(data stored in ACNUC8465 zone)

EMBL: CP000886

ID   CP000886; SV 1; circular; genomic DNA; STD; PRO; 4858887 BP.
XX
AC   CP000886;
XX
PR   Project:PRJNA27803;
XX
DT   01-DEC-2007 (Rel. 94, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7, complete
DE   genome.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-4858887
RG   The Salmonella enterica serovar Paratyphi B Genome Sequencing Project
RA   McClelland M., Sanderson E.K., Porwollik S., Spieth J., Clifton W.S.,
RA   Fulton R., Cordes M., Wollam A., Shah N., Pepin K., Bhonagiri V., Nash W.,
RA   Johnson M., Thiruvilangam P., Wilson R.;
RT   ;
RL   Submitted (13-NOV-2007) to the INSDC.
RL   Genetics, Genome Sequencing Center, 4444 Forest Park Parkway, St. Louis, MO
RL   63108, USA
XX
DR   MD5; bf14c2a0795b24748169d547125f599c.
DR   BioSample; SAMN02603951.
DR   COMPARE-RefGenome; SPB7.
DR   EnsemblGenomes-Gn; EBG00001082747.
DR   EnsemblGenomes-Gn; EBG00001082748.
DR   EnsemblGenomes-Gn; EBG00001082749.
DR   EnsemblGenomes-Gn; EBG00001082750.
DR   EnsemblGenomes-Gn; EBG00001082751.
DR   EnsemblGenomes-Gn; EBG00001082752.
DR   EnsemblGenomes-Gn; EBG00001082753.
DR   EnsemblGenomes-Gn; EBG00001082754.
DR   EnsemblGenomes-Gn; EBG00001082755.
DR   EnsemblGenomes-Gn; EBG00001082756.
DR   EnsemblGenomes-Gn; EBG00001082757.
DR   EnsemblGenomes-Gn; EBG00001082758.
DR   EnsemblGenomes-Gn; EBG00001082759.
DR   EnsemblGenomes-Gn; EBG00001082760.
DR   EnsemblGenomes-Gn; EBG00001082761.
DR   EnsemblGenomes-Gn; EBG00001082762.
DR   EnsemblGenomes-Gn; EBG00001082763.
DR   EnsemblGenomes-Gn; EBG00001082764.
DR   EnsemblGenomes-Gn; EBG00001082765.
DR   EnsemblGenomes-Gn; EBG00001082766.
DR   EnsemblGenomes-Gn; EBG00001082767.
DR   EnsemblGenomes-Gn; EBG00001082768.
DR   EnsemblGenomes-Gn; EBG00001082769.
DR   EnsemblGenomes-Gn; EBG00001082770.
DR   EnsemblGenomes-Gn; EBG00001082771.
DR   EnsemblGenomes-Gn; EBG00001082772.
DR   EnsemblGenomes-Gn; EBG00001082773.
DR   EnsemblGenomes-Gn; EBG00001082774.
DR   EnsemblGenomes-Gn; EBG00001082775.
DR   EnsemblGenomes-Gn; EBG00001082776.
DR   EnsemblGenomes-Gn; EBG00001082777.
DR   EnsemblGenomes-Gn; EBG00001082778.
DR   EnsemblGenomes-Gn; EBG00001082779.
DR   EnsemblGenomes-Gn; EBG00001082780.
DR   EnsemblGenomes-Gn; EBG00001082781.
DR   EnsemblGenomes-Gn; EBG00001082782.
DR   EnsemblGenomes-Gn; EBG00001082783.
DR   EnsemblGenomes-Gn; EBG00001082784.
DR   EnsemblGenomes-Gn; EBG00001082785.
DR   EnsemblGenomes-Gn; EBG00001082786.
DR   EnsemblGenomes-Gn; EBG00001082787.
DR   EnsemblGenomes-Gn; EBG00001082788.
DR   EnsemblGenomes-Gn; EBG00001082789.
DR   EnsemblGenomes-Gn; EBG00001082790.
DR   EnsemblGenomes-Gn; EBG00001082791.
DR   EnsemblGenomes-Gn; EBG00001082792.
DR   EnsemblGenomes-Gn; EBG00001082793.
DR   EnsemblGenomes-Gn; EBG00001082794.
DR   EnsemblGenomes-Gn; EBG00001082795.
DR   EnsemblGenomes-Gn; EBG00001082796.
DR   EnsemblGenomes-Gn; EBG00001082797.
DR   EnsemblGenomes-Gn; EBG00001082798.
DR   EnsemblGenomes-Gn; EBG00001082799.
DR   EnsemblGenomes-Gn; EBG00001082800.
DR   EnsemblGenomes-Gn; EBG00001082801.
DR   EnsemblGenomes-Gn; EBG00001082802.
DR   EnsemblGenomes-Gn; EBG00001082803.
DR   EnsemblGenomes-Gn; EBG00001082804.
DR   EnsemblGenomes-Gn; EBG00001082805.
DR   EnsemblGenomes-Gn; EBG00001082806.
DR   EnsemblGenomes-Gn; EBG00001082807.
DR   EnsemblGenomes-Gn; EBG00001082808.
DR   EnsemblGenomes-Gn; EBG00001082809.
DR   EnsemblGenomes-Gn; EBG00001082810.
DR   EnsemblGenomes-Gn; EBG00001082811.
DR   EnsemblGenomes-Gn; EBG00001082812.
DR   EnsemblGenomes-Gn; EBG00001082813.
DR   EnsemblGenomes-Gn; EBG00001082814.
DR   EnsemblGenomes-Gn; EBG00001082815.
DR   EnsemblGenomes-Gn; EBG00001082816.
DR   EnsemblGenomes-Gn; EBG00001082817.
DR   EnsemblGenomes-Gn; EBG00001082818.
DR   EnsemblGenomes-Gn; EBG00001082819.
DR   EnsemblGenomes-Gn; EBG00001082820.
DR   EnsemblGenomes-Gn; EBG00001082821.
DR   EnsemblGenomes-Gn; EBG00001082822.
DR   EnsemblGenomes-Gn; EBG00001082823.
DR   EnsemblGenomes-Gn; EBG00001082824.
DR   EnsemblGenomes-Gn; EBG00001082825.
DR   EnsemblGenomes-Gn; EBG00001082826.
DR   EnsemblGenomes-Gn; EBG00001082827.
DR   EnsemblGenomes-Gn; EBG00001082828.
DR   EnsemblGenomes-Gn; EBG00001082829.
DR   EnsemblGenomes-Gn; EBG00001082830.
DR   EnsemblGenomes-Gn; EBG00001082831.
DR   EnsemblGenomes-Gn; EBG00001082832.
DR   EnsemblGenomes-Gn; EBG00001082833.
DR   EnsemblGenomes-Gn; EBG00001082834.
DR   EnsemblGenomes-Gn; EBG00001082835.
DR   EnsemblGenomes-Gn; EBG00001082836.
DR   EnsemblGenomes-Gn; EBG00001082837.
DR   EnsemblGenomes-Gn; EBG00001082838.
DR   EnsemblGenomes-Gn; EBG00001082839.
DR   EnsemblGenomes-Gn; EBG00001082840.
DR   EnsemblGenomes-Gn; EBG00001082841.
DR   EnsemblGenomes-Gn; EBG00001082842.
DR   EnsemblGenomes-Gn; EBG00001082843.
DR   EnsemblGenomes-Gn; EBG00001082844.
DR   EnsemblGenomes-Gn; EBG00001082845.
DR   EnsemblGenomes-Gn; EBG00001082846.
DR   EnsemblGenomes-Gn; EBG00001082847.
DR   EnsemblGenomes-Gn; EBG00001082848.
DR   EnsemblGenomes-Gn; EBG00001082849.
DR   EnsemblGenomes-Gn; EBG00001082850.
DR   EnsemblGenomes-Gn; EBG00001082851.
DR   EnsemblGenomes-Gn; EBG00001082852.
DR   EnsemblGenomes-Gn; EBG00001082853.
DR   EnsemblGenomes-Gn; EBG00001082854.
