLLTEKS
FT                   TKTSGITENVVNNINELSRQSTTIDSIVSVIDEIAEQTNLLSLNASIEAARAGEAGKGF
FT                   GVVSEEIKKLALRSKELAGQIKSIVSNIHKQTSETVTITKQAKVMVSEEANLMKQTIDS
FT                   FVEMEDGMNVLLDIMMKISTDIENMNTMRTVTLEAIENISAVSEQTCAASGTVNDTMQM
FT                   QVKKVVDLQEVAKELKMNVNDLEESITKFKID"
FT   gene            630357..631754
FT                   /locus_tag="Cphy_0494"
FT   CDS_pept        630357..631754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0494"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: gtn:GTNG_0824 sugar transport system sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40881"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI47"
FT                   /protein_id="ABX40881.1"
FT                   /translation="MKFIKNSVLSILFVVVMLIGLTGCDNLKRNSASSLESKVEEKKKK
FT                   IVTVWTKDRHDAEFQLEKIEEYNASNSDNIEIRYSIFSDNYLQAVDLAFQSNSAPDILV
FT                   FTSQVFNNYVVSDQFADLTPFMDKEFKETFSSSMIEGLNVIDGKCYYIPTAATICRLFY
FT                   NKDIFERVGVLEPPRTLDEMVEIAQKITKELSGEGIYGFSANMKYPNSALNRSLMPMAQ
FT                   MGLGIRSGFDFKKGVYDFSGYQTILEEWRTLLSPECAYPNSDSLDIDPLRKLFAAGKIG
FT                   MYMSYAHSELGVYENQFPMEQEWRCTEIPVVGGIILGAQNYSLNNGYLFNAKSKNLDAA
FT                   WKAYVSVFADIDNLAEYHSQGLGISTVPKVLERATLNQSYIDNPALLVGENDKIWPKVP
FT                   HEANVNAIVVDGLDMYNTFAELIYGTMDIKEGLSDLTKRYNKAYQEGINSGIGEVYKID
FT                   DFDPLNP"
FT   sig_peptide     630357..630428
FT                   /locus_tag="Cphy_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.707) with cleavage site probability 0.618 at
FT                   residue 24"
FT   gene            631901..633715
FT                   /locus_tag="Cphy_0495"
FT   CDS_pept        631901..633715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0495"
FT                   /product="histidine kinase internal region"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase internal region; KEGG: cbe:Cbei_4458 histidine
FT                   kinase internal region"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40882"
FT                   /db_xref="GOA:A9KI48"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI48"
FT                   /protein_id="ABX40882.1"
FT                   /translation="MKRFIKNTKFKTKIILLFLTLLLLHSTIAGTLYYKYTYKDTLSNY
FT                   YQSSEDTIYQLNVHMYSRFRSIAKSVNALSNNMSFANPMSVFLRNPDTLNYAKLMGDVA
FT                   DSITEMQMSDDYIHSIYIYTKYGDFDNFVRIKKHGIKFEETEVYQYFEEHPDETVAWFP
FT                   AMENPVFIGTDIVIPIVYKFAIGRENIFILINLDQSKISDYLNETYNSYEKIFIVDKNG
FT                   KNIINLDDKYKEIPLIRHQGDDLDEMALCQPLKIGEDDYLVTSTMMKGNSWEIYALKST
FT                   ESLLGNLTSLRKFISLELSISALLALFIIILCVRSLTAPLGRLVNIMDKTIKEGFHIKF
FT                   HYPYKDEVGNLAKSFNYMVEEIEGLVTELNLHIEALKEEKEALKVVQEQKRIAEIKALQ
FT                   AQINPHFLYNTLNTITWQAADQGAKEISILSKSLGSFFRIALSKGREIITIREELEHVK
FT                   SYLEIQKIRYKSKINYSIEIDDEIKDCSIIKILLQPLVENAIYHGIKTKEGHGNISIAA
FT                   VMKMDELTIPAIKLCVEDDGLGIEKNQLEILNAGLSKGIVDSKNGYGIYNVNQRLKLTY
FT                   GEIYGLSLESKLGEWTRATIIIPVQKLD"
FT   sig_peptide     631901..631990
FT                   /locus_tag="Cphy_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 30"
FT   gene            633810..635441
FT                   /locus_tag="Cphy_0496"
FT   CDS_pept        633810..635441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0496"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; response regulator receiver; KEGG: cbe:Cbei_4431
FT                   response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40883"
FT                   /db_xref="GOA:A9KI49"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI49"
FT                   /protein_id="ABX40883.1"
FT                   /translation="MYQIIIADDEEDVREILARNINQSGKEFQVIGTAENGVDALRLVK
FT                   ELNPSIVITDICMPVLGGLELIKSIQDFDPSIKTVVISGHDEFSYAKKAMALGVTEYLL
FT                   KPFLPEELFEVLYKIKDNLDHQIALTKNITKMQNQIEKNLIYSQERFLKKVIEGSYQES
FT                   EIILEGENVQIDLTAKVYCTGIFKVSVNTGHHAKELNGDRVIADFFSIIKEQYFDPEIK
FT                   IYAISFEENQIVLIFCGACRNHLLFFKHIEQGIEKINESMERYYHTKVNGVLGNAYESI
FT                   EKISISYQEALSAWKRVLDFKVNIVRYDEGKKRNDTEEIGIRQKPKELELSLLLHIQMN
FT                   RREKALEALQEIFVSYASYGIEYMEFVNVSLVELVFRISESLAKAGGNLGVWEDDKVIH
FT                   YLKRHFTYGSLMEAKSVLEDYIIRCCEEFSIINEKQSEKIVYNVKMLIENNLSNEEFNI
FT                   EEASAQLFFSHNYVRQVFKQKTGESFNDYLFRRRMEVALELLKNPSQKIREIALSIGYS
FT                   NQRYFASCFKKYYNCTPTEYREKLGI"
FT   gene            complement(635568..638291)
FT                   /locus_tag="Cphy_0497"
FT   CDS_pept        complement(635568..638291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0497"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; KEGG:
FT                   cno:NT01CX_1810 penicillin-binding protein 1A/1B"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40884"
FT                   /db_xref="GOA:A9KI50"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI50"
FT                   /protein_id="ABX40884.1"
FT                   /translation="MDFSRKGVIKKQRNIKSTSKRLNTKIRITLFRVSMISIVCLGIVG
FT                   VIAISGAMKGIIGSAPDIGQVNIDPEGFASYIYYSDGTLAQKLIGAESNRVLVSIDKIP
FT                   DVLQHAFVALEDERFYEHDGIDVYGIFRAGFSVLKTKDLGFGGSTITQQLIKAKVFNYG
FT                   NEPNAVDKIVRKIQEQYLAIKLEDIYTKDEILEAYLNNINLGNGTYGVQTAAQSYFGKD
FT                   VSELTLSEASVIAPIALSPVFRNPINYPAMNAERRQSCLDNMLRLGYITQKDYDAALAD
FT                   DVYSRIKQYNEEKAPSTYYSYFTDAVINQVLSDLQTKKGYTQDDASYMLFSNGLKIFST
FT                   QDKTIQGIVDKYFQDESNFPAIGEGSYYEMKYELSVYDDEDNATHYHFNDMLEYFKDFK
FT                   DTEGLYFHEPYTPKVGINSLGYSKEDMEAKIEEFRNSKVKENQVYVEKKEITLQPQTSM
FT                   TIMDQHNGNVVALYGGRGTKTGNRTTNRASSSKRQVGSTFKVLASFLPALDSGRYTLAS
FT                   VMDDSEYTYPNGKDTVTNWNKKYKGLSTMREGIYNSMNIIACRFMEAVTPRKGFDYLTS
FT                   LGFDLVELKVKNGKTYTDIGVSLALGGITDGVTNVELTAGYAAIANGGVYNEPIYYTKV
FT                   VDQNGKVILSNEPSSKQVMYTSTAWLLTNAMEDTIKRGTATSIGFRNYSMPIAGKTGTS
FT                   TKDYDLWFVGYTPYYTSAIWTGFDYNFPQKEKSYHKVMWRNIMEEIHSTLKLENKAFVK
FT                   PDSIVTARICTKSGQLAVPGLCDKALSGDCTRTEYFAKGTVPTQTCTVHQKVSICKVSG
FT                   YFASPYCPLDSLVEKVFLIKDEKGSTDDKPYLLPTGDITNPCPIHSEGTVAPPTDEEDN
FT                   ETPIEPENPDDGNENPVEPTTTPPPVIIIPPTDNQP"
FT   sig_peptide     complement(638127..638291)
FT                   /locus_tag="Cphy_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.415 at
FT                   residue 55"
FT   gene            complement(638612..641344)
FT                   /locus_tag="Cphy_0498"
FT   CDS_pept        complement(638612..641344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0498"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; KEGG:
FT                   cno:NT01CX_1810 penicillin-binding protein 1A/1B"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40885"
FT                   /db_xref="GOA:A9KI51"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI51"
FT                   /protein_id="ABX40885.1"
FT                   /translation="MDFSRKGVVKKQRDIKSTSKRLNTKIRITLFRVSMICIVCLGIVG
FT                   VIAVSGAVKGVIESAPDIGQVNIDPEGFASYIYYNDGTLAQELIGAESNRILVSIDEIP
FT                   DVLKHSFVALEDERFYQHDGIDVYGIFRAGFSVLKTQGLGFGGSTLTQQLIKIKVFNYG
FT                   NEANAVDKIVRKIQEQYLAIKLEDIYTKDEILEAYLNNINLGNGAYGVQTAAQSYFGKD
FT                   VSELTLSEASVIAPIALSPVRCNPINYPETNAKRRESCLDNMLRLGYISQKEHDDALAD
FT                   DVYSRIKQYNEEKAPSTYYSYFTDAVIDQVLSDLQTKKGYTQDDASYMLYSGGLKIYTT
FT                   QDKTIQGIVDKYFQDEKNFPAVGEGSYYEMKYDLSVYDDEDKVTHYHFNDLLEYFKDFK
FT                   DTQSLYYHDPYSSKVGINSLGYSKEDMEAKIEEFRNSKVKGDQVYVENKQITLQPQTSM
FT                   TIMDQHNGDVVALYGGRGNKTGNRTTNRASSSKRQVGSTFKVLASFLPALDSGRYTLAS
FT                   VMDDSEYTYPNSTDTVTNWNKKYKGLSTMREAIYNSMNIIACRFMEAVTPRKGFDYLTS
FT                   LGFKLIELKVMDNGKTYSDIGVPLALGGITEGVTNVELTAGYAAIANGGVYNEPIYYTK
FT                   VVDQNGKVILSNEPSSKQVMYTSTAWLLTNAMEDTIKRGTATSIGFRNYSMPIAGKTGT
FT                   STKDYDLWFVGYTPYYTSAIWTGFDYNFPQKEKSYHKVMWRNIMEEIHSTLKLENKAFA
FT                   KPDSIVSARICAKSGQLAIPGVCDKALGGDTTRVEYFAKGTVPTQTCTVHQKVSICKVS
FT                   GHFASPYCPLDSLVEKVFLIKDEKSQTDDTPYILPTGDMTTPCPIHSEGTVAPPTDGED
FT                   NETPIGPENPDEGNKIPVGPTTTPTPPPVIIIPPTDNQP"
FT   sig_peptide     complement(641198..641344)
FT                   /locus_tag="Cphy_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.453 at
FT                   residue 49"
FT   gene            complement(641556..642212)
FT                   /locus_tag="Cphy_0499"
FT   CDS_pept        complement(641556..642212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0499"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: gka:GK3152 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40886"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI52"
FT                   /protein_id="ABX40886.1"
FT                   /translation="MQTSYKTVYAGGTSEIIEKKSRFIATVIPIKSEEEALSFIEQMKK
FT                   KNWDASHNCSAYVLGLNQELQRCSDDGEPSKTAGRPMLDILLGEGIHNTAVVVTRYFGG
FT                   TLLGTGGLVRAYQSAAKEGLANSIIIEKHFGKQYEITTDYNGIGKLQYIAGTMNLTILS
FT                   TDYTDIVKATLLIPPDAFGSFQKKITEATNGRAVMEELADVYYAFLDQEILIENA"
FT   gene            642483..643010
FT                   /locus_tag="Cphy_0500"
FT   CDS_pept        642483..643010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0500"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: cbh:CLC_2550 VanZ
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40887"
FT                   /db_xref="GOA:A9KI53"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI53"
FT                   /protein_id="ABX40887.1"
FT                   /translation="MKLLMNENTSKKQRLMAAVPMLLMMVLIFLFSAKTATESDGTSLP
FT                   IAKGLLNTYQSLFGKMGKDSYDVSLRVANVLTRKAAHVTEYGILSILVSYYIWVRGHRG
FT                   KQFFFLTILISVGYAITDEIHQLFVPGRAGRITDVLIDSSGCIMGALFFLLIYHLIKNR
FT                   SLKKQLSRQLIK"
FT   sig_peptide     642483..642590
FT                   /locus_tag="Cphy_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.859 at
FT                   residue 36"
FT   gene            complement(643059..643232)
FT                   /locus_tag="Cphy_0501"
FT   CDS_pept        complement(643059..643232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pdi:BDI_1526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40888"
FT                   /db_xref="InterPro:IPR025346"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI54"
FT                   /protein_id="ABX40888.1"
FT                   /translation="MLPTDPIMLLSYVNTKLRDEFQSLEDFCQSLDVNVVTLIDTLDKI
FT                   DYHYSKERNQFI"
FT   gene            643428..644762
FT                   /locus_tag="Cphy_0502"
FT   CDS_pept        643428..644762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0502"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: chy:CHY_2201 ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40889"
FT                   /db_xref="GOA:A9KI55"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI55"
FT                   /protein_id="ABX40889.1"
FT                   /translation="MDLFEYMRENTKEKESPLASRLRPTKLTEVVGQSHIIGEDKLLYR
FT                   AIMADKLGSVIFYGPPGTGKTTLAKVIANTTSSNFQQINATSAGKKDMEAVIEQAKQTL
FT                   GMYGKKTILFVDEIHRFNKGQQDYLLPFVEDGTIVLVGATTENPYFEVNSALISRSIVF
FT                   ELKPLEQNDIKELLIRAITDKEKGLGAYHAVMEDDALDFLANAANGDARSALNAIELGV
FT                   LTTKRSEDGFIHITLEVASECIQKRVLKYDKSGDNHYDTISAFIKSMRGSDPDAAIYYL
FT                   AKMLYAGEDVAFIARRIMICAAEDVSNADPNALVVATAAAQAVERLGMPEGRIVLAQAV
FT                   TYVACAPKSNSAIVAIDEASELVAKDKTPPIPPHLQDAHYKGAAKLNHGVGYLYAHNYE
FT                   NHYVKQQYLPDPYVGRTFYRPSDNGYEKAIKEYFRKIKGNETDSF"
FT   gene            644853..645194
FT                   /locus_tag="Cphy_0503"
FT   CDS_pept        644853..645194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40890"