DR   EnsemblGenomes-Gn; EBG00001082855.
DR   EnsemblGenomes-Gn; EBG00001082856.
DR   EnsemblGenomes-Gn; EBG00001082857.
DR   EnsemblGenomes-Gn; EBG00001082858.
DR   EnsemblGenomes-Gn; EBG00001082859.
DR   EnsemblGenomes-Gn; EBG00001082860.
DR   EnsemblGenomes-Gn; EBG00001082861.
DR   EnsemblGenomes-Gn; EBG00001082862.
DR   EnsemblGenomes-Gn; EBG00001082863.
DR   EnsemblGenomes-Gn; EBG00001082864.
DR   EnsemblGenomes-Gn; EBG00001082865.
DR   EnsemblGenomes-Gn; EBG00001082866.
DR   EnsemblGenomes-Gn; EBG00001082867.
DR   EnsemblGenomes-Gn; EBG00001082868.
DR   EnsemblGenomes-Gn; EBG00001082869.
DR   EnsemblGenomes-Gn; EBG00001082870.
DR   EnsemblGenomes-Gn; EBG00001082871.
DR   EnsemblGenomes-Gn; EBG00001082872.
DR   EnsemblGenomes-Gn; EBG00001082873.
DR   EnsemblGenomes-Gn; EBG00001082874.
DR   EnsemblGenomes-Gn; EBG00001082875.
DR   EnsemblGenomes-Gn; EBG00001082876.
DR   EnsemblGenomes-Gn; EBG00001082877.
DR   EnsemblGenomes-Gn; EBG00001082878.
DR   EnsemblGenomes-Gn; EBG00001082879.
DR   EnsemblGenomes-Gn; EBG00001082880.
DR   EnsemblGenomes-Gn; EBG00001082881.
DR   EnsemblGenomes-Gn; EBG00001082882.
DR   EnsemblGenomes-Gn; EBG00001082883.
DR   EnsemblGenomes-Gn; EBG00001082884.
DR   EnsemblGenomes-Gn; EBG00001082885.
DR   EnsemblGenomes-Gn; EBG00001082886.
DR   EnsemblGenomes-Gn; EBG00001082887.
DR   EnsemblGenomes-Gn; EBG00001082888.
DR   EnsemblGenomes-Gn; EBG00001082889.
DR   EnsemblGenomes-Gn; EBG00001082890.
DR   EnsemblGenomes-Gn; EBG00001082891.
DR   EnsemblGenomes-Gn; EBG00001082892.
DR   EnsemblGenomes-Gn; EBG00001082893.
DR   EnsemblGenomes-Gn; EBG00001082894.
DR   EnsemblGenomes-Gn; EBG00001082895.
DR   EnsemblGenomes-Gn; EBG00001082896.
DR   EnsemblGenomes-Gn; EBG00001082897.
DR   EnsemblGenomes-Gn; EBG00001082898.
DR   EnsemblGenomes-Gn; EBG00001082899.
DR   EnsemblGenomes-Gn; EBG00001082900.
DR   EnsemblGenomes-Gn; EBG00001082901.
DR   EnsemblGenomes-Gn; EBG00001082902.
DR   EnsemblGenomes-Gn; EBG00001082903.
DR   EnsemblGenomes-Gn; EBG00001082904.
DR   EnsemblGenomes-Gn; EBG00001082905.
DR   EnsemblGenomes-Gn; EBG00001082906.
DR   EnsemblGenomes-Gn; EBG00001082907.
DR   EnsemblGenomes-Gn; EBG00001082908.
DR   EnsemblGenomes-Gn; EBG00001082909.
DR   EnsemblGenomes-Gn; EBG00001082910.
DR   EnsemblGenomes-Gn; EBG00001082911.
DR   EnsemblGenomes-Gn; EBG00001082912.
DR   EnsemblGenomes-Gn; EBG00001082913.
DR   EnsemblGenomes-Gn; EBG00001082914.
DR   EnsemblGenomes-Gn; EBG00001082915.
DR   EnsemblGenomes-Gn; EBG00001082916.
DR   EnsemblGenomes-Gn; EBG00001082917.
DR   EnsemblGenomes-Gn; EBG00001082918.
DR   EnsemblGenomes-Gn; EBG00001082919.
DR   EnsemblGenomes-Gn; EBG00001082920.
DR   EnsemblGenomes-Gn; EBG00001082921.
DR   EnsemblGenomes-Gn; EBG00001082922.
DR   EnsemblGenomes-Gn; EBG00001082923.
DR   EnsemblGenomes-Gn; EBG00001082924.
DR   EnsemblGenomes-Gn; EBG00001082925.
DR   EnsemblGenomes-Gn; EBG00001082926.
DR   EnsemblGenomes-Gn; EBG00001082927.
DR   EnsemblGenomes-Gn; EBG00001082928.
DR   EnsemblGenomes-Gn; EBG00001082929.
DR   EnsemblGenomes-Gn; EBG00001082930.
DR   EnsemblGenomes-Gn; EBG00001082931.
DR   EnsemblGenomes-Gn; EBG00001082932.
DR   EnsemblGenomes-Gn; EBG00001082933.
DR   EnsemblGenomes-Gn; EBG00001082934.
DR   EnsemblGenomes-Gn; EBG00001082935.
DR   EnsemblGenomes-Gn; EBG00001082936.
DR   EnsemblGenomes-Gn; EBG00001082937.
DR   EnsemblGenomes-Gn; EBG00001082938.
DR   EnsemblGenomes-Gn; EBG00001082939.
DR   EnsemblGenomes-Gn; EBG00001082940.
DR   EnsemblGenomes-Gn; EBG00001082941.
DR   EnsemblGenomes-Gn; EBG00001082942.
DR   EnsemblGenomes-Gn; EBG00001082943.
DR   EnsemblGenomes-Gn; EBG00001082944.
DR   EnsemblGenomes-Gn; EBG00001082945.
DR   EnsemblGenomes-Gn; EBG00001082946.
DR   EnsemblGenomes-Gn; EBG00001082947.
DR   EnsemblGenomes-Gn; EBG00001082948.
DR   EnsemblGenomes-Gn; EBG00001082949.
DR   EnsemblGenomes-Gn; EBG00001082950.
DR   EnsemblGenomes-Gn; EBG00001082951.
DR   EnsemblGenomes-Gn; EBG00001082952.
DR   EnsemblGenomes-Gn; EBG00001082953.
DR   EnsemblGenomes-Gn; EBG00001082954.
DR   EnsemblGenomes-Gn; EBG00001082955.
DR   EnsemblGenomes-Gn; EBG00001082956.
DR   EnsemblGenomes-Gn; EBG00001082957.
DR   EnsemblGenomes-Gn; EBG00001082958.
DR   EnsemblGenomes-Gn; EBG00001082959.
DR   EnsemblGenomes-Gn; EBG00001082960.
DR   EnsemblGenomes-Gn; EBG00001082961.
DR   EnsemblGenomes-Gn; EBG00001082962.
DR   EnsemblGenomes-Gn; EBG00001082963.
DR   EnsemblGenomes-Gn; EBG00001082964.
DR   EnsemblGenomes-Gn; EBG00001082965.
DR   EnsemblGenomes-Gn; EBG00001082966.
DR   EnsemblGenomes-Gn; EBG00001082967.
DR   EnsemblGenomes-Gn; EBG00001082968.
DR   EnsemblGenomes-Gn; EBG00001082969.
DR   EnsemblGenomes-Gn; EBG00001082970.
DR   EnsemblGenomes-Gn; EBG00001082971.
DR   EnsemblGenomes-Gn; EBG00001082972.
DR   EnsemblGenomes-Gn; EBG00001082973.
DR   EnsemblGenomes-Gn; EBG00001082974.
DR   EnsemblGenomes-Gn; EBG00001082975.
DR   EnsemblGenomes-Gn; EBG00001082976.
DR   EnsemblGenomes-Gn; EBG00001082977.
DR   EnsemblGenomes-Gn; EBG00001082978.
DR   EnsemblGenomes-Gn; EBG00001082979.
DR   EnsemblGenomes-Gn; EBG00001082980.
DR   EnsemblGenomes-Gn; EBG00001082981.
DR   EnsemblGenomes-Gn; EBG00001082982.
DR   EnsemblGenomes-Gn; EBG00001082983.
DR   EnsemblGenomes-Gn; EBG00001082984.
DR   EnsemblGenomes-Gn; EBG00001082985.
DR   EnsemblGenomes-Gn; EBG00001082986.
DR   EnsemblGenomes-Gn; EBG00001082987.
DR   EnsemblGenomes-Gn; EBG00001082988.
DR   EnsemblGenomes-Gn; EBG00001082989.
DR   EnsemblGenomes-Gn; EBG00001082990.
DR   EnsemblGenomes-Gn; EBG00001082991.
DR   EnsemblGenomes-Gn; EBG00001082992.
DR   EnsemblGenomes-Gn; SPAB_00316.
DR   EnsemblGenomes-Gn; SPAB_00317.
DR   EnsemblGenomes-Gn; SPAB_00318.
DR   EnsemblGenomes-Gn; SPAB_00319.
DR   EnsemblGenomes-Gn; SPAB_00539.
DR   EnsemblGenomes-Gn; SPAB_00540.
DR   EnsemblGenomes-Gn; SPAB_00541.
DR   EnsemblGenomes-Gn; SPAB_00542.
DR   EnsemblGenomes-Gn; SPAB_00546.
DR   EnsemblGenomes-Gn; SPAB_00547.
DR   EnsemblGenomes-Gn; SPAB_00571.
DR   EnsemblGenomes-Gn; SPAB_00721.
DR   EnsemblGenomes-Gn; SPAB_00770.
DR   EnsemblGenomes-Gn; SPAB_01091.
DR   EnsemblGenomes-Gn; SPAB_01094.
DR   EnsemblGenomes-Gn; SPAB_01108.
DR   EnsemblGenomes-Gn; SPAB_01139.
DR   EnsemblGenomes-Gn; SPAB_01141.
DR   EnsemblGenomes-Gn; SPAB_01212.
DR   EnsemblGenomes-Gn; SPAB_01213.
DR   EnsemblGenomes-Gn; SPAB_01214.
DR   EnsemblGenomes-Gn; SPAB_01480.
DR   EnsemblGenomes-Gn; SPAB_01483.
DR   EnsemblGenomes-Gn; SPAB_01900.
DR   EnsemblGenomes-Gn; SPAB_01901.
DR   EnsemblGenomes-Gn; SPAB_02098.
DR   EnsemblGenomes-Gn; SPAB_02119.
DR   EnsemblGenomes-Gn; SPAB_02403.
DR   EnsemblGenomes-Gn; SPAB_02469.
DR   EnsemblGenomes-Gn; SPAB_02574.
DR   EnsemblGenomes-Gn; SPAB_02770.
DR   EnsemblGenomes-Gn; SPAB_02771.
DR   EnsemblGenomes-Gn; SPAB_02772.
DR   EnsemblGenomes-Gn; SPAB_02773.
DR   EnsemblGenomes-Gn; SPAB_02775.
DR   EnsemblGenomes-Gn; SPAB_02864.
DR   EnsemblGenomes-Gn; SPAB_02866.
DR   EnsemblGenomes-Gn; SPAB_02867.
DR   EnsemblGenomes-Gn; SPAB_02868.
DR   EnsemblGenomes-Gn; SPAB_02870.
DR   EnsemblGenomes-Gn; SPAB_02871.
DR   EnsemblGenomes-Gn; SPAB_02873.
DR   EnsemblGenomes-Gn; SPAB_03008.
DR   EnsemblGenomes-Gn; SPAB_03107.
DR   EnsemblGenomes-Gn; SPAB_03277.
DR   EnsemblGenomes-Gn; SPAB_03348.
DR   EnsemblGenomes-Gn; SPAB_03361.
DR   EnsemblGenomes-Gn; SPAB_03362.
DR   EnsemblGenomes-Gn; SPAB_03363.
DR   EnsemblGenomes-Gn; SPAB_03365.
DR   EnsemblGenomes-Gn; SPAB_03366.
DR   EnsemblGenomes-Gn; SPAB_03367.
DR   EnsemblGenomes-Gn; SPAB_03411.
DR   EnsemblGenomes-Gn; SPAB_03507.
DR   EnsemblGenomes-Gn; SPAB_03508.
DR   EnsemblGenomes-Gn; SPAB_03509.
DR   EnsemblGenomes-Gn; SPAB_03510.
DR   EnsemblGenomes-Gn; SPAB_03511.
DR   EnsemblGenomes-Gn; SPAB_03720.
DR   EnsemblGenomes-Gn; SPAB_03721.
DR   EnsemblGenomes-Gn; SPAB_03783.
DR   EnsemblGenomes-Gn; SPAB_03886.
DR   EnsemblGenomes-Gn; SPAB_04009.
DR   EnsemblGenomes-Gn; SPAB_04052.
DR   EnsemblGenomes-Gn; SPAB_04101.
DR   EnsemblGenomes-Gn; SPAB_04106.
DR   EnsemblGenomes-Gn; SPAB_04233.
DR   EnsemblGenomes-Gn; SPAB_04234.
DR   EnsemblGenomes-Gn; SPAB_04235.
DR   EnsemblGenomes-Gn; SPAB_04236.
DR   EnsemblGenomes-Gn; SPAB_04237.
DR   EnsemblGenomes-Gn; SPAB_04238.
DR   EnsemblGenomes-Gn; SPAB_04517.
DR   EnsemblGenomes-Gn; SPAB_04834.
DR   EnsemblGenomes-Gn; SPAB_04835.
DR   EnsemblGenomes-Gn; SPAB_04836.
DR   EnsemblGenomes-Gn; SPAB_04838.
DR   EnsemblGenomes-Gn; SPAB_04839.
DR   EnsemblGenomes-Gn; SPAB_04840.
DR   EnsemblGenomes-Gn; SPAB_04841.
DR   EnsemblGenomes-Gn; SPAB_04876.
DR   EnsemblGenomes-Gn; SPAB_04877.
DR   EnsemblGenomes-Gn; SPAB_04878.
DR   EnsemblGenomes-Gn; SPAB_04879.
DR   EnsemblGenomes-Gn; SPAB_04945.
DR   EnsemblGenomes-Gn; SPAB_04946.
DR   EnsemblGenomes-Gn; SPAB_04947.
DR   EnsemblGenomes-Gn; SPAB_04949.
DR   EnsemblGenomes-Gn; SPAB_04950.
DR   EnsemblGenomes-Gn; SPAB_05109.
DR   EnsemblGenomes-Gn; SPAB_05118.
DR   EnsemblGenomes-Gn; SPAB_05119.
DR   EnsemblGenomes-Gn; SPAB_05120.
DR   EnsemblGenomes-Gn; SPAB_05122.
DR   EnsemblGenomes-Gn; SPAB_05123.
DR   EnsemblGenomes-Gn; SPAB_05128.
DR   EnsemblGenomes-Gn; SPAB_05129.
DR   EnsemblGenomes-Gn; SPAB_05130.
DR   EnsemblGenomes-Gn; SPAB_05131.
DR   EnsemblGenomes-Gn; SPAB_05170.
DR   EnsemblGenomes-Gn; SPAB_05171.
DR   EnsemblGenomes-Gn; SPAB_05172.
DR   EnsemblGenomes-Gn; SPAB_05173.
DR   EnsemblGenomes-Gn; SPAB_05450.
DR   EnsemblGenomes-Gn; SPAB_05485.
DR   EnsemblGenomes-Gn; SPAB_05486.
DR   EnsemblGenomes-Gn; SPAB_05487.
DR   EnsemblGenomes-Gn; SPAB_05645.
DR   EnsemblGenomes-Gn; SPAB_05729.
DR   EnsemblGenomes-Gn; SPAB_05730.
DR   EnsemblGenomes-Gn; SPAB_05731.
DR   EnsemblGenomes-Tr; EBT00001685138.