FT                   /db_xref="GOA:A9KI56"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI56"
FT                   /protein_id="ABX40890.1"
FT                   /translation="MKTSKENNTSGTDNTNSTGNTSKAKRVLSMIGIIILLGLYLFSLV
FT                   AAIMAKPYANGLFLTSIYATVIIPVFIYVFLLMNRTFGKKNDGYTMHEINKMKKKGFQE
FT                   ANKTDKEDN"
FT   sig_peptide     644853..644993
FT                   /locus_tag="Cphy_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.575 at
FT                   residue 47"
FT   gene            645905..646405
FT                   /locus_tag="Cphy_0504"
FT   CDS_pept        645905..646405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0504"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   cno:NT01CX_0951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40891"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI57"
FT                   /protein_id="ABX40891.1"
FT                   /translation="MSLLTDWRDVAYAEDMDQKTGQIFWGNYFTIEKGIYEQLLSNPEE
FT                   VVTGTVEELAKKYNTTLQIMVGFLDGINESLKEPNPIETMEANTVVNLGFDLEKLYYNM
FT                   VEASADWLYTLPQWENLLDDSRRKELYLTQKKSGTVVKEKKVGRNDPCPCGSGKKYKFC
FT                   CGK"
FT   gene            646539..647039
FT                   /locus_tag="Cphy_0505"
FT   CDS_pept        646539..647039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bth:BT_4765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40892"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI58"
FT                   /protein_id="ABX40892.1"
FT                   /translation="MPNIAIMKISTYHKAQGHDVDWYNPVIDIMDTDILYECQLFNFTA
FT                   PYQYYPVRAKIIRGGTGVDIKSHLPKEIEQILELDYSLYPDCDYSMQFFSRGCIRNCHF
FT                   CVVRDKEGYIHEVEPMLLNPKGKHIEVLDNNFFANPNWNKAVDYIINTGQKVSLHGVDY
FT                   GYL"
FT   gene            647014..647556
FT                   /locus_tag="Cphy_0506"
FT   CDS_pept        647014..647556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40893"
FT                   /db_xref="GOA:A9KI59"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI59"
FT                   /protein_id="ABX40893.1"
FT                   /translation="MVWTMDIYNNLLNLTIGIIGGIFSSIIVSRIFLITADYKEQIQRV
FT                   QTHVEVLYCLSGYLYCSKVMMKEAKEISLAQKEKLILILEEEKTRFSQMIFDDLEKELH
FT                   KIAIDMNDFIEGFKINKMNEQYIKNSRDELDGIIYRFTIYKNDSRIKMRKLLIRDNVLR
FT                   ILLFVFIVIIILTIVSR"
FT   gene            648281..648649
FT                   /locus_tag="Cphy_0507"
FT   CDS_pept        648281..648649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40894"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI60"
FT                   /protein_id="ABX40894.1"
FT                   /translation="MFDMERYEIMFDTERYEIMFNAEKSVDFDLDIVVNSWAAAAKAVQ
FT                   AKTGIFVNAQFVEKMIAYHESNLSERVVAATATRNPTVITDKELFFDALIEVINNTKLI
FT                   LGNPYTSLTRLPAEVIVM"
FT   gene            649202..649936
FT                   /locus_tag="Cphy_0508"
FT   CDS_pept        649202..649936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40895"
FT                   /db_xref="GOA:A9KI61"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI61"
FT                   /protein_id="ABX40895.1"
FT                   /translation="MFQLFKKIWQNRIGKIILLVLSSIVLVMFLIWYITLFNQKVIYFN
FT                   GERLIQTKLTNSTQYKGNYLSEPILITVQNQNTGEIIVEYNLPNKLYFSYLVYFENGNN
FT                   YGKKIRILEDNNELFNGIYNNNSPFNLLTNDLEPYFDNDLRVVSNNNFYPGDFKPSLNT
FT                   TAEFATGNGVENRGKIYPLIMFFVVLIIYFIDIKFPLFFFTLHNFLSVKDPEPTEFYLY
FT                   MQKLGWYVIYPIFLIVLLFMGI"
FT   gene            complement(650047..650415)
FT                   /locus_tag="Cphy_0509"
FT   CDS_pept        complement(650047..650415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0509"
FT                   /product="membrane protein"
FT                   /note="KEGG: cac:CAC1316 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40896"
FT                   /db_xref="GOA:A9KI62"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI62"
FT                   /protein_id="ABX40896.1"
FT                   /translation="MKTARLVIGIISMVLFAFVSFQSCAAGVGNALVNNGESSGSAGML
FT                   IAFCFLIAGIVGVATRNKGKGGPMTAGVFYALGGIMGLATSSTLYGDLKIWAILSLIFA
FT                   AVFILGALKQKTENVPNA"
FT   sig_peptide     complement(650338..650415)
FT                   /locus_tag="Cphy_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 26"
FT   gene            complement(650678..651022)
FT                   /locus_tag="Cphy_0510"
FT   CDS_pept        complement(650678..651022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0510"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   chy:CHY_1697 putative prophage LambdaCh01, repressor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40897"
FT                   /db_xref="GOA:A9KI63"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI63"
FT                   /protein_id="ABX40897.1"
FT                   /translation="MNFNIRLKQLRQKHKLTQSELAEILGLKPTAVSNYESRRNEPSFE
FT                   KLIALSRYFDVSCDYLLGISDAYLPVGGEVLDKDIVDFFNLYQQLDSNNAAELKNFANY
FT                   LLYKQESSNE"
FT   gene            651219..652691
FT                   /locus_tag="Cphy_0511"
FT   CDS_pept        651219..652691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0511"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: cth:Cthe_0806
FT                   PAS/PAC sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40898"
FT                   /db_xref="GOA:A9KI64"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI64"
FT                   /protein_id="ABX40898.1"
FT                   /translation="MSKIPYDLVLKHCAEGVFIFDQTGQIFYANDAAMQETGYMDKLVD
FT                   TNILDIFPKALKVHMDNMIINRFEVEEVKETMEYSIIETFAYRKNQTCYPVRMKLLWGE
FT                   KEKDNFSVCITRNMTELNAVMKREKNVKEELKEATGVKNEFLANITHELRTPVNGMKGL
FT                   ADVLLGTELTQNQRENVNIIRRCCDNMTNIINGILDFSKITAGKMQLENKVIDISNFLK
FT                   NTLSYHIPKLNEKGLKLQVNIGDNVPKKILGDELRLEQILSNLISNAIKFTSVGQLVIE
FT                   VINTDQKEDEVELFFMVIDSGIGISKEDMDKLFQSFSQVDGSITRRYGGTGLGLAISKS
FT                   LVELMGGTIHVSSEIGRGSTFSFSIRFKVVKEDYDIETEPKLDGNNGFTMENTTWNVIS
FT                   GDRQNVRAPRLSEPYVLDKVAIAEHLEKLIICVELETWEKAENFASIIKRMIPESEQEG
FT                   RKNAFRLELAVRKEDYEGTQKQIKKLQDYLQS"
FT   gene            652706..653812
FT                   /locus_tag="Cphy_0512"
FT   CDS_pept        652706..653812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0512"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /note="PFAM: response regulator receiver; metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; KEGG: gme:Gmet_2999 response
FT                   regulator receiver (CheY-like) modulated metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40899"
FT                   /db_xref="GOA:A9KI65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI65"
FT                   /protein_id="ABX40899.1"
FT                   /translation="MIDRIYGVDGLEIGEQIIQEANILIVDDVIANLIVLTEMIRKSGY
FT                   VARPVTSVKQATQAIEATLPQLILLDISMPDMDGFEWCERLKKDAKTRDIPIIFISALN
FT                   STEDKIRGFNLGAVDFISKPFEHEEVSLRISTHLKIHRMQQELEMYNQKLQKLVKEQME
FT                   KIETEEKNLIYAMARMCEARDKGRENHIENIGKNCRLLAMSLHFSGLYEEEITQDYIDT
FT                   IELASALHDIGKIFIPDNILQKRGKLTIDEDRVLKSHAELGAKNLSEAYAQSEYNDFLK
FT                   MAIDIAKYHHEKYDGSGYPMGLRGKEIPLSARIVAVVNKYDNLLRDSADEGEEAHKEAL
FT                   QRMKLEANRSLDPDIIEVFLKIQRQLKR"
FT   gene            654074..655546
FT                   /locus_tag="Cphy_0513"
FT   CDS_pept        654074..655546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_4521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40900"
FT                   /db_xref="GOA:A9KI66"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI66"
FT                   /protein_id="ABX40900.1"
FT                   /translation="MRKKDRYLDFDAKRRKLKFTRRRIKGFQNRGVLALLILVIALGLG
FT                   TCVFFFLKAKMDRIGKKELSENQLIKQQLEELSGRTASGPYGMWIAKPIGEKLLEPVED
FT                   QEVWMTNFKDTRKAVKAKGIYITASRANNNIDDLLKLVDDTELNAMVIDIKDDEGRITY
FT                   QMQYQPAIDINATRGYISDINGLISKLKEHDVYLIARVVAFKDPVLADKRPELALKLKD
FT                   GSTFRDKDKLAWVNPYKKEVWDYLVGVASQCASLGFDEVNFDYIRFSTDSGMANVDFGV
FT                   EATTKTKIETITEFVKYACEQLRPLGIFVSADVYGAIISSSVDAKIVGQSYLEMSKYLD
FT                   YICPMIYPSHYGEGYYGIKYPDTEPYNLILAALDASRKALNQIPEGEHKALVRPWLQDF
FT                   TAPWIKHYIRYGSKEVREQIEAVYDSDYSEWLLWNGNMNYTKEALYTEEEAAIQYANRP
FT                   TPTPLPMPSSIPLPTRVPNSGKYYDSPWKSGN"
FT   sig_peptide     654074..654238
FT                   /locus_tag="Cphy_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.890 at
FT                   residue 55"
FT   gene            655666..656220
FT                   /locus_tag="Cphy_0514"
FT   CDS_pept        655666..656220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0514"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: cbe:Cbei_1302 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40901"
FT                   /db_xref="GOA:A9KI67"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI67"
FT                   /protein_id="ABX40901.1"
FT                   /translation="MTDEEILSLINKKNQLGLSLLAEKYEKLLVYIAAGILGNHVRDIE
FT                   ECVNDTYFKFWKNAEKYDYTKASLPTYLKVIVRNTAINRLRDVRRHEDRTHSEDVAELA
FT                   SVLPDVSVNIENQMLRKENVKRLNKMIASLPEKDRELMIRKYYYVQSSKVIAHAMSMSV
FT                   TAVDSRLSRLRTKMKNEYQLT"
FT   gene            656236..656652
FT                   /locus_tag="Cphy_0515"
FT   CDS_pept        656236..656652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40902"
FT                   /db_xref="GOA:A9KI68"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI68"
FT                   /protein_id="ABX40902.1"
FT                   /translation="MTENYLIDLMGDLETRFLENEYPERDIQKQTAIAKRRRTLMPFKK
FT                   GNVFVISDTLYRTINEQRELYDNIVAHEPVLERAAHAKEHVKQKVDAVQAKIKALVAVV
FT                   SGIIAMAVVIISLIRMVAKKKWLNKLFGKRVQTA"
FT   gene            656934..657851
FT                   /locus_tag="Cphy_0516"
FT   CDS_pept        656934..657851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0516"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG: cth:Cthe_0935
FT                   malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40903"
FT                   /db_xref="GOA:A9KI69"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI69"
FT                   /protein_id="ABX40903.1"
FT                   /translation="MKQVAFLFPGQGAQYTGMGKDFYDTYKESKEVFELASDILSLDMT
FT                   KLIFEEDERLHITEYTQVAMVTTMTAMLMAVKEKNITPAVCAGLSLGEYVALYQSKVLS
FT                   LKDVIYLVRKRGIYMQEAVPVSVGTMAAVLGLNNELVEEICANTEGIVTVANYNCPGQI
FT                   VISGEKHSVEAAKISLEKAGAKRVLPLNVSGPFHSPMLLPAGEKLRKELEVITINDPVI
FT                   PYVANTTAEYITSKEPIVDSLAAQVSSSVRWQQSVEKMIANGITTFVEIGPGKTLSSFV
FT                   KKIDRTMQVINIEKIEDLDKLDAL"
FT   gene            657952..658692
FT                   /locus_tag="Cphy_0517"
FT   CDS_pept        657952..658692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0517"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; KR domain
FT                   protein; KEGG: bha:BH2491 3-oxoacyl-(acyl-carrier protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40904"
FT                   /db_xref="GOA:A9KI70"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI70"
FT                   /protein_id="ABX40904.1"
FT                   /translation="MLENKVAVVTGASRGIGRQVALTLASYGATVVVNYCGSKERAEEV
FT                   VQKIISEGGKAIAYQADVSDAKATEAMFADILAEFKQVDILVNNAGITRDNLIMKMSEE
FT                   EFDVVIDTNLKGCFHCIKQVTRPMLKQRSGRIINISSVVGVIGNIGQINYCASKAGVIG
FT                   MTKSAARELGSRGITVNAVAPGFIQTEMTDVLPENAKEMVLTQIPLKKFGEVTHIAETV
FT                   AFLASDKAAYITGQVIQVDGGMGM"
FT   gene            658744..659979
FT                   /locus_tag="Cphy_0518"
FT   CDS_pept        658744..659979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0518"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 2"
FT                   /note="TIGRFAM: 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   2; PFAM: Beta-ketoacyl synthase; KEGG: cbf:CLI_3824
FT                   3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40905"
FT                   /db_xref="GOA:A9KI71"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI71"
FT                   /protein_id="ABX40905.1"
FT                   /translation="MKRVVVTGMGVITPIGKNVEDFWSNIKSGTTGFGPITYFDTTDYR
FT                   AKLAAEVKDFNAADYMDGKSARRMEKFCQYAVAATKEAIESSGLDLTKEDRTRIGVSVG
FT                   SGIGDLVIIEKEYEKVLNNGPKRTNPLFVPLMISNMAAGNVSINFGLKGKCINVVTACA
FT                   TGTHSIGEAYRAIQCGDADVMVCGGTEAAISKLGIAGFGALTALSSSEDPKRASIPFDK
FT                   ERNGFIMGEGAGVVVIESLEHAKARGANILAEVAGYGATADAFHITSPAEDGEGAMRAM
FT                   LLAVKEAGLKPEDVDYINAHGTSTHHNDLFETKSIKAAFGEHAYHLNVNSTKSMTGHLL
FT                   GAAGAVEFIVCVKSVQEDFIHATVGYSVPDEELDLDYTKEARTDKKVNVAISNSLGFGG
FT                   HNGTLLVKKYVE"
FT   gene            660000..660431
FT                   /locus_tag="Cphy_0519"
FT   CDS_pept        660000..660431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0519"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: sgo:SGO_1691 acetyl-CoA
FT                   carboxylase, biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40906"
FT                   /db_xref="GOA:A9KI72"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI72"
FT                   /protein_id="ABX40906.1"
FT                   /translation="MEIKDIIDLIEAVSSSKLTSFTYIEGETKLSFELNHELLITDASK
FT                   VVAATAISEQDCILKDTVPCNIITSPMVGTFYCAKGEGEEPFIQVGDKVIKGQVVGIVE
FT                   AMKLMNEIESPYDGFVEEVLVKNQEMVGFDQKLVRIRPL"
FT   gene            660574..660999
FT                   /locus_tag="Cphy_0520"
FT   CDS_pept        660574..660999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0520"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; KEGG: cbh:CLC_3575
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40907"
FT                   /db_xref="GOA:A9KI73"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI73"
FT                   /protein_id="ABX40907.1"
FT                   /translation="MVLNCNEIMDIIPHRSPFLLVDRILELVPGIRAIGRKCVTFNEPF
FT                   FTGHYPGNPVMPGVLIIEALAQVGSVVMLSLEENKGKVPFFGGIDKAKFRNMVTPGDVL
FT                   TLEVSLLKQKGPVGVATAKAYDDEKVFAEAELTFVIR"
FT   gene            661081..662427
FT                   /locus_tag="Cphy_0521"
FT   CDS_pept        661081..662427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0521"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; RimK domain protein
FT                   ATP-grasp; KEGG: cbf:CLI_3821 acetyl-CoA carboxylase,
FT                   biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40908"
FT                   /db_xref="GOA:A9KI74"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI74"
FT                   /protein_id="ABX40908.1"
FT                   /translation="MFKKILVANRGEIAVRIIRACREMGIQTVAIYSTADEQALHAQLA
FT                   DEAVCIGPAYAKDSYLKMERILSATLASGAEAIHPGFGFLSENSKFAQLCEKCNIAFIG
FT                   PNKDVIDRMGDKACARNTMMEAKVPVVPGTKEPLHELKRAKALANEIGYPIMIKASAGG
FT                   GGRGMRIVHSEEEFDNLFETARQEAKNAFGDDTMYLERYISGARHIEFQILADQFGNVV
FT                   HLGERDCSVQRRHQKMIEEAPSAALNESLRKEMGEVAVMAAKAANYTNAGTIEFLLDDK
FT                   GRYYFIEMNTRIQVEHGITELVTGIDLIKEQIKIAAGEPLSFKQEDVRIAGHAIECRIN
FT                   AECPERGFLPSPGTVTEFHMPGGFGVRIDTMLYEGYTIPRYYDSLIAKVMVHDKTREEA
FT                   IAKMQGVLGELIIDGIETNTDFLYQLIQNKQFQTGNITTNFIEQFLGKE"
FT   gene            662529..663455
FT                   /locus_tag="Cphy_0522"
FT   CDS_pept        662529..663455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0522"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, beta subunit; KEGG: cac:CAC3569 acetyl-CoA
FT                   carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40909"
FT                   /db_xref="GOA:A9KI75"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI75"
FT                   /protein_id="ABX40909.1"
FT                   /translation="MGMFKKTGNASEKETRRNEKVKNIMNEPQVPDGLFQKCEKCGEII
FT                   YAEDIIANYYICPNCNNYFRIAPKTRLSMVLDKGSFIEYDVNLPISNPLDFPGYEAKLS
FT                   HMKSVNNLDEAVITGEGKICGASVSIGAMASTFLMGSMGGVVGEKITRLIEKATEKRQP
FT                   LILFCCSGGARMQEGIISLMQMAKTSAALKRHSDAGLIYIPILTDPSTGGVVASFAMLG
FT                   DVILAEPGALIGFAGPRVIEQTIGQKLPEGFQRAEFLLEHGFVDKIVKRSRLKQVLSFL
FT                   IKTSMNPSYESLYEEEQEETTELNEFL"
FT   gene            663483..664382
FT                   /locus_tag="Cphy_0523"
FT   CDS_pept        663483..664382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0523"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="KEGG: cac:CAC3568 acetyl-CoA carboxylase alpha
FT                   subunit; TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; PFAM: acetyl-CoA carboxylase
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40910"
FT                   /db_xref="GOA:A9KI76"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI76"
FT                   /protein_id="ABX40910.1"
FT                   /translation="MENNISAWERVKIARGTERPTSIDYMSHIFDRFLELHGDRYCGDD
FT                   GAIVGGIATIDGIPVTVIGQQKGRNIKQNMKRNFGMPNPEGYRKALRLMKQAEKFHRPV
FT                   ICFVDTPGAFCGIEAEMRGQGEAIAKNLYEMSSLKTPILSIVIGEGGSGGALALAVADE
FT                   VWMLENATYSILSPEGFASILWKDSKRADEAAAIMKITADDLLELKIIDQVFPELSLEE
FT                   TEKEAMSLLGDESEPVSEFITDIEEKDGDNEIKRTLNTGNMEHVAWSLKQGILEFVKRY
FT                   SDKGETLIETRYQRFRKY"
FT   gene            664806..665345
FT                   /locus_tag="Cphy_0524"
FT   CDS_pept        664806..665345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0524"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: cdf:CD0825 rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40911"
FT                   /db_xref="GOA:A9KI77"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI77"
FT                   /protein_id="ABX40911.1"
FT                   /translation="MANLKGTKTEANLKAAFAGESEARNKYTYFASKAKKEGYEQIAAL
FT                   FLETAENEKEHAKLWYKLLHNGIGDTTQNLKDAAAGENYEWTDMYAGFAKEAREEGFGH
FT                   IADLFEGVAKIEKEHEERYLKLLENVEKGLVFSKDGDSIWQCRNCGHVIIGKEAPQLCP
FT                   VCAHPQAYYQVKAENY"
FT   gene            complement(665552..667120)
FT                   /locus_tag="Cphy_0525"
FT   CDS_pept        complement(665552..667120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0525"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; response regulator receiver; KEGG: cpf:CPF_0555
FT                   DNA-binding response regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40912"
FT                   /db_xref="GOA:A9KI78"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI78"
FT                   /protein_id="ABX40912.1"
FT                   /translation="MIRTIIVEDDIEMLNGLLHIIAWEDYGYLIVGKAENGAEALNIVK
FT                   EKSPDLIITDITMPKMNGLDLIKSAKEFKSGIKSIIISCNEDFNYAREAIKLEADDYIL
FT                   KHTLTKESLINTLEQFRRKFVEERQQQTSFEDAIHKLKANKFILLEQFFSDISEGILAR
FT                   DQEILHQAKKMNVKLPEKNMRIISLYIDNLESVITDHPIKEYSLLKFAFLNVMEETIDN
FT                   RDGIILFPYNRGAFGILYDDTLISTNTVQQLIKKLISNATSFLRLPLSACFSNVFHSVK
FT                   DIGKILRQNEVLRSYYFYSGSLQIITEPPLDAYPIADLYQTYGADFKYLLSLQNKIRLK
FT                   KYTEDLFSRLESTKYDSNSVKQLLRRLEIDMRLFLEKYQINLCTFSLDGDTFDHFKKIF
FT                   FDMIDCMFEQLSKPENKSSRPEIKKVLAYISTHIGEEITCDNMSSYINMNSNYFSRLFK
FT                   NEMGVSFSEYLLNKRIHIATELLKNSDCPIHEISRIVGFESPSYFHRAYKKVTGITPGD
FT                   AREPK"
FT   gene            complement(667117..668901)
FT                   /locus_tag="Cphy_0526"
FT   CDS_pept        complement(667117..668901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0526"
FT                   /product="histidine kinase internal region"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase internal region; KEGG: cbe:Cbei_4458 histidine
FT                   kinase internal region"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40913"
FT                   /db_xref="GOA:A9KI79"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI79"
FT                   /protein_id="ABX40913.1"
FT                   /translation="MERFKLSNISIYKKLLAAFVIIIILPQITSYLIAEQSSKNLIVGQ
FT                   LSSETMSSLQMASDNINTLLKRMTSIALFVNSDKNIKGLIEDETTADNLKNLDRINKFN
FT                   SFIENIAYNMMGTRCYITVITKSGNRYTNWNSSGPSSSAFLEKYTPANLQNKSPGFIWS
FT                   FLDENYIDSDKKAYPYILTLVKNIYDNSGKKLYGTFIISIPEIELSNLTVSSSEQPKTQ
FT                   RAVIDKNNIVISSNQKEWIGKPLSDIISTNIPEEPKGYFITKGDSENIISYSHLDSMTI
FT                   IDVKSYDSITKQLRVTTNRLLLFNFFFILLYLFISALIAKNLVNPIHRLSKKMLDTNFE
FT                   SPIEEPPKKRMDEIGILENTFYIMRENIYKLIQDNQEKEKKKRESDMKFLQSQISPHFL
FT                   FNTLNTIRWAGINNNNQKVADMVLALSNLLRMTIVKENDLITISEEINTLRSYALIIQM
FT                   RHSTQFELICNLPEELLTYHIPKLLLQPIVENSIIHGFENIDSEGIIEISSRTEDQFMI
FT                   LSIIDNGAGMDLNSFDGKNKKEFKFSGIGIKNIDERIKIYFGDKYGIKITSSINQGTTV
FT                   ELWLPSHDIYNDRKEESI"
FT   sig_peptide     complement(668797..668901)
FT                   /locus_tag="Cphy_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.835 at
FT                   residue 35"
FT   gene            669186..670076
FT                   /locus_tag="Cphy_0527"
FT   CDS_pept        669186..670076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0527"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL120664 putative
FT                   permease component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40914"
FT                   /db_xref="GOA:A9KI80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI80"
FT                   /protein_id="ABX40914.1"
FT                   /translation="MKKKMSKEALAAILFLAPSFLGFLVFFLFPVLFSLILSFAKWDMA
FT                   SGISSIKFVGLKNFKIIFKDLWFTDSMKNSIVFTVTTVVIGVSIALILAVILTRAAYFK
FT                   NTLKAMMFLPYISSTVAIAIVWMIVLQPKYGPVNQFLLSIGVNKPPNWLADMKWAMPAL
FT                   IAMYIWQNLGYNMVVYIAGLSSVPTDLYEAAEIDGAGAFSKFRFITIPMVSPTTFFLVI
FT                   MGIINSFKVFDQVNVLTQGGPGTSTTVLALYIYREAFKFYDMGSASSAAWIMFVIIFIV
FT                   TIIQWIGQRKWVTYE"
FT   sig_peptide     669186..669308
FT                   /locus_tag="Cphy_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.723 at
FT                   residue 41"
FT   gene            670088..670933
FT                   /locus_tag="Cphy_0528"
FT   CDS_pept        670088..670933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0528"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL120663 putative
FT                   permease component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40915"
FT                   /db_xref="GOA:A9KI81"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI81"
FT                   /protein_id="ABX40915.1"
FT                   /translation="MTNKAVIRKKIIRIVATLVLGIMALTMVLPLLWMISASMKVEADV
FT                   FKYPVEWIPKRFNVIANYKEVWSGRYNFGIFYLNSIKVTLLTTFLQVLISAMGAYAFSK
FT                   IEFKFRDGLFLLYISMMMIPDQVTIIPKFMIFRSLKLFDKHLGLILLGSFSIYGMFLLK
FT                   QFMTAIPTALSESAKIDGAGHGRIFLRIILPVTKPALATLAMLKFVWTWNDYQNPLIFL
FT                   KTEKLYTIPLGMTKFMTEYTSFYSLIMVAAVCAIIPLLIVFLFGQKYIMDGMMVGAVKG
FT                   "
FT   sig_peptide     670088..670219
FT                   /locus_tag="Cphy_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.623 at
FT                   residue 44"
FT   gene            671066..672460
FT                   /locus_tag="Cphy_0529"
FT   CDS_pept        671066..672460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0529"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: efa:EF2234 sugar ABC transporter, sugar-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40916"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI82"