DR   EnsemblGenomes-Tr; EBT00001685139.
DR   EnsemblGenomes-Tr; EBT00001685140.
DR   EnsemblGenomes-Tr; EBT00001685141.
DR   EnsemblGenomes-Tr; EBT00001685142.
DR   EnsemblGenomes-Tr; EBT00001685143.
DR   EnsemblGenomes-Tr; EBT00001685144.
DR   EnsemblGenomes-Tr; EBT00001685145.
DR   EnsemblGenomes-Tr; EBT00001685146.
DR   EnsemblGenomes-Tr; EBT00001685147.
DR   EnsemblGenomes-Tr; EBT00001685148.
DR   EnsemblGenomes-Tr; EBT00001685149.
DR   EnsemblGenomes-Tr; EBT00001685150.
DR   EnsemblGenomes-Tr; EBT00001685151.
DR   EnsemblGenomes-Tr; EBT00001685152.
DR   EnsemblGenomes-Tr; EBT00001685153.
DR   EnsemblGenomes-Tr; EBT00001685154.
DR   EnsemblGenomes-Tr; EBT00001685155.
DR   EnsemblGenomes-Tr; EBT00001685156.
DR   EnsemblGenomes-Tr; EBT00001685157.
DR   EnsemblGenomes-Tr; EBT00001685158.
DR   EnsemblGenomes-Tr; EBT00001685159.
DR   EnsemblGenomes-Tr; EBT00001685160.
DR   EnsemblGenomes-Tr; EBT00001685161.
DR   EnsemblGenomes-Tr; EBT00001685162.
DR   EnsemblGenomes-Tr; EBT00001685163.
DR   EnsemblGenomes-Tr; EBT00001685164.
DR   EnsemblGenomes-Tr; EBT00001685165.
DR   EnsemblGenomes-Tr; EBT00001685166.
DR   EnsemblGenomes-Tr; EBT00001685167.
DR   EnsemblGenomes-Tr; EBT00001685168.
DR   EnsemblGenomes-Tr; EBT00001685169.
DR   EnsemblGenomes-Tr; EBT00001685170.
DR   EnsemblGenomes-Tr; EBT00001685171.
DR   EnsemblGenomes-Tr; EBT00001685172.
DR   EnsemblGenomes-Tr; EBT00001685173.
DR   EnsemblGenomes-Tr; EBT00001685174.
DR   EnsemblGenomes-Tr; EBT00001685175.
DR   EnsemblGenomes-Tr; EBT00001685176.
DR   EnsemblGenomes-Tr; EBT00001685177.
DR   EnsemblGenomes-Tr; EBT00001685178.
DR   EnsemblGenomes-Tr; EBT00001685179.
DR   EnsemblGenomes-Tr; EBT00001685180.
DR   EnsemblGenomes-Tr; EBT00001685181.
DR   EnsemblGenomes-Tr; EBT00001685182.
DR   EnsemblGenomes-Tr; EBT00001685183.
DR   EnsemblGenomes-Tr; EBT00001685184.
DR   EnsemblGenomes-Tr; EBT00001685185.
DR   EnsemblGenomes-Tr; EBT00001685186.
DR   EnsemblGenomes-Tr; EBT00001685187.
DR   EnsemblGenomes-Tr; EBT00001685188.
DR   EnsemblGenomes-Tr; EBT00001685189.
DR   EnsemblGenomes-Tr; EBT00001685190.
DR   EnsemblGenomes-Tr; EBT00001685191.
DR   EnsemblGenomes-Tr; EBT00001685192.
DR   EnsemblGenomes-Tr; EBT00001685193.
DR   EnsemblGenomes-Tr; EBT00001685194.
DR   EnsemblGenomes-Tr; EBT00001685195.
DR   EnsemblGenomes-Tr; EBT00001685196.
DR   EnsemblGenomes-Tr; EBT00001685197.
DR   EnsemblGenomes-Tr; EBT00001685198.
DR   EnsemblGenomes-Tr; EBT00001685199.
DR   EnsemblGenomes-Tr; EBT00001685200.
DR   EnsemblGenomes-Tr; EBT00001685201.
DR   EnsemblGenomes-Tr; EBT00001685202.
DR   EnsemblGenomes-Tr; EBT00001685203.
DR   EnsemblGenomes-Tr; EBT00001685204.
DR   EnsemblGenomes-Tr; EBT00001685205.
DR   EnsemblGenomes-Tr; EBT00001685206.
DR   EnsemblGenomes-Tr; EBT00001685207.
DR   EnsemblGenomes-Tr; EBT00001685208.
DR   EnsemblGenomes-Tr; EBT00001685209.
DR   EnsemblGenomes-Tr; EBT00001685210.
DR   EnsemblGenomes-Tr; EBT00001685211.
DR   EnsemblGenomes-Tr; EBT00001685212.
DR   EnsemblGenomes-Tr; EBT00001685213.
DR   EnsemblGenomes-Tr; EBT00001685214.
DR   EnsemblGenomes-Tr; EBT00001685215.
DR   EnsemblGenomes-Tr; EBT00001685216.
DR   EnsemblGenomes-Tr; EBT00001685217.
DR   EnsemblGenomes-Tr; EBT00001685218.
DR   EnsemblGenomes-Tr; EBT00001685219.
DR   EnsemblGenomes-Tr; EBT00001685220.
DR   EnsemblGenomes-Tr; EBT00001685221.
DR   EnsemblGenomes-Tr; EBT00001685222.
DR   EnsemblGenomes-Tr; EBT00001685223.
DR   EnsemblGenomes-Tr; EBT00001685224.
DR   EnsemblGenomes-Tr; EBT00001685225.
DR   EnsemblGenomes-Tr; EBT00001685226.
DR   EnsemblGenomes-Tr; EBT00001685227.
DR   EnsemblGenomes-Tr; EBT00001685228.
DR   EnsemblGenomes-Tr; EBT00001685229.
DR   EnsemblGenomes-Tr; EBT00001685230.
DR   EnsemblGenomes-Tr; EBT00001685231.
DR   EnsemblGenomes-Tr; EBT00001685232.
DR   EnsemblGenomes-Tr; EBT00001685233.
DR   EnsemblGenomes-Tr; EBT00001685234.
DR   EnsemblGenomes-Tr; EBT00001685235.
DR   EnsemblGenomes-Tr; EBT00001685236.
DR   EnsemblGenomes-Tr; EBT00001685237.
DR   EnsemblGenomes-Tr; EBT00001685238.
DR   EnsemblGenomes-Tr; EBT00001685239.
DR   EnsemblGenomes-Tr; EBT00001685240.
DR   EnsemblGenomes-Tr; EBT00001685241.
DR   EnsemblGenomes-Tr; EBT00001685242.
DR   EnsemblGenomes-Tr; EBT00001685243.
DR   EnsemblGenomes-Tr; EBT00001685244.
DR   EnsemblGenomes-Tr; EBT00001685245.
DR   EnsemblGenomes-Tr; EBT00001685246.
DR   EnsemblGenomes-Tr; EBT00001685247.
DR   EnsemblGenomes-Tr; EBT00001685248.
DR   EnsemblGenomes-Tr; EBT00001685249.
DR   EnsemblGenomes-Tr; EBT00001685250.
DR   EnsemblGenomes-Tr; EBT00001685251.
DR   EnsemblGenomes-Tr; EBT00001685252.
DR   EnsemblGenomes-Tr; EBT00001685253.
DR   EnsemblGenomes-Tr; EBT00001685254.
DR   EnsemblGenomes-Tr; EBT00001685255.
DR   EnsemblGenomes-Tr; EBT00001685256.
DR   EnsemblGenomes-Tr; EBT00001685257.
DR   EnsemblGenomes-Tr; EBT00001685258.
DR   EnsemblGenomes-Tr; EBT00001685259.
DR   EnsemblGenomes-Tr; EBT00001685260.
DR   EnsemblGenomes-Tr; EBT00001685261.
DR   EnsemblGenomes-Tr; EBT00001685262.
DR   EnsemblGenomes-Tr; EBT00001685263.