FT                   /protein_id="ABX40916.1"
FT                   /translation="MRRFSKALALMLGITLVFTGCGAKNSNSGDGSKGNEGNTNNTSTV
FT                   KPTEPAKTDSGKQNTIVVYSWEASLKEQNDKVIAAFESKYPNIKVDMQYPVENDNVKYT
FT                   EKVDLLLLSGEKVDAVLESSVAKCVSKVQRNLYQPLDQFIQAEGINYDDVYSVNSQVDG
FT                   SYYACPIDVTPWFIMMNKDMLDKAGLPVPTSWTWDDYREYAKKLTSGSGLDKIYGSYFH
FT                   TWQNYGLMGVYSTKMDNAYYKADGSLNFDDPNLRDWLEFRYEMENVDETSVPLIDIKTS
FT                   NLAYRNEFFGEKVAMLPTGTWMLAEIKDAEKWPHNFKTCFAPLPTWDNGAEGRTFSDTK
FT                   MFSIPKSSKYPEDAYKFIRFYTTEGAYIRAGGLTAEKNMNLDTILPFIVGENPDALYDM
FT                   DSVKNVLNNPKLEMNAPMTAPGYNAEIDSLFVEEIEKYLVGGETLDDCISNLNERGKYI
FT                   VESFVE"
FT   sig_peptide     671066..671137
FT                   /locus_tag="Cphy_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.708 at
FT                   residue 24"
FT   gene            672748..674523
FT                   /locus_tag="Cphy_0530"
FT   CDS_pept        672748..674523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0530"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: glycoside hydrolase family 2 immunoglobulin
FT                   domain protein beta-sandwich; glycoside hydrolase family 2
FT                   TIM barrel; glycoside hydrolase family 2 sugar binding;
FT                   KEGG: sit:TM1040_3871 beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40917"
FT                   /db_xref="GOA:A9KI83"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI83"
FT                   /protein_id="ABX40917.1"
FT                   /translation="MQKEENGTFQESIHKVNYEDCYRSKMIKSDSLFLDYYREKEYLNG
FT                   TWNYGIDQYDNCLRAKWFEEVYFDEDGRQYPVDFSFDTWETMKVPSCWNTQSEKYFHYE
FT                   GSVVYTRTFRYKNNGEKRVFLKFGAVNYEAKVFVNKQFVGMHQGGSTPFVIEVTGILAE
FT                   DNRIMVVANNTRKRTNVPCENTDWFNYGGIYRDVEIIRMPESFIKDAFLYLVPDGSYNK
FT                   IAGKITLEGSNANSSVQLEIKELQINEVFEVKDGVVEFNLEAHPELWSTENPKLYDVVI
FT                   RYGEDYVKEKIGFREVKVYGTDIYLNGKKILLKGICAHEESVINGKAVTEDEIRENFRL
FT                   AKEMNCNYMRLAHYPHTEKAARIADEIGIMLWEEIPVYWAIEFENPDTYADASNQLSEL
FT                   ILRDRNRASVIIWSVGNENADSDSRLRFMSNLVNKARELDSTRMISAACLVDLKKLCIA
FT                   DRLADVIDIIGLNEYFGWYEPDFSKLIKIFENSKPDKPVIISEFGADARAGARGSMDDL
FT                   YTEDRQLKIYRDQIDTLSKISYVKGISPWILFDFRCPRRLHTMQNYYNLKGLLSADKSY
FT                   KKPAYFLMKEFYRNW"
FT   gene            674706..676121
FT                   /locus_tag="Cphy_0531"
FT   CDS_pept        674706..676121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0531"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   cth:Cthe_1271 carbohydrate binding family 6"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40918"
FT                   /db_xref="GOA:A9KI84"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI84"
FT                   /protein_id="ABX40918.1"
FT                   /translation="MRKQGFNPYLPSWEYIPDGEPYIFNDRVYVYGSHDRFNGYAYCLN
FT                   DYVCWSTPVDDLSDWRCEGVIYKATDVQDNEDRDSCLYAPDVAVGPDGRYYLYYVDSKR
FT                   SIISVAVCNTPAGKYEFYGYIHYADGVNLGEREGDEPQFDPAVLVEGDKVYLYTGFCAI
FT                   GDKSRSGAMATVLSTDMLTIIEDPVIIAPSEPYSKGSGFEGHGFFEAPSIRKRGNTYYF
FT                   IYSSILMHELCYATSKHPTMGFKYRGTIVSNCDIGISTYKPANKPMYYGGNNHGSIMEI
FT                   NGKWYIFYHRHTNGTNFSRQGCLEEISFLEDESIPQVEITSCGPNGGPLKGLGEYHAYI
FT                   ASNLFCDEESIYTDFTGAWMNNQFPKITQDGKDGDEEIGYIANMKASATAGFKYFNCIG
FT                   VKRLKIKVRGYCKGDFEIKTSLNGPVLGKIPVAFSNVWKEYSADITIPDGVHALYITYT
FT                   GEGSASLASFTLE"
FT   gene            676231..677979
FT                   /locus_tag="Cphy_0532"
FT   CDS_pept        676231..677979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0532"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: cdf:CD2247 putative germination-specific
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40919"
FT                   /db_xref="GOA:A9KI85"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017310"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034045"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR041365"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI85"
FT                   /protein_id="ABX40919.1"
FT                   /translation="MDSGKLDNQLNLALDVSNRDREQTQDLDVGYDTETRQWELIVRFN
FT                   GSLQRVADELGFKFEELLGNFAIIVIDQGKIDRLVGYSEIEFIEKPKQLTFEVTAGKAA
FT                   SCISAVQAPPFNLYGEGVIVAVIDSGIDYAHPDFRKADGKTRIIALWDQTIQPTGDRKP
FT                   PEGYVDGTLYTEDDINAALEVYNISQRMRLVPSTDLSGHGTHVAGIAAGSGATDGRYRG
FT                   VASKSDILVVKLGNPVSQSFPKTSQLMTGVDFAIKTALARKQPIAINISFGNNYGSHDG
FT                   NAILETYLNTAANYWKTNIIVGTGNEGSSRTHTAGILSSNVNAVVELAIGDGETSISIQ
FT                   IWKNYFDEFDISLVHPSGDVVGPIPSILGSQQFQLRQTKILLYYGKPIPSNKAQEIYIE
FT                   LIPAVGALLVPGIWKITLTPRRIIVGNYNLWLPSSGVLSGQTGFLRPTPETTLTIPSTA
FT                   SGVISVGAYNSNTNSLAYFSGRGFTRGDLAVKPDLVAPGVDIISASPGGGFTVRSGTSM
FT                   ATPFVTGAAALLMEWGIVKGNDLYLYGEKMKAYLISGAKHLPAYRDYPNPVVGWGALCV
FT                   RDSLPV"
FT   gene            678258..679514
FT                   /locus_tag="Cphy_0533"
FT   CDS_pept        678258..679514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0533"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cth:Cthe_2680
FT                   peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40920"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI86"
FT                   /protein_id="ABX40920.1"
FT                   /translation="MDTLKKKKAFLAVLCLSLVFSGCGLSKANRSYSKAMSYYENGEYE
FT                   NAEKSFIDAIKANPDKAEFYLDYGFTLIKLSRYEDAIKEFESIIMDKEIAIVKQNNKKA
FT                   YRGIGIAYLYAQSYEEAIKNFDLALAISEEKNLDTDILYYKGNALERSGNLEEASNIYS
FT                   EILETEKDDTAIYNARANINRILGNYEESIKDYDKAIEISKGDFDLYFGKFAALKELSR
FT                   TAEAEEVLKIAASLPVHTERDSFELAKVYFYQKNYDHAKLQLAQSLKNGFIEANYFLGE
FT                   ISIEEGDFKQAIQYFETFEESGGMVSAMFYNQLLTCYLNEEEYDKAKNCLKKAKKYSDV
FT                   TIEQQLLRNEIILLEKTGDFKEAYEKMKKYLVRYPDDVDAKKDATFLKTRVEGASNETN
FT                   TNQTNQTEQVGTSETVKKP"
FT   sig_peptide     678258..678344
FT                   /locus_tag="Cphy_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.552 at
FT                   residue 29"
FT   gene            679533..680795
FT                   /locus_tag="Cphy_0534"
FT   CDS_pept        679533..680795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0534"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   proten HflX; PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   tte:TTE1127 GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40921"
FT                   /db_xref="GOA:A9KI87"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI87"
FT                   /protein_id="ABX40921.1"
FT                   /translation="MSELYEIKEEQEKVILVAVSENDNDDTEESLDELMELVDTAGAVT
FT                   VGRITQNREKIHPGTYVGKGKIEEIRLLIEQLGATGIICDDELSPAQLRNLEDALQAKV
FT                   MDRTMIILDIFAQHASTREGKIQVELAQLKYRATRLIGMRNSLSRLGGGIGTRGPGEKK
FT                   LEIDRRLIKDRIAQLNRELDDIKRNREVARSLRMKNPIPVVAIVGYTNAGKSTLLNRLT
FT                   EADVLEANMLFATLDPTTRNLSLESGQQVLLTDTVGFIRKLPHHLIDAFRSTLEEAKYA
FT                   DIIIHVVDASNPQAYKQMHIVYETLKKLQVTDKTVITVFNKQDLVQEEEPMKDLKADKT
FT                   VKISAKQGVGVVELLDIIEEVLREAKVLIEHIFSYQEAGSIQLIRKYGQLLEEEYQEGG
FT                   IFVKAYVPKDIANQIVWSKQS"
FT   gene            681064..683466
FT                   /locus_tag="Cphy_0535"
FT   CDS_pept        681064..683466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0535"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; PFAM: ATP-cone domain protein; KEGG: tde:TDE1331
FT                   anaerobic ribonucleoside triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40922"
FT                   /db_xref="GOA:A9KI88"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI88"
FT                   /protein_id="ABX40922.1"
FT                   /translation="MIKVVKRDGEIAEFALSKISSAIAKAFNATQKLYNEDIINLLSLR
FT                   VTSDFQTKLKDSTVTVEDIQDSVEHVLEQSGYTDVAKAYILYRKNREKIRNMKSTILDY
FT                   KEIVDMYVKEEDWRVKENSTVTYSVGGLILHNSGAITANYWLSEIYDEEIANAHRSADI
FT                   HIHDLSMLTGYCAGWSLKQLIKEGLGGIPGKITSSPAKHLSTLCNQMVNFLGIMQNEWA
FT                   GAQAFSSFDTYLAPFVKVDNLSYEEVKQCIQCFIYGVNTPSRWGTQAPFSNITLDWTVP
FT                   NDLAELPCIVGGKEMEFKYKDCKKEMDLVNKAFIEIMIEGDANGRGFQYPIPTYSITKD
FT                   FDWSDTENNRLLFEMTAKYGTPYFSNYINSDMEPSDVRSMCCRLRLDLRELRKKTGGFF
FT                   GSGESTGSVGVVTINMPRIAYVSANEAEFYQRLDRMMDISARSLKVKRKVITKLLEEGL
FT                   YPYTKRYLGTFDNHFSTIGLIGMNEVGLNARWLGKDMTDKKTQQFSVEVLNHMRDRLGD
FT                   YQVEFGDLYNLEATPAESTSYRLAKHDRKRWSEIRTAGKEGDTPYYTNSSHLPVEYTDD
FT                   IFSALDVQDQLQTLYTSGTVFHAFLGEKLPDWEAAAKLVRTISENYKLPYYTMSPTYSI
FT                   CKNHGYIKGESFVCPECGEKAEVYSRITGYYRPVQNWNEGKSQEYKNRIEYDLAHALNT
FT                   GDLLSANKGIEEAAVTLNLDDNESYLSNDGCYLFTTKTCPNCKLAKGYLDGYKYQVIDA
FT                   EENMELAKQYHIMQAPTLLVVKEGIMTKYVNASNIKQYVDAESAYVI"
FT   gene            683808..685622
FT                   /locus_tag="Cphy_0536"
FT   CDS_pept        683808..685622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0536"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: cdf:CD3625 putative signaling
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40923"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI89"
FT                   /protein_id="ABX40923.1"
FT                   /translation="MEDNKILTRAYVGCATFDSDFRIRVGDEGIYRIIDEGKCYPYSLL
FT                   LLIHNEEQEDFCIAVQNLKENEVHSGTFHIRLEDGKFYVVYYVVENQGIQYMDEELYQI
FT                   RLYNIKAFHQVITKQENEIMDYRTILSLTNNLYFSYDMNTTNFTYYWMSGNQEVIVAQQ
FT                   PLLLWKKEVLDNGYVKEQEKAIFGSMCEDLMAGTSNFYYQLINSILTNGKEVVRWVIRG
FT                   CAVHERMKLDRIVGVIEIEKLTKDVQENFFYDLMNRDALTGLLNKRAITQLAEQKIQYT
FT                   GKDKFRFLILDVDNFKTINDSYGHMVGDEAIVRVANIVKKMVGDHGVVGRIGGDELFAI
FT                   LDNVDDEKSLRNVLKAIRENVAYAYVGSENNIHITCSMGCAEYPTDGVSYKELFQKADY
FT                   SLYLAKEKGKNRYIIYNPLKHGEVSCKFPNAILGMEIAFAGCSNTNLFSNMMQSLYEMR
FT                   KDGIEEVFCQLGELYQFEKINVYYGRELPLIIQWGKINSEDKNAKYLLEQGYQKNFSAN
FT                   GVIVLENMNISKSLQAYQIFMKQNLTFVMQIMIKKENNILGLISLERKVKKSKMSVVDI
FT                   NNLELLCRLIGNIVLDTTPDRNVILDTI"
FT   gene            685938..687008
FT                   /locus_tag="Cphy_0537"
FT   CDS_pept        685938..687008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0537"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: cth:Cthe_0856
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40924"
FT                   /db_xref="GOA:A9KI90"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI90"
FT                   /protein_id="ABX40924.1"
FT                   /translation="MLNIRYEKTTAPKELPAADNPLKFGTIFTDHMFLMDYEEGKGWHD
FT                   ARIVPYGPISLEPSAMVFHYGQEMFEGLKAYKTEDGRTLLFRPNKNAERANNSNKRLCI
FT                   PTIPEEDFAQAVKAMVKMDERWIPTKPGTSLYIRPFVIATDPFLGVRPSNRYLFAVILS
FT                   PVGAYYPEGLNPVKIWIEDEYVRAIKGGIGEAKTGGNYVASLASQVKAHEEGYSQVLWL
FT                   DGKERKYIEEVGAMNIFFKINGKVLTPELNGSILPGVTRDSVISLCKHWNVPVEERRIS
FT                   VEELYEAGKDGSLEEVFGTGTAAVISPVGHLRFEDHVLMVGDGGIGEFSQKIYDTITGI
FT                   QLGKVEDTLGWTVEVV"
FT   gene            687149..688120
FT                   /locus_tag="Cphy_0538"
FT   CDS_pept        687149..688120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0538"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: ckl:CKL_0600
FT                   predicted polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40925"
FT                   /db_xref="GOA:A9KI91"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI91"
FT                   /protein_id="ABX40925.1"