DR   EnsemblGenomes-Tr; EBT00001685264.
DR   EnsemblGenomes-Tr; EBT00001685265.
DR   EnsemblGenomes-Tr; EBT00001685266.
DR   EnsemblGenomes-Tr; EBT00001685267.
DR   EnsemblGenomes-Tr; EBT00001685268.
DR   EnsemblGenomes-Tr; EBT00001685269.
DR   EnsemblGenomes-Tr; EBT00001685270.
DR   EnsemblGenomes-Tr; EBT00001685271.
DR   EnsemblGenomes-Tr; EBT00001685272.
DR   EnsemblGenomes-Tr; EBT00001685273.
DR   EnsemblGenomes-Tr; EBT00001685274.
DR   EnsemblGenomes-Tr; EBT00001685275.
DR   EnsemblGenomes-Tr; EBT00001685276.
DR   EnsemblGenomes-Tr; EBT00001685277.
DR   EnsemblGenomes-Tr; EBT00001685278.
DR   EnsemblGenomes-Tr; EBT00001685279.
DR   EnsemblGenomes-Tr; EBT00001685280.
DR   EnsemblGenomes-Tr; EBT00001685281.
DR   EnsemblGenomes-Tr; EBT00001685282.
DR   EnsemblGenomes-Tr; EBT00001685283.
DR   EnsemblGenomes-Tr; EBT00001685284.
DR   EnsemblGenomes-Tr; EBT00001685285.
DR   EnsemblGenomes-Tr; EBT00001685286.
DR   EnsemblGenomes-Tr; EBT00001685287.
DR   EnsemblGenomes-Tr; EBT00001685288.
DR   EnsemblGenomes-Tr; EBT00001685289.
DR   EnsemblGenomes-Tr; EBT00001685290.
DR   EnsemblGenomes-Tr; EBT00001685291.
DR   EnsemblGenomes-Tr; EBT00001685292.
DR   EnsemblGenomes-Tr; EBT00001685293.
DR   EnsemblGenomes-Tr; EBT00001685294.
DR   EnsemblGenomes-Tr; EBT00001685295.
DR   EnsemblGenomes-Tr; EBT00001685296.
DR   EnsemblGenomes-Tr; EBT00001685297.
DR   EnsemblGenomes-Tr; EBT00001685298.
DR   EnsemblGenomes-Tr; EBT00001685299.
DR   EnsemblGenomes-Tr; EBT00001685300.
DR   EnsemblGenomes-Tr; EBT00001685301.
DR   EnsemblGenomes-Tr; EBT00001685302.
DR   EnsemblGenomes-Tr; EBT00001685303.
DR   EnsemblGenomes-Tr; EBT00001685304.
DR   EnsemblGenomes-Tr; EBT00001685305.
DR   EnsemblGenomes-Tr; EBT00001685306.
DR   EnsemblGenomes-Tr; EBT00001685307.
DR   EnsemblGenomes-Tr; EBT00001685308.
DR   EnsemblGenomes-Tr; EBT00001685309.
DR   EnsemblGenomes-Tr; EBT00001685310.
DR   EnsemblGenomes-Tr; EBT00001685311.
DR   EnsemblGenomes-Tr; EBT00001685312.
DR   EnsemblGenomes-Tr; EBT00001685313.
DR   EnsemblGenomes-Tr; EBT00001685314.
DR   EnsemblGenomes-Tr; EBT00001685315.
DR   EnsemblGenomes-Tr; EBT00001685316.
DR   EnsemblGenomes-Tr; EBT00001685317.
DR   EnsemblGenomes-Tr; EBT00001685318.
DR   EnsemblGenomes-Tr; EBT00001685319.
DR   EnsemblGenomes-Tr; EBT00001685320.
DR   EnsemblGenomes-Tr; EBT00001685321.
DR   EnsemblGenomes-Tr; EBT00001685322.
DR   EnsemblGenomes-Tr; EBT00001685323.
DR   EnsemblGenomes-Tr; EBT00001685324.
DR   EnsemblGenomes-Tr; EBT00001685325.
DR   EnsemblGenomes-Tr; EBT00001685326.
DR   EnsemblGenomes-Tr; EBT00001685327.
DR   EnsemblGenomes-Tr; EBT00001685328.
DR   EnsemblGenomes-Tr; EBT00001685329.
DR   EnsemblGenomes-Tr; EBT00001685330.
DR   EnsemblGenomes-Tr; EBT00001685331.
DR   EnsemblGenomes-Tr; EBT00001685332.
DR   EnsemblGenomes-Tr; EBT00001685333.
DR   EnsemblGenomes-Tr; EBT00001685334.
DR   EnsemblGenomes-Tr; EBT00001685335.
DR   EnsemblGenomes-Tr; EBT00001685336.
DR   EnsemblGenomes-Tr; EBT00001685337.
DR   EnsemblGenomes-Tr; EBT00001685338.
DR   EnsemblGenomes-Tr; EBT00001685339.
DR   EnsemblGenomes-Tr; EBT00001685340.
DR   EnsemblGenomes-Tr; EBT00001685341.
DR   EnsemblGenomes-Tr; EBT00001685342.
DR   EnsemblGenomes-Tr; EBT00001685343.
DR   EnsemblGenomes-Tr; EBT00001685344.
DR   EnsemblGenomes-Tr; EBT00001685345.
DR   EnsemblGenomes-Tr; EBT00001685346.
DR   EnsemblGenomes-Tr; EBT00001685347.
DR   EnsemblGenomes-Tr; EBT00001685348.
DR   EnsemblGenomes-Tr; EBT00001685349.
DR   EnsemblGenomes-Tr; EBT00001685350.
DR   EnsemblGenomes-Tr; EBT00001685351.
DR   EnsemblGenomes-Tr; EBT00001685352.
DR   EnsemblGenomes-Tr; EBT00001685353.
DR   EnsemblGenomes-Tr; EBT00001685354.
DR   EnsemblGenomes-Tr; EBT00001685355.
DR   EnsemblGenomes-Tr; EBT00001685356.
DR   EnsemblGenomes-Tr; EBT00001685357.
DR   EnsemblGenomes-Tr; EBT00001685358.
DR   EnsemblGenomes-Tr; EBT00001685359.
DR   EnsemblGenomes-Tr; EBT00001685360.
DR   EnsemblGenomes-Tr; EBT00001685361.
DR   EnsemblGenomes-Tr; EBT00001685362.
DR   EnsemblGenomes-Tr; EBT00001685363.
DR   EnsemblGenomes-Tr; EBT00001685364.
DR   EnsemblGenomes-Tr; EBT00001685365.
DR   EnsemblGenomes-Tr; EBT00001685366.
DR   EnsemblGenomes-Tr; EBT00001685367.
DR   EnsemblGenomes-Tr; EBT00001685368.
DR   EnsemblGenomes-Tr; EBT00001685369.
DR   EnsemblGenomes-Tr; EBT00001685370.
DR   EnsemblGenomes-Tr; EBT00001685371.
DR   EnsemblGenomes-Tr; EBT00001685372.
DR   EnsemblGenomes-Tr; EBT00001685373.
DR   EnsemblGenomes-Tr; EBT00001685374.
DR   EnsemblGenomes-Tr; EBT00001685375.
DR   EnsemblGenomes-Tr; EBT00001685376.
DR   EnsemblGenomes-Tr; EBT00001685377.
DR   EnsemblGenomes-Tr; EBT00001685378.
DR   EnsemblGenomes-Tr; EBT00001685379.
DR   EnsemblGenomes-Tr; EBT00001685380.
DR   EnsemblGenomes-Tr; EBT00001685381.
DR   EnsemblGenomes-Tr; EBT00001685382.
DR   EnsemblGenomes-Tr; EBT00001685383.
DR   EnsemblGenomes-Tr; SPAB_00316-1.
DR   EnsemblGenomes-Tr; SPAB_00317-1.
DR   EnsemblGenomes-Tr; SPAB_00318-1.
DR   EnsemblGenomes-Tr; SPAB_00319-1.
DR   EnsemblGenomes-Tr; SPAB_00539-1.