FT                   /translation="MKDKIIMLVLLLIFLSLIGRLFYDKANEEATAGIIGKVEYVSLDE
FT                   LALFVTLENEVQLNKQGMVWMDGSSIWDHDITASITVESGYVSDGDLSREPDYVHHYPN
FT                   LYAKSEADYKSPTDGRKVCFLTFDDGPSANTLKVLDVLDEKKIKATFFVIGEEINKENA
FT                   NILKEVVKRGHLIGVHTHVHDYNKIYKSVDSFLKDYDKAFQKIEEVTGVRPYIYRFPGG
FT                   SYNHYLKRIRKELVAEMTRRGFTYYDWNVSGEDSVGSPTAYSIKKNISRDLNRYRCPVV
FT                   LLHDGQTNPLTAKVLGGVIDYIESKGYEFDTLDHREPCQFRW"
FT   gene            complement(688261..689655)
FT                   /locus_tag="Cphy_0539"
FT   CDS_pept        complement(688261..689655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0539"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   cdf:CD0551 putative spore cortex-lytic enzyme pre-pro-form
FT                   (putative spore peptidoglycan hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40926"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI92"
FT                   /protein_id="ABX40926.1"
FT                   /translation="MVYNPYSFRYPTFREGLGLEKDVFSPTMDNQIPRTNMMPRNDYRV
FT                   YPAQVETQSLGGLVVDVLSARDNRPISNATVGIQFTGDPSTQPIEELQTSDTGRTELVE
FT                   LPAPPVDYSLEPSAPMPYSEYTLTIKAPGFEPVIITGAQILPTVNALQNILLDPTPSAG
FT                   VRNTAEAFVIPYHTLYGDYPPKILEDEIKPLEEAGEIVLPNVVIPEFIVVHDGVPTDKT
FT                   AKDYWVPYRDYIKNVASSEIYATWPESTIYANVLAIQSFTLNRVFTEWYRNKGFSFTIT
FT                   SSTAYDHKFMPGRNFFDSISRVVDTIFNNYLSRPNVKQPILTQYCDGKRVSCPEVMTQW
FT                   GSKTLGDQGYTPIQILRYYYGDSIYINTTYEVSGVPVSFPGYNLTIGSSGSSVMQLQEQ
FT                   LNAIADVYYPIPNVSADGIFGPATAAAVKAFQKQFNLPQSGIVDLPTWYKISGIYVAIT
FT                   RMAEYQ"
FT   gene            690089..691351
FT                   /locus_tag="Cphy_0540"
FT   CDS_pept        690089..691351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0540"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase small chain; KEGG: ldb:Ldb1137
FT                   carbamoyl-phosphate synthase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40927"
FT                   /db_xref="GOA:A9KI93"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI93"
FT                   /protein_id="ABX40927.1"
FT                   /translation="MKAFLILEDGHIFEGKHIGSKREVISEIVFNTSMTGYLEILTDPS
FT                   YAGQAVVMTYPLIGNYGICPSDMESLKAWPDGFIVRETSRVPSNFRSKLSLEEFLIKND
FT                   IPGISGVDTRCLTKILRESGTMNGMITTNENFIIEDVINALKDYKVTGVVSKVSCKEKK
FT                   VTTHENFTPTDFEMAKMTYMASTEMKEAIEKATKNGVCLGEIALACMQGTAGIAYLNKL
FT                   AEDENLVKTHYKVALMDFGSKKNIEHCLLKRGCEVTVYPADTKAEEILEANPDGIMLSN
FT                   GPGDPAECFEIIKEIKKLSETNIPIFAICLGHQLMALANDFETKKMKYGHRGANHPVKD
FT                   LETGRVYLSSQNHGYVVVEDTIDESKAEVRFINANDKTIEGIKYKNKNIFTVQFHPEAC
FT                   AGPQDSEFLFDEFMKMMEVNA"
FT   gene            691351..694551
FT                   /locus_tag="Cphy_0541"
FT   CDS_pept        691351..694551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0541"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: phosphoribosylglycinamide synthetase;
FT                   protein of unknown function DUF201; Carbamoyl-phosphate
FT                   synthase L chain ATP-binding; Carbamoyl-phosphate
FT                   synthetase large chain oligomerisation; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; MGS domain protein;
FT                   KEGG: cth:Cthe_0949 carbamoyl-phosphate synthase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40928"
FT                   /db_xref="GOA:A9KI94"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KI94"
FT                   /protein_id="ABX40928.1"
FT                   /translation="MPKNNNIKKVLVIGSGPIVIGQAAEFDYAGTQACRSLKEEGVTVV
FT                   LVNSNPATIMTDKDIADMVYIEPLTPDVVKKIILKEKPDSVLPTLGGQAALNIAMELEE
FT                   SGFLAETGTKLIGTTSLTIKKAEDRLEFKNTMEKIGEPCAASVVVTTVPAAVDFAETIG
FT                   YPVVIRPAYTLGGSGGGIAADKEELIDICTNGLRLSRVGQCLIERCIAGWKEIEYEVMR
FT                   DGAGNCITVCNMENLDPVGVHTGDSIVVAPSQTLSDKEYQMLRTSALNIITEINITGGC
FT                   NVQYALKPDSFEYCVIEVNPRVSRSSALASKATGYPIAKVAAKIALGYTLDEIPNAITG
FT                   KTVASFEPALDYCVVKIPKWPFDKFIMAKRTLTTQMKATGEVMSICTNFEGALMKAVRS
FT                   LEQNIYSMNYGDYSKDSVEDIREKLHLIDDRRIFVIAEAIRRGITPEEINDITKIDLWF
FT                   IDKIAILTEMEKRLSEEPLTKELMLEAKRMEFPDRVIAQFSGKTLEEVKKLRKEEYEIH
FT                   AAFKTVDTCAAEFEAQTPYYYSCFDSENEVDATKTKKKVLVLGSGPIRIGQGIEFDYCS
FT                   VHATWSMSKSGFETIIVNNNPETVSTDFDIADKLYFEPLTPEDVENIVDLEQPDGAVVQ
FT                   FGGQTAIKLTEALLKMGVPILGTSAENVDAAEDRELFDEILEKCCIPRPAGKTVFTTEE
FT                   AIVAANQLGYPVLVRPSYVLGGAGMQIAICDDDVREFMEIINRNVQEHPILVDKYLMGK
FT                   EVEVDAVCDGEDILIPGIMEHIERAGIHSGDSISVYPAQSISNKVQDVIVDYTRKLAKS
FT                   LNVIGLINIQFIVYNEEVYVIEVNPRSSRTVPYISKVTNIPIVSLASKAVLGEKIADLG
FT                   YGTGLAKKADYIAIKMPVFSFEKLRGADIGLGPEMKSTGECLGIAKTFNEALYKAFLGA
FT                   GINLPKHKKMILTVKDADKLEAVSVGRRFKALGYEIYATRSTARVLKENGVDAIPVQKV
FT                   DGESPTILDLLLGHEIDLVVDTPTQGRDKSRDGFVIRRMSIETGVTCLTSLDTANALLT
FT                   SLENVADGELSLIDIARI"
FT   sig_peptide     691351..691422
FT                   /locus_tag="Cphy_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.822) with cleavage site probability 0.711 at
FT                   residue 24"
FT   gene            complement(694720..695130)
FT                   /locus_tag="Cphy_0542"
FT   CDS_pept        complement(694720..695130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40929"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI95"
FT                   /protein_id="ABX40929.1"
FT                   /translation="MKKCIISSLVVVLFAALLVSCSPKESNYSLHLLVDSWSDQNIDYP
FT                   ENEFYYENLISKKTYDIPLRGSAFLREFKVVKIDSNSITISTSESYSDNEDGHVFASEK
FT                   KKFVIEYGKSKTIYTRSMDAGESYVFTLVEKN"
FT   sig_peptide     complement(695068..695130)
FT                   /locus_tag="Cphy_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.741 at
FT                   residue 21"
FT   gene            complement(695551..698313)
FT                   /locus_tag="Cphy_0543"
FT   CDS_pept        complement(695551..698313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0543"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; magnesium-translocating P-type
FT                   ATPase; PFAM: cation transporting ATPase domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: cdf:CD3373
FT                   magnesium transporting ATPase, P-type"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40930"
FT                   /db_xref="GOA:A9KI96"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI96"
FT                   /protein_id="ABX40930.1"
FT                   /translation="MNKKRNHNVSAKQIAEIKARRDNANKAISFAAMNPTDIILQNLET
FT                   SMDGLSEKDVLDSRLSHGSNKVTEGKKKSQIQKLAGAFINPFTIILLCLAIVSTITDII
FT                   LPLKQNAPDDINPITVIIILTMVFISGTLRFVQESRSGNAAEKLLAMITTTCTVDRLEE
FT                   KKMEIPLEEAVVGDIIHLAAGDMVPADVRILSAKDLFISQSSLTGENDPLEKLPIVYGT
FT                   ACDAITDYNNIAFMGSNVISGSATAVIIAVGDDTLFGSMASSVAGDAVETSFTKGVNSV
FT                   SWVLIRFMLVMVPIVFVINGLTKGDWLDAFLFAISIAVGLTPEMLPMIVTTCLAKGAVS
FT                   MSKKKTIVKNLNSIQNFGAIDILCTDKTGTLTQDQVVLEYHLDVIGKEDRRVLRHAYLN
FT                   SYFQTGYKNLMDLAIIRKTEEEEASDPKLLDLSAAYVKVDEIPFDFTRRRLSTVVSDKN
FT                   GKTQMVTKGAVEEMLSVCSYVELNGKVEPLTEEIKSNIFETVNGFNEDGMRVIAVAQKT
FT                   NPSPVGAFGVKDECDMVLIGYLAFLDPPKESTKDAIKALKAHGVTTKILTGDNDKVTRC
FT                   ICKQVGLEVGNLLLGADIDSMTDEALAIAAETTDVFAKLSPDQKSRVVTVLRNSGHTVG
FT                   FMGDGINDAAAMKSADIGISVDTAVDIAKESADIILLEKDLMVLEEGIIEGRKTYANMI
FT                   KYIKMTASSNFGNMFSVLVASALLPFLPMMSVHLIILNLIYDLSCTAIPWDNVDKEFLT
FT                   VPRKWDASSVGSFMIWIGPASSVFDWLTYAFMYFVLCPMFVSNGVLFHNLASHYSGTAL
FT                   LQMQASYAAMFQAGWFVESMWSQTLVIHMIRTPKLPFIQSHASASVTMLTFTGIAVLTV
FT                   IPFTALGTMLGFVALPMAYFAFLLPCILMYMVLATVLKKAYIRHHGELL"
FT   gene            complement(698717..699220)
FT                   /locus_tag="Cphy_0544"
FT   CDS_pept        complement(698717..699220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0544"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: cdf:CD3376 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40931"
FT                   /db_xref="GOA:A9KI97"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI97"
FT                   /protein_id="ABX40931.1"
FT                   /translation="MKKNTSFITVDSALVRWIRDKINIEQPNSVYSKELLQGLNDLIQS
FT                   EDSTLILSMTNNSKSFIDNIDDNIYAGDLSIYLKSRKVLRKDLEISLTPKEFDILYFLA
FT                   QNRGYVYTKEQIFQAVWEEDYLMSDSNIMAFIRKLRKKIEPNPDEPEYIITIWGIGYKF
FT                   NDQY"
FT   gene            699850..701943
FT                   /locus_tag="Cphy_0545"
FT   CDS_pept        699850..701943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0545"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: amt:Amet_0212 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40932"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI98"
FT                   /protein_id="ABX40932.1"
FT                   /translation="MKIGIIGYAKPELESLLQAYAVKKVLEDEAVDCYWYRKRDNFTYK
FT                   AARTTHKRNLLDALSGRQHIHVDLNEAKTAMEGFVKDKLSLNPNKSEKTDSFVIVNYKS
FT                   TIDTTNSTANYIDFYQRSFEPKSEITEALMLCSLEDYEKIMGETIDEQAYVFMDSETDK
FT                   AGIIPSVRKIAKANNLKVISKAYNRTYYAFEKVTEIFTPSEYLAYIRDAKLVVTDSFTT
FT                   VYFAILMKKPLICYDQGMTQGKIKRFLQRLSLMDNYFTMKQSNTSLTAYSIKHPNKVNK
FT                   QLKKYREELTDSLYELVGAFGIDQPVNCPTKITRGECCGCYACKEVCPTGAIQMLMDRE
FT                   GFYYPHVNKEKCIHCGLCERVCVKKENSQIVSYEADYPKVYSAINKDENARMISTSGGV
FT                   FHALSKYAIEQREGVVFGVKFDENMNAVSTLASTMNDVKAFYGSKYVKSEIDGVYAKVK
FT                   EQLNEGKFVLYSGLPCECAGLKAYLRKDYENLFISEILCHAAPSPKVFKNYLKFLSIKY
FT                   KSPITNVVFRDKRDGWLIHKCSMVIEFKDRKPLVVNARRNNYFRNFLLDNIQRPGCSQC
FT                   SFVGRSRVGDITIGDFWGIHRMDEEMFDDKGTSAIMVNTEKGAKVLEELKDSFYMKEKS
FT                   IKELFKYNHSKPCPYKPERDEIFKRLGKEKINPLLESFNDLKNKSARDITAKEVVNEVI
FT                   MDD"
FT   gene            702304..704553
FT                   /locus_tag="Cphy_0546"
FT   CDS_pept        702304..704553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0546"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: amt:Amet_0212 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40933"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI99"
FT                   /protein_id="ABX40933.1"
FT                   /translation="MKIGIVADLNDMNLDVWLSTYALQEALKEMEHISVVIHHSFINSE
FT                   DGEKLGPKELAYEFYNVVEGSSQLSNDAGYYNLFDIYLVASERMWQKVKDNTIKEYYPI
FT                   HYLRDSILLMQQKNYHPLAKKKSINEDYLLCYYETPSKEKLEFLKFLLDKKSLKLVSNQ
FT                   MGNNELKSLQSYTDQDIREFLLYLRHAKVVITDSGFIASMALLYEKPFLLLSEKTQEVL
FT                   AAGILKELGLSSLILSDLSTSRDISIYNSLLETYENNQREFRKRIKDFRKEQKKKLSQL
FT                   IRLASYEMYVDCPTDIKKIECCGCTACREVCPYNAIEMKPDEEGFIYPVVDHDKCVKCM
FT                   LCKKVCVKRENPQTITYEKRENQQTNNNVKKENPQTDTSVRKESSQTNTSARKESSQTN
FT                   TSVRKENSQTNTYAKKENFQTFTNEKKENPQTITYAKKENSQAISHAESYPIVYAVNNK
FT                   KLKVRTNSSSGGIFPELVQYVIEELEGYVVGVKFDNDMNAVSSIAHTMEEAKEFYGAKY
FT                   TKSDFTGMFRNVKKLLDKGETVLYSALPCEAAGLRAFLRKRYDNLIVSEVLCHAGPSPL
FT                   VFRRYVQYLESRFHSKVKKINFRDKSKGWLALDNTMVVEFANREPLKLRARRNNYYRSF
FT                   IKDNIARPACSQCSFVYTNRVGDLTMGDFWGIQYAKPEMFDNKGTSILMINTKNGENIW
FT                   NKISNRFEYEESNLTEAFRYNHKKPIKLTEKRNEFFDRFEKEEINSLLQEFNDLK"
FT   gene            704732..705256
FT                   /locus_tag="Cphy_0547"
FT   CDS_pept        704732..705256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0547"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="KEGG: cno:NT01CX_1843 adenine
FT                   phosphoribosyltransferase; TIGRFAM: adenine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40934"
FT                   /db_xref="GOA:A9KIA0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KIA0"
FT                   /protein_id="ABX40934.1"
FT                   /translation="MKKLEEYVRSIPDFPEEGIIFRDVTSVLQDKDSLKMSIDQMQENL
FT                   NGLDFDVIVGPESRGFIFGVPIAYNLNKAFIPVRKKGKLPCETVEMEYALEYGTATIEM
FT                   HKDSIKPGQKVVIIDDLIATGGTIEAITKLIEQLGGEVVKIVFLMELEGLMGREKLKGY
FT                   DIASVIKYAGK"
FT   gene            705501..707942
FT                   /locus_tag="Cphy_0548"
FT   CDS_pept        705501..707942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0548"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: cth:Cthe_1344 (p)ppGpp synthetase I,
FT                   SpoT/RelA; TIGRFAM: RelA/SpoT family protein; PFAM: amino
FT                   acid-binding ACT domain protein; TGS domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; RelA/SpoT
FT                   domain protein; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40935"
FT                   /db_xref="GOA:A9KIA1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIA1"
FT                   /protein_id="ABX40935.1"
FT                   /translation="MEKSLNQSTDTNLEPKKLHNVSSILQNESTILENGSSIQKNGNAI
FT                   QKNDIDLMQDETAIKYQKDRKIGVVPSDFTSPDELYEILLKTIRAYHPSTDVEIVEKAY
FT                   KIATFAHKDQLRKSGEPYIIHPLCVAIILAELELDKETIVAGILHDVVEDTVLTVSELT
FT                   KEFGEEVALLVDGVTKLTQLNYSKDKVEIQAENLRKMFLAMAKDIRVILIKLADRLHNM
FT                   RTMQYQTPKKQIEKSRETMDIYAPIAQRLGISMIKIELDDLSLQYLEPEVYKELNEKIA
FT                   SKKEEREAFINSIVEDVGKHIAEANISAKIDGRVKHFFSIYKKMVNQGKTLEQIYDLFA
FT                   VRIVVDTVKDCYAALGVIHEMYKPIPGRFKDYIAMPKPNMYQSLHTTLIGPNGQPFEIQ
FT                   IRTFEMHRTAEYGIAAHWKYKEGHDGKNTRDTEEAKLTWLRQILEWQRDLSDNKEFLSL
FT                   LKNDLDLFSDSVYCFTPTGDVKNLPAGSNPVDFAYSIHSAVGNKMVGARVNGRLVPIDY
FT                   VIQNGDRIEIMTSQNSKGPSRDWLNIVKSTQAKNKINQWFKTELKEDNIIRGKEMLVAY
FT                   CKTKTITMSDLLKNEFMEVVMKKYGFRDWESVYAAVGHGGLKEGQVINKLQEVYTKKNR
FT                   KEMTDEKVLETIADVKFDRPAVMKSKGGIVVQGIHDVAVHFSKCCSPVPGDEIVGFVTR
FT                   GRGVSIHRTDCINVINLPYEDRERLIDAEWNIPADKQNSGLYTAEIKIYANNRNGVLLD
FT                   VSRIFTENKIDVISMTVRTSKQGTATISVGFEINGVEQLHFIIGKLRSIESVIDIERTT
FT                   G"
FT   gene            708053..708703
FT                   /locus_tag="Cphy_0549"
FT   CDS_pept        708053..708703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0549"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   chy:CHY_2221 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40936"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIA2"
FT                   /protein_id="ABX40936.1"
FT                   /translation="MSKIRLDMLTLGEIRTNCFIVSNEDTKDAVVVDPGDECERILEHL
FT                   NLNELNIKAILLTHGHFDHIMAARELASTTRVCIYAYESERELLADPGLNCSSIFGKSL
FT                   TLAPVESLHDLEKIQFADIEFVVLHTPGHTKGSVCYYIPDEQILLSGDTLFFESVGRTD
FT                   FPTGNSEVLVKSINERLFTLPKEVKVYPGHGCSTSIGYEMQNNPYVNGEGSFY"
FT   gene            708704..710179
FT                   /locus_tag="Cphy_0550"
FT   CDS_pept        708704..710179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0550"
FT                   /product="Coproporphyrinogen dehydrogenase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: cth:Cthe_1341 radical SAM; PFAM: Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40937"
FT                   /db_xref="GOA:A9KIA3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023995"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIA3"
FT                   /protein_id="ABX40937.1"
FT                   /translation="MIQLTMIGEDYEQDIAPLLKSFYPKEEIKIEKYQTETEQALSTET
FT                   TLVLRLFLDRFEVALYEDTILRKREEKILSEYPLTRSIYRNALLRVLYLLLSDYTKESL
FT                   PWGIMTGIRPTKQVLERLEDGVTEEDIKKYLKEEYYCSDEKIALSLNVAKREHEILKDL
FT                   SYQNGYSIYIGIPFCPSTCHYCSFTSYPLERFEHLVEPYLMALTKEMEYASTCLDKPLS
FT                   TLYVGGGTPTTLSAKQLEYLLTKIDHYFGIKGLKELTVEAGRPDSITREKLQVLKDFGV
FT                   SRISINPQSMRQKTLDLIGRKHTATQIEEAFYLAREIGHDNINMDIIIGLSGENPSDVI
FT                   YTLDRIKSMNPDSLTVHTLAIKRAARLNTQKEQYKDMEAVRVSDMLAETVKFAKENNYD
FT                   PYYLYRQKNMAENLENVGYARYGKEGIYNILIMEEKQTILALGAGGSSKFVFHKENRIE
FT                   RVENVKSVMDYTERIDEMIQRKKDFLRNSIKDL"
FT   gene            710182..710904
FT                   /locus_tag="Cphy_0551"
FT   CDS_pept        710182..710904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0551"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: chy:CHY_1969 HDIG domain protein; TIGRFAM:
FT                   metal dependent phophohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40938"
FT                   /db_xref="GOA:A9KIA4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIA4"
FT                   /protein_id="ABX40938.1"
FT                   /translation="MGILGFYRKEELKQIQKESSFRCGNLSAPSATGIAIIRGLDYPYL
FT                   CEEIKEEAISHGILVSNLAYSLAKELKLSKKTCLELAEAGIVHDIGKLKLGEYLYGKEH
FT                   DTLKIEEMKYIRLHPELGAQILKDHRCHSREVLTSIYHHHENFDGSGYPDNLSGNAIPY
FT                   GARILRTCDVFAALVTERAYRSFFEVDAAIELMIDEVKNFDMEIFLAFLRFVHSKEFES
FT                   IRDYVIYVNNNSMTIPEE"
FT   gene            711008..712261
FT                   /locus_tag="Cphy_0552"
FT   CDS_pept        711008..712261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0552"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: cbe:Cbei_1544 histidyl-tRNA synthetase;
FT                   TIGRFAM: histidyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (G H P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40939"
FT                   /db_xref="GOA:A9KIA5"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KIA5"
FT                   /protein_id="ABX40939.1"
FT                   /translation="MITQRPKGTLDWYGDNMYKRTLIEELARKLCKAYNIKEIITPVFE
FT                   HTILFQRGVGETTDVVQKEMYTFLDKKDRSITLKPEGTAGAIRAYLENNLYAESGPTKL
FT                   FYVTPAFRYEQPQSGRLRQHHQFGVEFVGSKSPLAEVELITLITTFLKEIGLKKAKLHI
FT                   NSIGCKNCRATYNEALLTYLRKHEDHLCSTCKERMQKNPLRVIDCKESACKEIVKDAPR
FT                   TIEYLDEECKNHFEELQSLLHTLNIPFEIDTGIVRGLDYYTKTVFEFVNEDGFTLCGGG
FT                   RYDGLVHEIDEKQDIPSVGFGMGIERILYFLEKEEVSLPPQPAIELYVGILGAEAKASA
FT                   YQLVTKLRGEGIITETDYMDRSVKAQMKYANKIGAKNTVILGADELAKGLANVKNMETG
FT                   EQTELPLEDIADFILKNA"
FT   gene            712412..714208
FT                   /locus_tag="Cphy_0553"
FT   CDS_pept        712412..714208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0553"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: GAD domain
FT                   protein; tRNA synthetase class II (D K and N); nucleic acid
FT                   binding OB-fold tRNA/helicase-type; KEGG: csc:Csac_0677
FT                   aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40940"
FT                   /db_xref="GOA:A9KIA6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KIA6"
FT                   /protein_id="ABX40940.1"
FT                   /translation="MAESMKGLHRTHRCTELSNSNVGEIVTVMGWVQKSRNKGGIIFVD
FT                   LRDRSGLLQIIFEEGDIGTEMFEKASKLRSEFVVAVVGKVETRSGAVNENLLTGTIEVR
FT                   ATELRILSESETPPFPIEEGSKTKEELRLKYRYLDLRRPDLVRNLMLRSKVATLTRQFL
FT                   SDEGFLEIETPMLTKSTPEGARDYLVPSRVHPGNFYALPQSPQIFKQLLMVSGYDRYFQ
FT                   IVKCFRDEDLRADRQPEFTQIDMELSFVDVDDVISVNERLLQKMFKESIGIDVSLPIQR
FT                   MTWREAMDRYGSDKPDTRFGMELKNVSELVKDCGFAVFTGALENGGSVRGINANGQGEM
FT                   PRKKIDALIEFAKGYGAKGLAYLSINEDGTYKSSFSKFMTEEELSALVAAMEAKPGDLL
FT                   FFAADKDKVVFDVLGNLRLEIARNLELLDKNTYNFLWVTEFPLLEYSEEEGRYTAMHHP
FT                   FTMPMDEDLPLLETDPGKVRAKAYDIVLNGTEVGGGSVRIFQNNVQEKMFEVLGFTKEE
FT                   AYERFGFLLNAFKYGVPPHAGLAYGLDRLVMLMAKEDSIRDVIAFPKVKDASCLLTDAP
FT                   NVVDDKQLEELSIALAKKATEE"
FT   gene            714315..714527
FT                   /locus_tag="Cphy_0554"
FT   CDS_pept        714315..714527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0554"
FT                   /product="protein of unknown function DUF1294"
FT                   /note="PFAM: protein of unknown function DUF1294; KEGG:
FT                   cbh:CLC_2171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40941"
FT                   /db_xref="GOA:A9KIA7"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIA7"
FT                   /protein_id="ABX40941.1"
FT                   /translation="MGIDKKKAKAREWRIRERTLFLIAFIGGSLGSLLGMKVFHHKTKH
FT                   KNFQILIPLFLILQITLGIIYIVKM"
FT   gene            714687..714887
FT                   /locus_tag="Cphy_0555"
FT   CDS_pept        714687..714887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0555"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: amt:Amet_1627 putative cold-shock
FT                   DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40942"
FT                   /db_xref="GOA:A9KIA8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIA8"
FT                   /protein_id="ABX40942.1"
FT                   /translation="MNKGTVKWFNNQKGFGFISDEQGNDVFVHYSGLNMDGFKSLEEGQ
FT                   EVAFEVVQGAKGPQATNVTRI"
FT   gene            715212..716273
FT                   /locus_tag="Cphy_0556"
FT   CDS_pept        715212..716273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0556"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: cbe:Cbei_4465 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40943"
FT                   /db_xref="GOA:A9KIA9"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIA9"
FT                   /protein_id="ABX40943.1"
FT                   /translation="MKISQRPFGKTKQGEKVTLYTITNDHGMVVSFSDFGANIVSIIVP
FT                   DKNGTFADVALGYDNVKQYEVNGPGYGSFIGRHANRIAEALVVINGKEYKLEKNDGNHN
FT                   LHSGSKGYNKFLYETEVFKDKDETTVEFSRLSPDMEQGLPGNLDLVVSYTLTNDNELAI
FT                   EYYGVSDKDTIINFTNHSYFNLAGHNSGSIEGHQVMIDSDEFTLTDETLIPTGEIAKVE
FT                   GTPMDFRKLKKIGKDIEADYQPLRVAGGYDHNYVLKTSEEEAAKVAELWEEKSGRLMEV
FT                   FTDAKGLQLYTGNFILGNENGKEGYCYQKRDGVCFETQYYPNSCNISNFPSCLKNAGEP
FT                   FESVTIYKFSVKK"
FT   gene            complement(716430..717059)
FT                   /locus_tag="Cphy_0557"
FT   CDS_pept        complement(716430..717059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0557"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="KEGG: smu:SMU.1673 uracil phosphoribosyltransferase;
FT                   TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40944"
FT                   /db_xref="GOA:A9KIB0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KIB0"
FT                   /protein_id="ABX40944.1"
FT                   /translation="MSNVCIMDHPLIQHKIGIMRMKTTSTKEFRDLVAEVAMLIYYEAS
FT                   RNLPLADKEVETPLTKAIVKEIEGKKLCVVPILRAGMHMADGILNLTPNAKVGHIGLYR
FT                   NEETLEPVEYFCKLPSDAPDREIFVVDPMLATGGSAIAAITLLKRRGIEKIRFLCLIAA
FT                   PEGLKKLQEAHPDVDVFIGALDERLNEQGYILPGLGDAGDRIYGTK"
FT   gene            717390..718490
FT                   /locus_tag="Cphy_0558"
FT   CDS_pept        717390..718490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0558"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   dar:Daro_0240 response regulator receiver:ATP-binding
FT                   region, ATPase-like:histidine kinase, HAMP region:histidine
FT                   kinase A, N-terminal:Hpt"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40945"
FT                   /db_xref="GOA:A9KIB1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIB1"
FT                   /protein_id="ABX40945.1"
FT                   /translation="MIDTIFHGDKIGATALIVDDNPVNLIAGGMMLKTYGLSVETAGGG
FT                   RDALEKVAEKDYDLIFMDLMMPEIDGVETAKRIHKLVGKFGQVIIAISGALIGENEKIA
FT                   TTNEFSDVLEKPIEADKLSQCLKRWLPKEKLCENLIDSFHEIGERTDEVSEFIEIFQQV