DR   EnsemblGenomes-Tr; SPAB_00540-1.
DR   EnsemblGenomes-Tr; SPAB_00541-1.
DR   EnsemblGenomes-Tr; SPAB_00542-1.
DR   EnsemblGenomes-Tr; SPAB_00546-1.
DR   EnsemblGenomes-Tr; SPAB_00547-1.
DR   EnsemblGenomes-Tr; SPAB_00571-1.
DR   EnsemblGenomes-Tr; SPAB_00721-1.
DR   EnsemblGenomes-Tr; SPAB_00770-1.
DR   EnsemblGenomes-Tr; SPAB_01091-1.
DR   EnsemblGenomes-Tr; SPAB_01094-1.
DR   EnsemblGenomes-Tr; SPAB_01108-1.
DR   EnsemblGenomes-Tr; SPAB_01139-1.
DR   EnsemblGenomes-Tr; SPAB_01141-1.
DR   EnsemblGenomes-Tr; SPAB_01212-1.
DR   EnsemblGenomes-Tr; SPAB_01213-1.
DR   EnsemblGenomes-Tr; SPAB_01214-1.
DR   EnsemblGenomes-Tr; SPAB_01480-1.
DR   EnsemblGenomes-Tr; SPAB_01483-1.
DR   EnsemblGenomes-Tr; SPAB_01900-1.
DR   EnsemblGenomes-Tr; SPAB_01901-1.
DR   EnsemblGenomes-Tr; SPAB_02098-1.
DR   EnsemblGenomes-Tr; SPAB_02119-1.
DR   EnsemblGenomes-Tr; SPAB_02403-1.
DR   EnsemblGenomes-Tr; SPAB_02469-1.
DR   EnsemblGenomes-Tr; SPAB_02574-1.
DR   EnsemblGenomes-Tr; SPAB_02770-1.
DR   EnsemblGenomes-Tr; SPAB_02771-1.
DR   EnsemblGenomes-Tr; SPAB_02772-1.
DR   EnsemblGenomes-Tr; SPAB_02773-1.
DR   EnsemblGenomes-Tr; SPAB_02775-1.
DR   EnsemblGenomes-Tr; SPAB_02864-1.
DR   EnsemblGenomes-Tr; SPAB_02866-1.
DR   EnsemblGenomes-Tr; SPAB_02867-1.
DR   EnsemblGenomes-Tr; SPAB_02868-1.
DR   EnsemblGenomes-Tr; SPAB_02870-1.
DR   EnsemblGenomes-Tr; SPAB_02871-1.
DR   EnsemblGenomes-Tr; SPAB_02873-1.
DR   EnsemblGenomes-Tr; SPAB_03008-1.
DR   EnsemblGenomes-Tr; SPAB_03107-1.
DR   EnsemblGenomes-Tr; SPAB_03277-1.
DR   EnsemblGenomes-Tr; SPAB_03348-1.
DR   EnsemblGenomes-Tr; SPAB_03361-1.
DR   EnsemblGenomes-Tr; SPAB_03362-1.
DR   EnsemblGenomes-Tr; SPAB_03363-1.
DR   EnsemblGenomes-Tr; SPAB_03365-1.
DR   EnsemblGenomes-Tr; SPAB_03366-1.
DR   EnsemblGenomes-Tr; SPAB_03367-1.
DR   EnsemblGenomes-Tr; SPAB_03411-1.
DR   EnsemblGenomes-Tr; SPAB_03507-1.
DR   EnsemblGenomes-Tr; SPAB_03508-1.
DR   EnsemblGenomes-Tr; SPAB_03509-1.
DR   EnsemblGenomes-Tr; SPAB_03510-1.
DR   EnsemblGenomes-Tr; SPAB_03511-1.
DR   EnsemblGenomes-Tr; SPAB_03720-1.
DR   EnsemblGenomes-Tr; SPAB_03721-1.
DR   EnsemblGenomes-Tr; SPAB_03783-1.
DR   EnsemblGenomes-Tr; SPAB_03886-1.
DR   EnsemblGenomes-Tr; SPAB_04009-1.
DR   EnsemblGenomes-Tr; SPAB_04052-1.
DR   EnsemblGenomes-Tr; SPAB_04101-1.
DR   EnsemblGenomes-Tr; SPAB_04106-1.
DR   EnsemblGenomes-Tr; SPAB_04233-1.
DR   EnsemblGenomes-Tr; SPAB_04234-1.
DR   EnsemblGenomes-Tr; SPAB_04235-1.
DR   EnsemblGenomes-Tr; SPAB_04236-1.
DR   EnsemblGenomes-Tr; SPAB_04237-1.
DR   EnsemblGenomes-Tr; SPAB_04238-1.
DR   EnsemblGenomes-Tr; SPAB_04517-1.
DR   EnsemblGenomes-Tr; SPAB_04834-1.
DR   EnsemblGenomes-Tr; SPAB_04835-1.
DR   EnsemblGenomes-Tr; SPAB_04836-1.
DR   EnsemblGenomes-Tr; SPAB_04838-1.
DR   EnsemblGenomes-Tr; SPAB_04839-1.
DR   EnsemblGenomes-Tr; SPAB_04840-1.
DR   EnsemblGenomes-Tr; SPAB_04841-1.
DR   EnsemblGenomes-Tr; SPAB_04876-1.
DR   EnsemblGenomes-Tr; SPAB_04877-1.
DR   EnsemblGenomes-Tr; SPAB_04878-1.
DR   EnsemblGenomes-Tr; SPAB_04879-1.
DR   EnsemblGenomes-Tr; SPAB_04945-1.
DR   EnsemblGenomes-Tr; SPAB_04946-1.
DR   EnsemblGenomes-Tr; SPAB_04947-1.
DR   EnsemblGenomes-Tr; SPAB_04949-1.
DR   EnsemblGenomes-Tr; SPAB_04950-1.
DR   EnsemblGenomes-Tr; SPAB_05109-1.
DR   EnsemblGenomes-Tr; SPAB_05118-1.
DR   EnsemblGenomes-Tr; SPAB_05119-1.
DR   EnsemblGenomes-Tr; SPAB_05120-1.
DR   EnsemblGenomes-Tr; SPAB_05122-1.
DR   EnsemblGenomes-Tr; SPAB_05123-1.
DR   EnsemblGenomes-Tr; SPAB_05128-1.
DR   EnsemblGenomes-Tr; SPAB_05129-1.
DR   EnsemblGenomes-Tr; SPAB_05130-1.
DR   EnsemblGenomes-Tr; SPAB_05131-1.
DR   EnsemblGenomes-Tr; SPAB_05170-1.
DR   EnsemblGenomes-Tr; SPAB_05171-1.
DR   EnsemblGenomes-Tr; SPAB_05172-1.
DR   EnsemblGenomes-Tr; SPAB_05173-1.
DR   EnsemblGenomes-Tr; SPAB_05450-1.
DR   EnsemblGenomes-Tr; SPAB_05485-1.
DR   EnsemblGenomes-Tr; SPAB_05486-1.
DR   EnsemblGenomes-Tr; SPAB_05487-1.
DR   EnsemblGenomes-Tr; SPAB_05645-1.
DR   EnsemblGenomes-Tr; SPAB_05729-1.
DR   EnsemblGenomes-Tr; SPAB_05730-1.
DR   EnsemblGenomes-Tr; SPAB_05731-1.
DR   EuropePMC; PMC2658671; 19159446.
DR   EuropePMC; PMC2687191; 19332668.
DR   EuropePMC; PMC3098285; 21625519.
DR   EuropePMC; PMC3133335; 21602358.
DR   EuropePMC; PMC3163573; 21824423.
DR   EuropePMC; PMC3356390; 22623967.
DR   EuropePMC; PMC3411829; 22880062.
DR   EuropePMC; PMC3753948; 23793625.
DR   EuropePMC; PMC4042001; 24885207.
DR   EuropePMC; PMC4616196; 26494672.
DR   EuropePMC; PMC5320704; 28348832.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01384; InvR.
DR   RFAM; RF01387; isrC.