FT                   TTLDCRLGLHYALNQVDNYIRIAEASMKQLIQSKDKLELITEEKERGIMQAECHSLKSI
FT                   LYHLGSRELAEDATALEMKRMSEESLEHNNSIHECQMEQLKRFLMRINLFCSELEQALI
FT                   AYNNRRNPKNETMGISNCSKEVIAKQQGKVLYHISHYEYFEIINGLRLLLTMVSKENQK
FT                   KIHQAMEAAEEFDYENTAKYVNQIII"
FT   gene            718855..719307
FT                   /locus_tag="Cphy_0559"
FT   CDS_pept        718855..719307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40946"
FT                   /db_xref="GOA:A9KIB2"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIB2"
FT                   /protein_id="ABX40946.1"
FT                   /translation="MSVFKKLIRKELGEVNYNKYFTYIQKNLKNKSLESKEVFEDIYTR
FT                   LKDKDIESIARMHDRLNDAMLLAFRISKNYMFAVVFYIAASTFILLKGLVPMIAITALG
FT                   TMSVLFLMKTYEFVLNKYCFIDAQIVLVYKSVLEKIILGHVKRRNL"
FT   misc_binding    719539..719770
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 108.72"
FT   gene            719941..720960
FT                   /locus_tag="Cphy_0560"
FT   CDS_pept        719941..720960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0560"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   cth:Cthe_1754 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40947"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIB3"
FT                   /protein_id="ABX40947.1"
FT                   /translation="MKKFKKLLTLGLILTIVMTGCGTKAGNENHETNEMPTSEAQITAQ
FT                   PSTGTEPATTPTGLPEDTTENNETKYPLTVTDTMGTTITFENEPQTMISFSPSITEILY
FT                   ALSLSDKLIGRTDYCDYPAEALSIESIGDFYNPDIEKVVSLAPDVVLASSLWTEDVIQK
FT                   FKEVGITVVVANEDKDVAGIYGMIDLIGQIFNCQDNSAKLVETMKTQIEDVTKKVASLP
FT                   KKTVYYVVGFGEYGDYTAGGDTFIGNLLTLAGGDNIAKNVSGWSYTLESLIDADPEVII
FT                   LDSSMKDSFISSDNYKDLSAVKNNQVYSIDNNLLERQSYRVADGILEVAKILHPEAFQ"
FT   sig_peptide     719941..720018
FT                   /locus_tag="Cphy_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.777 at
FT                   residue 26"
FT   gene            721033..722073
FT                   /locus_tag="Cphy_0561"
FT   CDS_pept        721033..722073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0561"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: ctc:CTC00784 iron(III) dicitrate transport
FT                   system permease protein fecD"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40948"
FT                   /db_xref="GOA:A9KIB4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIB4"
FT                   /protein_id="ABX40948.1"
FT                   /translation="MNKRKTSFYYLVFTLLLLITIIVTASVGSANITIYDSLKVLLSKI
FT                   PIIRKLIETSDIPKNYVTIIWNIRIPRILLSGLSGASLALVGACFQGLFRNPLADPQIL
FT                   GISSGAALGATIATLSGMTISFFGLGVIGAFAFVGALLTVFLVYQIAFTGSTGSVTHIV
FT                   LTGTAISSMLSAMISLLMSIRREQIEKVYMWTLGSFSAASMKKVGFLLLFFVVCATIII
FT                   VYARELNIIAAGEETAESLGIDTLKVKRTLIIVGSLLVAACVSVCGIIGFVGLIIPHMI
FT                   RLLLGPRHERLLPFSCIFGAFFLIVCDTLARTLRAPGELPVGVITALFGAPYFLLLLYR
FT                   DKKRMV"
FT   sig_peptide     721033..721125
FT                   /locus_tag="Cphy_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.435 at
FT                   residue 31"
FT   gene            722075..722869
FT                   /locus_tag="Cphy_0562"
FT   CDS_pept        722075..722869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0562"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ctc:CTC00783 ferric enterobactin transport
FT                   ATP-binding protein fepC"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40949"
FT                   /db_xref="GOA:A9KIB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIB5"
FT                   /protein_id="ABX40949.1"
FT                   /translation="MDKLQTIQINELTWQPQKEEDAILKEICATFLQGGFYGILGPNGS
FT                   GKTSFIRHILRLLPVESGRIFLENKEITSYKRNDIAKKMSLVPQNTNIETRFTAYEIVM
FT                   MGRAPYQKRFQAVSDKDREIVNEAMKMTNCYHLREAIFSRLSGGEKQRVITARAIAQQT
FT                   PWLFLDEPVAHLDVRYQMELMKYLKKLNDTKNTSIITVLHDINLAARYCKQIVLMKDGR
FT                   IVAAGETKQVLTIDNLNQVFEILFYELENEALGGTYFIPTPS"
FT   gene            723380..725623
FT                   /locus_tag="Cphy_0563"
FT   CDS_pept        723380..725623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0563"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; Propeptide PepSY amd
FT                   peptidase M4; KEGG: cth:Cthe_2168 propeptide, PepSY amd
FT                   peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40950"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIB6"
FT                   /protein_id="ABX40950.1"
FT                   /translation="MKRKSFIALMLAGGLIFTSIPVQVDAMSTVVAEAVTSESVQSNST
FT                   EDTKLQANLSKIITEIKKKVTIPSDCTKFDSNYYGEEYGRGIQWNLNWSSEKGSHYFNV
FT                   VCDDNANITFINDRDYDKYDKQEPINYLIKELRPVADAFIKKVAPEVWGHVTYQTASYV
FT                   GYYNNCYQFEYVRTENGIMMPDNTITIQISAADKKVQRYNANWLFGLSIPSKDVKISKE
FT                   QATEKIKKQVSMELKYLTKWSEDGKTRSAYLVYAPNNNYIAVDAKTGEVYTSREQWIET
FT                   SEKESAMQDTSKNESNAGGSTLTKEELAQIKEIGSLITKEQAIDKVVKNKYLLMDANIK
FT                   AISASLSGYRLYGNEKEKQYVWSISLTDPRVTDDSKNDYYRASAYATVDAKTGEILSYH
FT                   SSVKNADQMTTDELEKAKTKLSKEECAKIYEAFAKSQNEKQFTNTKQSSVIQGYIYDYV
FT                   KEIPVYGGYTFGYERVNEGIPYADNYFTGSVDSISGKVFEYNKNWDTTIKFESSKNAMS
FT                   PEQAFNAYIKLDGYELVYEINTVHKLAKSGDANGTIENSYSMEYQPRLVYRTNINPNTI
FT                   SPFTGKQLDWSGNVYVSQLKKSADYTDIKGHKYERSILLLRDLGAGSEELKFRPNDVIT
FT                   GKELQSLAEKLFYEASRDEIKLKSNNGITKQQLAKYTVQILGYEKVATMGDIFRCGYTD
FT                   DAKIGKDYYNYVAIAKALKLFGNGNEKAFQPTAKITRGEAADILIKVLNNSAR"
FT   sig_peptide     723380..723460
FT                   /locus_tag="Cphy_0563"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.656 at
FT                   residue 27"
FT   gene            726147..726944
FT                   /locus_tag="Cphy_0564"
FT   CDS_pept        726147..726944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0564"
FT                   /product="Negative regulator of genetic competence
FT                   sporulation and motility-like protein"
FT                   /note="KEGG: sak:SAK_0197 adaptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40951"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIV2"
FT                   /protein_id="ABX40951.1"
FT                   /translation="MEFKRIDDETVRCIINEDDMKEYNIEIDDFLKNKGKIQEFLHKIV
FT                   EMAVDEVGYNPKNGLLAMQVMPLPRNRLAITFSEKGAEGMEDILHQINDALGGDGELTP
FT                   ESMMSRYEDLSSIEKIEAFDKFIRNLIQDVTDEYEEQQYKKNKDENKSKEDKKGKQKQT
FT                   VDSNLQLYTFATLSDVERFCVILPESWAIRSTLFKNEKEQLYYMVLEKGRLSKVNFQFV
FT                   CDRANEYGKFHSENQARVAYLKEHALCLIDKKAIKVMKNIANG"
FT   gene            complement(727142..728317)
FT                   /locus_tag="Cphy_0565"
FT   CDS_pept        complement(727142..728317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0565"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: fno:Fnod_1562 transposase
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40952"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIV3"
FT                   /protein_id="ABX40952.1"
FT                   /translation="MHNYCINKLLNLKEVKVKNIIHGDSYVKIFIETKASVQTCPCCGR
FT                   HTKQIHDYRWQSIKDLPFQLKHCYLVLKKRRYRCSCGKRFSEKYSFLARYQQRSTRLTQ
FT                   YIVNELRDTTSLKSVANKANVSSATIVRILDTIHYTCPSLKDAISIDEYKGNAETGKYQ
FT                   CIIVNPKQRSIMDILPDRTQPHLSAYFRNINRSERYRVKYFVCDMWQPYVDLAHSYFPN
FT                   AQVIIDKYHFIRQVTWAIENVRKRLQKTMPTSLRKYYKRSHKLILTRYHKLEDEYKKAC
FT                   DLMLYYNDDLRKAHMLKEWFYDICQSTKYSFQRTQFYEWIRNAESSGIAEFEKCAATYR
FT                   HWGKEILNSFKYGITNGPTEGFNNKIKVLKRISYGIRNFERFRTRILHSCN"
FT   gene            728797..730155
FT                   /locus_tag="Cphy_0566"
FT   CDS_pept        728797..730155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0566"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: cac:CAC0542
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40953"
FT                   /db_xref="GOA:A9KIV4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIV4"
FT                   /protein_id="ABX40953.1"
FT                   /translation="MRKSIRTKLVSVVLLLSLFSIVTNITNLNSVKKIHDAAYNVDSSN
FT                   PEAMEAARSELKGIYDTSIQSNYIGIGFMIFLTIAVIVITRKSIITPTKKSTKQLEEIL
FT                   YDFNSGQGDLTKRVTVYTKDEIGHLVSGINTFLETLQGIMGHMVSDSKQLKLSISLVSN
FT                   SISQVNDNSCDISSTMQQLAASMEEVTATISSMIDSIGILNTDVTTMVDKSVGTMEYIG
FT                   EMKIRANAMKEDATGKKATTSEMLNKIGDTLREAIENSKKVERIDELTNDILVISNQTN
FT                   LLALNASIEAARAGEAGKGFAVVADEIRQLADNSRNTATNIQEISGLVRDAVLNLSDSS
FT                   KLVLDYIQTTVLGDYDKNVVSGIQYDNDASFLHDNITQFMDYIKALNRMIENMSDSFHG
FT                   IASAVDESAMGVSNAANNASNLVEEMSKISKEIKNNEMISISLNEEANRFVEI"
FT   sig_peptide     728797..728871
FT                   /locus_tag="Cphy_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.356 at
FT                   residue 25"
FT   gene            complement(730286..731383)
FT                   /locus_tag="Cphy_0567"
FT   CDS_pept        complement(730286..731383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH3294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40954"
FT                   /db_xref="GOA:A9KIV5"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIV5"
FT                   /protein_id="ABX40954.1"
FT                   /translation="MGYKISARQKIDKIKATKFNSNQNMNDSKDNSIHNNKKLQLNKIL
FT                   HILSFIILMIGTYLLIDLLWISPMKSNNAMKKIQQIYEKSTPIPEDTIAPSIPKAIDDQ
FT                   VSSGKTSEIIPIEKFKQLLELNPDIKGWIQIEGTNINYPVLQSSKEEPEYYLTRNINKE
FT                   EDRLGSLFLDTNTEIETPTQCLLIHGHNMTSTGNMFHELMKFNDMDFLINSPIIQFDTL
FT                   YDVSLWKIFAVFKTNGSSAKEELFDYQRGSFEDSSDFLNFVYQIKVRSIYNIPVEISKE
FT                   DQLLLLSTCSYELPNYRTVIVARKLRPGESKELSRESVTKNKTPLYPDSWYQQYGGIPP
FT                   AITNFEEAQKNHDINWYQDFTNGTR"
FT   gene            complement(731604..732623)
FT                   /locus_tag="Cphy_0568"
FT   CDS_pept        complement(731604..732623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0568"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: apl:APL_0819
FT                   HTH-type transcriptional repressor PurR"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40955"
FT                   /db_xref="GOA:A9KIV6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIV6"
FT                   /protein_id="ABX40955.1"
FT                   /translation="MSTIREVAKLANVSIATVSRVLNNDTKYKMTEETKNRVLDAVTQL
FT                   NYIPITTPRKKMTVTNSNICKDAKIGCILRVTKKGYNDPYYMSILAGVETQLREVGIEL
FT                   SFIKSAPILQDKSHLASTFSDSLDGLILMEPLNEDIYHYIKKRVPHVVGIDTLRDDIDD
FT                   VGYDHLENGILATQHLIEKGHKEIGFIGGSGESQDIKDSKRYQGYVIAMHKAGLPIQKK
FT                   WIIDCGWNEDECVAKVDALCKSNHYPTAFFAASDLMAMAAMKSFYTNGISVPKRVAVIG
FT                   MSDIEMSQYSNPPLTTYHVPKEEIGRVATNLLLARIQGYETLPQKIILPTTFVERSST"
FT   gene            733282..734193
FT                   /locus_tag="Cphy_0569"
FT   CDS_pept        733282..734193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpf:CPF_1411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40956"
FT                   /db_xref="GOA:A9KIV7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIV7"
FT                   /protein_id="ABX40956.1"
FT                   /translation="MEKPVLVIMAAGMGSRYGGLKQIDSVDEQGHIIIDFSIFDAIKAG
FT                   FKKVIFIIKKEIEEDFKEVIGNRIEKIVEVEYVYQEIAKVPENFTVPESRVKPWGTGHA
FT                   ILCCMDKIQGPFAVINADDFYGREAFVKIYDFLSSIEQINLYSMVGYQLKNTLTEHGSV
FT                   ARGVCNVNEEGFLTKITERTKIEKFPDGAKYYESETDTWEEISFDSTVSMNLWGFQANI
FT                   MAELKEEFDTFLKTEVANNPEKSEFFLPTVVQHMIESQKVQVKVLHSKDQWFGVTYKED
FT                   KEVVLKEIAKLKEQGIYPENLW"
FT   gene            734224..735336
FT                   /locus_tag="Cphy_0570"
FT   CDS_pept        734224..735336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpe:CPE1200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40957"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIV8"
FT                   /protein_id="ABX40957.1"
FT                   /translation="MAREIKNELIENAIAQFQVEGTVESYERYGNGHINDTFVVAYEKD
FT                   GKIKRFILQRINHSIFKEPEKLMFNIAQVTSFLKDEVRKLGGDELREVLTIINTKNGKP
FT                   FYLDTEGSYWRMYLFIEDATSFEQVSKPEDFYQSAVAFGRFQKLLSAFDATSLYEVIPN
FT                   FHNTPLRYEAFLKAVNEDKCNRAKDVKEEIEFFIKRKEDMEYCKKCLDEGKLPLRVTHN
FT                   DTKLNNVMIDNKSGNGLCVIDLDTVMPGLSIFDFGDSIRFGANTATEDEKDLSKVSLDL
FT                   DLFELYVKGYLTGCEGSLTDTEISMLPHGAKTMTLECGMRFLMDYLEGDVYFRIHREEH
FT                   NLDRCHTQMALVLDMERKWDDMKEKVSKYR"
FT   gene            735349..736362
FT                   /locus_tag="Cphy_0571"
FT   CDS_pept        735349..736362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0571"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; Male sterility domain; KEGG: bcy:Bcer98_3965
FT                   UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40958"
FT                   /db_xref="GOA:A9KIV9"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIV9"
FT                   /protein_id="ABX40958.1"
FT                   /translation="MSILVTGGAGYIGSHTCLELLRKGYDVVVVDNLSNSSKESLERVK
FT                   KLANKDLTFYEFNVEDKEKLTEVFEKENIESVIHFAGLKAVGESVQKPLAYYYNNLVST
FT                   LVLCEVMSKFQVKKLVFSSSATVYGNPHTVPIKEDFPLSVTNPYGRTKLMQEEMLRDLV
FT                   VADSEWKIILLRYFNPIGADESGMIGEDPLGIPNNLVPYITQVAVGKLKELQVFGDDYD
FT                   TPDGSGVRDYIHVTDLAIGHVKSIEKLEQIEGVKTYNLGTGKGYSVLEMVTAFSEVCKK
FT                   TIPYVVKARRPGDIATCYADPKLAKEELGFTAVRELKKMCEDAYRWQCNYPNGYRD"
FT   gene            complement(736501..737403)
FT                   /locus_tag="Cphy_0572"
FT   CDS_pept        complement(736501..737403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0572"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   Cupin 2 conserved barrel domain protein; KEGG:
FT                   cth:Cthe_2212 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40959"
FT                   /db_xref="GOA:A9KIW0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIW0"
FT                   /protein_id="ABX40959.1"
FT                   /translation="MSNSRYNFKIDNESEASMIHKEDSTLSYTFNPDGKQGNQVHVTLL
FT                   YVAISKYGTDWKSLPHSHNFAEFFYITNGSGQFSVEKEILDVKANDLIILNPTIVHTEI
FT                   SNPSKPMEYIVLGIEGIKFQAEDQGYILLNSSAHKSDLHLYFNSLAHEMKSEQPYRNFV
FT                   CQNLLNIIFTMILRNDAFKISIVSGPKLTRECNIAKKYIEENYQENITIETLSSLVHLN
FT                   KYYFVHNFKKQFGTSPINYLIKRRIEESMHLLVSTNHSLSSISQIVGFSSPSYFSQAFK
FT                   RMTNITPQEYKKMYKVPSS"
FT   gene            737574..738956
FT                   /locus_tag="Cphy_0573"
FT   CDS_pept        737574..738956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0573"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: pac:PPA0085 periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40960"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR022387"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIW1"
FT                   /protein_id="ABX40960.1"
FT                   /translation="MKKIGSILLVLTLMISLLAGCGKKDTTGEGTAPTAVPTNEASKEN
FT                   PTEKPKQDVTIKVAAIETAYGPDMWTKVCEAFEAKTGIKVELTTDKLLEDVIGAGMKAG
FT                   DYPDVVHLATGRPAALTETLIKENGLEDLTDVLSMTVPGEDKKVSDKIAGGFTESSLTN
FT                   PYNDGKTYMAPMFYSPCGLFYNKGLFAEKGWTVPTTWDEMWTLADKAKAEGIALFAYPT
FT                   AGYFDAFFYALLYEVGGADFFAKATTYTEGIWDTPEANKAFDIVEKLASYTEKSVPSNA
FT                   NNDNYLKNQQLILDNKALFMPNGTWVVGEMKYAPRVNGFEWGFTALPAIAKGEDSYSFT
FT                   WFEQLWVPAAAEHKDAAKQFVAFMYSDEAAKIFAESGAVQPIVGFADKLEGDNKLFYSI
FT                   YDNGAKAALGGFAATEPVEGVNFSDTVFGTVNSLVSGDKTKAQWIDLIKKDSDLLRAAL
FT                   KK"
FT   sig_peptide     737574..737633
FT                   /locus_tag="Cphy_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.331 at
FT                   residue 20"
FT   gene            739199..740089
FT                   /locus_tag="Cphy_0574"
FT   CDS_pept        739199..740089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0574"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pac:PPA0086 putative
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40961"
FT                   /db_xref="GOA:A9KIW2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIW2"
FT                   /protein_id="ABX40961.1"
FT                   /translation="MKNRGKSLFIFLCVAPAVILFTIFMIIPTINIFKMSLYKWGGYSA
FT                   NKTFVGFDNFKKLASDMKFLQSFENTVLLIIIVSIVTIAFALLFAAILTREKIVGQNFF
FT                   RIVFYIPNILSIVIISAIFSAIFDSQNGLLNSILALFRGKGSEPIYWLGNQKIVIFSIA
FT                   IAMIWQAIGYYMVMYMASMASVPESVYESASIEGASRIRQFFHLTIPLIWTNIRTTLTF
FT                   FIISSINLSFMLVKAMTSGGPDGSTEVFLSYMYKQAYTNSSYGYGMAIGVVVFLFSFTL
FT                   SGIVNLITKREPLEL"
FT   gene            740100..740978
FT                   /locus_tag="Cphy_0575"
FT   CDS_pept        740100..740978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0575"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pac:PPA0087 permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40962"
FT                   /db_xref="GOA:A9KIW3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIW3"
FT                   /protein_id="ABX40962.1"
FT                   /translation="MNKEKNLPLKKIVIYLVLGLLAISIIVPVGWVFIASIKKNSEFYG
FT                   SPWKLPESIYFQNFVEAWGSAHMGEYMLNSVIVTVVALLVLLVVSLPAAYCLSRFKFRL
FT                   RKILNILFMAGLFINVNYIVVPIFLMFIDADKALKGWGFSPFFLNNIYVLAIVYAATAL
FT                   PFTIYLLSGYLVTIPKTYEEAAYIDGSGYFRTMVKVILPMARPSIITVILFNFLSFWNE
FT                   YIIAITLLADPKGGKTLPVGLMNLMKAQNAAAQYGRMYAGLVLVMLPTLILYIMVQKKL
FT                   TQGMMLGGLKG"
FT   gene            740986..741162
FT                   /locus_tag="Cphy_0576"
FT   CDS_pept        740986..741162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40963"
FT                   /db_xref="GOA:A9KIW4"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIW4"
FT                   /protein_id="ABX40963.1"
FT                   /translation="MENAMKVLGIVLKCIILVVCVGLVIIGQKSISYQGLYTMLAGLGG
FT                   ILILLFLYNRKYK"
FT   gene            741481..743652
FT                   /locus_tag="Cphy_0577"
FT   CDS_pept        741481..743652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cpr:CPR_0537 conserved hypothetical protein TIGR02336"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40964"
FT                   /db_xref="GOA:A9KIW5"
FT                   /db_xref="InterPro:IPR012711"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035080"
FT                   /db_xref="InterPro:IPR035356"
FT                   /db_xref="InterPro:IPR035363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KIW5"
FT                   /protein_id="ABX40964.1"
FT                   /translation="MKKDTMLAGRVTIPTDVDVVPETMELLNRWGADAIRDCDGTDYPE
FT                   ELKAVQAKVYSTYYTTRKDNAWAKAHPEEVQQCYIMTSFYTATETTLRIPLLKGIAKEL
FT                   MMVNNYDDKVRWWEVIDRSTAMVVSTDTWSYDKETGEVIITNCEPFHNYTVSFLAYLIW
FT                   DPVHMYNAVVNGWQGVEHQITFDVRQPKTREYSMVRLRKFIEEHPYVDVIRYTTFFHQF
FT                   TLVFDEMMREKYVDWYGYSASVSPYILEQFEKEVGYRFRPEFIIDQGYYNNQYRIPSKE
FT                   FKDFQAFQRREVAKLAKEMVDITHEYGKEAMMFLGDHWIGTEPFMEEFKTIGLDAVVGS
FT                   VGNGSTLRLISDIPGVKYTEGRFLPYFFPDTFHEGGDPVKEAKVNWVTARRAILRKPID
FT                   RIGYGGYLKLACQFPEFIDYVESVCNEFRELYENIKGTTPFCIKRVAVLNSWGKMRAWG
FT                   AHMVHHALYQKQNYSYAGVIESLSGTPFEVSFISFDDIKKDKNILKNIDVIINVGDGDT
FT                   AHTGGLVWEDADISSAIHQFVYEGGGLIGIGEPTGHQYQGRYIQLANVFGIEKETGFTL
FT                   NYDKYNWDAVESHFITEDCTKEVDFGEGKKNMYALEGTTILVQMEKEVQMAVNEFGKGR
FT                   SVYLSGLPYSFENSRVLYRSILWSAHEEENLHKWYSSNFNVEVHAYVKNNKYCVVNNTY
FT                   EPQNTTIYRGDSSSFDLELEANEIIWYEI"
FT   gene            complement(743784..745598)
FT                   /locus_tag="Cphy_0578"
FT   CDS_pept        complement(743784..745598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0578"
FT                   /product="histidine kinase internal region"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase internal region; KEGG: bld:BLi00440 putative ABC
FT                   transporter (permease); RBL00398"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40965"
FT                   /db_xref="GOA:A9KIW6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIW6"
FT                   /protein_id="ABX40965.1"
FT                   /translation="MIKNIFSKLYDYYVLRMKLKSKFMISHLLLALVPTIFITILCYQQ
FT                   LLGITTNNTLKSLASISYQTQNSLSNTISQLDDIASSIESQDFFTNFLYSDSPEEYKND
FT                   STFQVSLNNFFATVNFLANNNNASAVKIYINDIHYNVISSYNKEGIFDHEAATLGTYWH
FT                   GILSNTKQSILVCPSMYLSPNEIREYGDLAIIHSLKVNDDYIYVVVYFKQEIIDNILKQ
FT                   DLPFTHSVIYILNERDTLVSTTSSALYGTYLLKYKKIPELIKTTTKFMPVDFSNSKVYC
FT                   NYKTIIGTDWYMVTTIPARNMLEEGKQLLLRFLLFYLVILVSGVTLALQLNKSIVNRIS
FT                   SVITKMQSAKYGVPSPLDTKGGTDEIGDLIETYNFMSDQLNHLMLAQEQASKDLRLSEF
FT                   KALQSQINPHFLYNTLDMINWMAQAGKSSEISLAVQRLSRFYKLTLSKGNNIVSVKSEL
FT                   EHITLYVQLQNMRFDDKIHFFIDVPDEILDYEIPKLIFQPIVENSILHGILEKETKEGN
FT                   IVIMGWMDDDDLIFVISDDGVGITSDILSNILKGTVNTDKGSSIAIMNTHTRLQVYFGN
FT                   EYGLSFRSTEGVETEVEIRIPARPYRKM"
FT   gene            complement(745624..747219)
FT                   /locus_tag="Cphy_0579"
FT   CDS_pept        complement(745624..747219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0579"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; response regulator receiver; KEGG: csc:Csac_0684
FT                   response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40966"
FT                   /db_xref="GOA:A9KIW7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="PDB:3CU5"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIW7"
FT                   /protein_id="ABX40966.1"
FT                   /translation="MRILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAIQIALK
FT                   HPPNVLLTDVRMPRMDGIELVDNILKLYPDCSVIFMSGYSDKEYLKAAIKFRAIRYVEK
FT                   PIDPSEIMDALKQSIQTVLQHQAQQDSNVLYAKEAVSRFAQRLTHNGYDMKSDTLIDDA
FT                   VLRGSINNSTIFTTCILRIISPYNVIVDRSNLSSYLENFDKQIAKWHLNEIHFIKNDSL
FT                   IVLHIYGNERPEESVVSKIGTYIKSVIPIELNYFITFGKTVTGPSKVFDSYNSAAILLQ
FT                   SSFFFDYGSILIHKSSPQSVSSIYPHEFLNDFTEAIREKNFLRARELVETLYRSLKNNK
FT                   TLLTNVIKDMYYKAFLQINSVQYDLKLQTENAVSDSESMLDNITNCIILNELHQMLLAK
FT                   IDRFEEKLQSTPKETSTIFLIRDYISNHYGDYSLSIKDISDHVRLSFSYLCTVFKTETG
FT                   ETLNQYITNYRIEKAKQLLSDPRNKIIEVSSRVGYADNNYFGKIFKKIVGITPSEYREK
FT                   ELGRNTSFYVLKKK"
FT   gene            747501..749027
FT                   /locus_tag="Cphy_0580"
FT   CDS_pept        747501..749027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0580"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tte:TTE0763 ABC-type sugar (aldose) transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40967"
FT                   /db_xref="GOA:A9KIW8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIW8"
FT                   /protein_id="ABX40967.1"
FT                   /translation="MAEEYILELKGITKVFPGVRALDGVHFQLKKGEIHALMGENGAGK
FT                   STFIKVITGVHKAEQGEIYLNGIKVEFKGPKDAQAAGIAAIYQHVTAYPHLTVTENIFM
FT                   GHEKIKNGIIQWKQMNQDAQKLLEQLNADFKATDEMGSLSVAQQQMVEIAKALSSNAKI
FT                   IIMDEPTASLTKNESENLYRIAERLRDDGTSIIFISHRFEDMYRLATKVTVFRDSKYIG
FT                   TYDVDKISNQDLITAMVGREINDMFPKPEIKVGGEVLRVEKLCREGYFKDVSFTVHAGE
FT                   ILGLTGLVGARRTEVIQTIYGVEKLDSGKIFLEGKQVEIRNVQDAIKNGIGLLTEDRSN
FT                   LGLILSWGIGRNITLTEIEKYGSRLFTKEKEEHAVSKKLAEEVDTKAVSIFDKVSTLSG
FT