DR   RFAM; RF01388; isrD.
DR   RFAM; RF01389; isrF.
DR   RFAM; RF01390; isrG.
DR   RFAM; RF01391; isrH.
DR   RFAM; RF01392; isrI.
DR   RFAM; RF01393; isrJ.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01395; isrL.
DR   RFAM; RF01397; isrO.
DR   RFAM; RF01398; isrP.
DR   RFAM; RF01399; isrQ.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01402; STnc150.
DR   RFAM; RF01403; STnc290.
DR   RFAM; RF01404; STnc440.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01406; STnc500.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01409; STnc250.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01795; FourU.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02048; STnc30.
DR   RFAM; RF02049; STnc460.
DR   RFAM; RF02050; STnc470.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02054; STnc420.
DR   RFAM; RF02055; STnc380.
DR   RFAM; RF02056; STnc390.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02059; STnc50.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02062; STnc361.
DR   RFAM; RF02063; STnc350.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02065; STnc340.
DR   RFAM; RF02066; STnc320.
DR   RFAM; RF02067; STnc310.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02070; STnc300.
DR   RFAM; RF02071; STnc280.
DR   RFAM; RF02073; STnc260.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02075; STnc230.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02077; STnc220.
DR   RFAM; RF02078; STnc210.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02080; STnc170.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02088; STnc510.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000886.
DR   SILVA-SSU; CP000886.
DR   StrainInfo; 698230; 0.
XX
CC   The bacterium Salmonella Paratyphi B is host-specialized, for it
CC   grows well and causes disease only in humans, whereas most strains
CC   of Salmonella can grow in the gut of almost all animals, both
CC   domesticated and wild. Humans usually acquire Salmonella Paratyphi
CC   B by the ingestion of water or of food that has been contaminated
CC   through fecal contact with humans.  Paratyphi B is quite diverse
CC   and human infection is sometimes not associated with human-to-
CC   human system infection but rather associated with food borne
CC   infection.
CC   The specific strain of S. Paratyphi that was sequenced was isolated
CC   from the stool of a female in Penang Malaysia, and was obtained
CC   from Kwai-Lin Thong. It can be obtained from the Salmonella Genetic
CC   Stock Center as SGSC4150 (www.ucalgary.ca/
CC   kesander). The genome was sequenced to 8X coverage, using plasmid
CC   and fosmid libraries, and was manually finished.  Automated
CC   annotation has been performed and manual annotation will continue
CC   in the labs of Michael McClelland and Kenneth Sanderson.  The
CC   National Institute of Allergy and Infectious Diseases (NIAID),
CC   National Institutes of Health (NIH) has funded this project.
CC   Coding sequences below are predicted using GeneMark v3.3 and
CC   Glimmer2  v2.13.Intergenic regions not spanned by GeneMark and
CC   Glimmer2 were blasted against NCBI's non-redundant (NR) database
CC   and predictions generated based on protein alignments. RNA genes
CC   were determined  using tRNAscan-SE 1.23 or Rfam v8.0. This sequence
CC   was finished as follows unless otherwise noted: all regions were
CC   double stranded, sequenced with an alternate chemistries or covered
CC   by high quality data(i.e., phred quality >=30);an attempt was made
CC   to resolve all sequencing problems, such as compressions and
CC   repeats; all regions were covered by sequence from more than one
CC   m13 subclone.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4858887
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Paratyphi B str. SPB7"
FT                   /strain="SGSC4150; SPB7"
FT                   /mol_type="genomic DNA"
FT                   /serovar="Paratyphi B"
FT                   /db_xref="taxon:1016998"
FT                   /culture_collection="ATCC:BAA-1250"
FT   gene            join(4858339..4858887,1..63)
FT                   /locus_tag="SPAB_05780"
FT   CDS_pept        join(4858339..4858887,1..63)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_05780"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC4445 2.9e-93 lasT; putative tRNA/tRNA
FT                   methyltransferase K02533; COG: COG0565 rRNA methylase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_05780"
FT                   /db_xref="EnsemblGenomes-Tr:ABX71045"
FT                   /inference="protein motif:BlastProDom:IPR001537"
FT                   /inference="protein motif:HMMPfam:IPR001537"
FT                   /inference="protein motif:HMMTigr:IPR004384"
FT                   /inference="similar to AA sequence:REFSEQ:YP_219432.1"
FT                   /protein_id="ABX71045.1"
FT                   /translation="MGFTDLRIVDSQAHLEPATRWVAHGSGDIIDNIEVFQTLADALHD
FT                   VDFTVATTARSRAKFHYYASPAELVPLLQEKSRWMRHAALVFGREDSGLTNDELALADV
FT                   LTGVPMAADYPSLNLGQAVMVYCYQLAGLMQQTTESVDIADESQLQALRARLLRLLTTL
FT                   EAADDHKLTDWLQQRIGLLGQRDTVMLHRLVHDIEKKLTK"
FT   misc_feature    271..398
FT                   /note="threonine operon leader"
FT                   /inference="nucleotide motif:Rfam:RF00506"
FT   gene            424..2886
FT                   /locus_tag="SPAB_00002"
FT   CDS_pept        424..2886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00002"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0002 0. thrA; bifunctional
FT                   aspartokinase I/homeserine dehydrogenase I K00003:K00928;
FT                   COG: COG0527 Aspartokinases; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65446"
FT                   /inference="protein motif:Gene3D:IPR001048"
FT                   /inference="protein motif:HMMPfam:IPR001048"
FT                   /inference="protein motif:HMMPfam:IPR001342"
FT                   /inference="protein motif:HMMPfam:IPR002912"
FT                   /inference="protein motif:HMMPfam:IPR005106"
FT                   /inference="protein motif:HMMPIR:IPR011147"
FT                   /inference="protein motif:HMMTigr:IPR001341"
FT                   /inference="protein motif:ScanRegExp:IPR001341"
FT                   /inference="protein motif:ScanRegExp:IPR001342"
FT                   /inference="protein motif:superfamily:IPR001048"
FT                   /protein_id="ABX65446.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTIGGQDALPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIKHV
FT                   LHGISLLGQCPDSINAALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHYLES
FT                   TVDIAESTRRIAASQIPADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASSDDDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAARVFAAMS
FT                   RAGISVVLITQSSSEYSISFCVPQSDCARARRAMQDEFYLELKEGLLEPLAVTERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQLKRQQTWLKNKHIDLRVCGVANSKALLTNVHGLN
FT                   LDNWQAELAQANAPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVT
FT                   PNKKANTSSMDYYHQLRFAAAQSRRKFLYDTNVGAGLPVIENLQNLLNAGDELQKFSGI
FT                   LSGSLSFIFGKLEEGMSLSQATALAREMGYTEPDPRDDLSGMDVARKLLILARETGREL
FT                   ELSDIVIEPVLPNEFDASGDVTAFMAHLPQLDDAFAARVAKARDEGKVLRYVGNIEEDG
FT                   VCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   gene            2888..3817
FT                   /locus_tag="SPAB_00003"
FT   CDS_pept        2888..3817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00003"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0003 1.6e-165 thrB; homoserine kinase
FT                   K00872; COG: COG0083 Homoserine kinase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65447"
FT                   /db_xref="GOA:A9MXH1"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MXH1"
FT                   /inference="protein motif:HMMPfam:IPR006204"
FT                   /inference="protein motif:HMMPfam:IPR013750"
FT                   /inference="protein motif:HMMPIR:IPR000870"
FT                   /inference="protein motif:HMMTigr:IPR000870"
FT                   /inference="protein motif:ScanRegExp:IPR006203"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX65447.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGTLLGDVVSVEAADHFR
FT                   LHNLGRFADKLPPEPRENIVYQCWERFCQALGKTIPVAMTLEKNMPIGSGLGSSACSVA
FT                   AALVAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENGIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPQLA
FT                   AALMKDVIAEPYRARLLPGFSQARQAVSEIGALASGISGSGPTLFALCDKPETAQRVAD
FT                   WLSKHYLQNQEGFVHICRLDTAGARVVG"
FT   gene            3821..5107
FT                   /locus_tag="SPAB_00004"
FT   CDS_pept        3821..5107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0004 5.4e-227 thrC; threonine synthase
FT                   K01733; COG: COG0498 Threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65448"
FT                   /inference="protein motif:HMMPfam:IPR001926"
FT                   /inference="protein motif:HMMTigr:IPR004450"
FT                   /inference="protein motif:ScanRegExp:IPR000634"
FT                   /inference="similar to AA sequence:REFSEQ:YP_214991.1"
FT                   /protein_id="ABX65448.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHELPEFSLTEIDE
FT                   MLNQDFVSRSAKILSAFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQGARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPR
FT                   FLHDGKWAPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTM
FT                   RELKAKGYISEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEA
FT                   LAERADLPLLSHHLPADFAALRKLMMTRQ"
FT   gene            complement(5201..5974)
FT                   /locus_tag="SPAB_00005"
FT   CDS_pept        complement(5201..5974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00005"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3022 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65449"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MXH3"
FT                   /inference="protein motif:HMMPfam:IPR005583"
FT                   /inference="similar to AA sequence:INSD:AAL18969.1"
FT                   /protein_id="ABX65449.1"
FT                   /translation="MLILISPAKTLDYQSPLATTRYTQPELLDHSQQLIQQARQLSAPQ
FT                   ISRLMGISDKLADLNATRFHDWQPHFTPDNARQAILAFKGDVYTGLQAETFNDADFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENPRGKDLYQFWGDIITDKLNEALEAQG
FT                   DRVVVNLASEEYFKSVKPKKLNAELIKPVFLDEKNGKFKVVSFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTAFDREGYFFDEETSTQDELVFKRYEQ"
FT   gene            complement(5968..6072)
FT                   /locus_tag="SPAB_00006"
FT   CDS_pept        complement(5968..6072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65450"
FT                   /protein_id="ABX65450.1"
FT                   /translation="MRHRAIKPTIATIGQLCGVFLLKSQKIPCKDWIC"
FT   gene            complement(6053..7510)
FT                   /locus_tag="SPAB_00007"
FT   CDS_pept        complement(6053..7510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hpa:HPAG1_0925 7.6e-63 D-alanine glycine
FT                   permease K01613; COG: COG1115 Na+/alanine symporter; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65451"
FT                   /inference="protein motif:HMMPfam:IPR001463"
FT                   /inference="protein motif:HMMTigr:IPR001463"
FT                   /inference="protein motif:ScanRegExp:IPR001463"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454616.1"
FT                   /protein_id="ABX65451.1"
FT                   /translation="MTASTRGTLMPEFFSFINEILWGSVMIYLLLGAGCWFTWRTGFIQ
FT                   FRYIRQFSRSLKGSLSPQPGGLTSFQALCTSLAARIGSGNLAGVALAIAAGGPGAVFWM
FT                   WVSAIIGMATSFAECSLAQLYKERDPTGQFRGGPAWYMARGLGMRWMGVVFALFLLVAY
FT                   GLIFNSVQANAVSRALHFAFNIPPLISGIALAFCALLIIIRGIKGVARLMQWLIPIIAL
FT                   LWVAGSVFICLWHIEQMPGVIASIVKSAFGWQEAAAGAAGYTLTQAITSGFQRGMFSNE
FT                   AGMGSTPNAAAAATSYPLHPVAQGIVQMIGVFSDTIIICTASAMIILLAGNHASHSSTE
FT                   GIQLLQHAMVSLTGEWGASFVALIVILFAFSSIVANYIYAENNLFFLRLHNAKAIWLLR
FT                   LATLGMVIAGTLISFPLIWQLADMIMACMAITNLTAILLLSPVVYTLAGDYLRQRKLGV
FT                   RPQFDPRRFPDIEPQLAPDTWDAASRD"
FT   gene            7752..8705
FT                   /locus_tag="SPAB_00008"
FT   CDS_pept        7752..8705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0007 2.3e-164 talB; transaldolase B
FT                   K00616; COG: COG0176 Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65452"
FT                   /inference="protein motif:Gene3D:IPR013785"
FT                   /inference="protein motif:HMMPanther:IPR001585"
FT                   /inference="protein motif:HMMPfam:IPR001585"
FT                   /inference="protein motif:HMMTigr:IPR004730"
FT                   /inference="protein motif:ScanRegExp:IPR001585"
FT                   /inference="similar to AA sequence:SwissProt:P66955"
FT                   /protein_id="ABX65452.1"
FT                   /translation="MTDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAVAWAKQQSSDRAQQVVDATDKLAVNIGLEILKLVPGRISTEVDARLSYD
FT                   TEASIAKAKRIIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVYLISPFVGRILDWYKANTDKKDYAPAEDPGVVSVTEIYEYYKQHGYETVV
FT                   MGASFRNVGEILELAGCDRLTIAPALLKELAESEGAIERKLSFSGEVKARPERITEAEF
FT                   LWQHHQDPMAVDKLADGIRKFAVDQEKLEKMIGDLL"
FT   gene            8816..9406
FT                   /locus_tag="SPAB_00009"
FT   CDS_pept        8816..9406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hpa:HPAG1_0784 1.7e-42 molybdopterin
FT                   biosynthesis protein; COG: COG0521 Molybdopterin
FT                   biosynthesis enzymes; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65453"
FT                   /inference="protein motif:HMMPfam:IPR001453"
FT                   /inference="protein motif:HMMPIR:IPR012119"
FT                   /inference="protein motif:HMMTigr:IPR001453"
FT                   /inference="protein motif:ScanRegExp:IPR008284"
FT                   /inference="protein motif:superfamily:IPR001453"
FT                   /inference="similar to AA sequence:REFSEQ:YP_214995.1"
FT                   /protein_id="ABX65453.1"
FT                   /translation="MDTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFEVQRR
FT                   LIPDEQEIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMR
FT                   QISLRFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKADDGSVSVPGIFASVP
FT                   YCIQLLDGPYVETAPEVVAAFRPKSARRENMSS"
FT   gene            complement(9463..10029)
FT                   /locus_tag="SPAB_00010"
FT   CDS_pept        complement(9463..10029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY4088 0.0082 dmsC; putative anaerobic
FT                   DMSO reductase chain C anchor subunit K00369; COG: COG1584
FT                   Predicted membrane protein; Psort location:
FT                   CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65454"
FT                   /inference="protein motif:BlastProDom:IPR000791"
FT                   /inference="protein motif:HMMPfam:IPR000791"
FT                   /inference="protein motif:ScanRegExp:IPR000791"
FT                   /inference="similar to AA sequence:INSD:AAL18973.1"
FT                   /protein_id="ABX65454.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNAGFFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLTDAPDAQLLGAYLG
FT                   LWGVFTLFMFFGTLKAARALQFVFLSLTVLFALLAVGNITGNEAIIHIAGWVGLVCGAS
FT                   AIYLAMGEVLNEQFGRTILPIGEAH"
FT   gene            complement(10179..10892)
FT                   /locus_tag="SPAB_00011"
FT   CDS_pept        complement(10179..10892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00011"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4735 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65455"
FT                   /inference="protein motif:HMMPfam:IPR005367"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454620.1"
FT                   /protein_id="ABX65455.1"
FT                   /translation="MNVTYLHDEDLDFLQHCSEEQLADFARLLTHNEKGKARLSSVLSH
FT                   NELFKAMEGHPEQHRRNWQLIAGEFQHYGGDSIANKLRGHGKQYRAILLDVAKRLKLKA
FT                   DKSMSTFEIEQQLLEHFLRHTWQKMDAAHKQEFLQAVDAKVSELEELLPLLMKDRSLAK
FT                   GVSHLLSTQLTRILRTHAAMSILGHGLLRGAGLGGPVGAALNGVKAMSGSAYCVTIPAV
FT                   LQIACLRRMMAAVQA"
FT   gene            complement(10928..11332)
FT                   /locus_tag="SPAB_00012"
FT   CDS_pept        complement(10928..11332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00012"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09752 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65456"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MXI0"
FT                   /inference="similar to AA sequence:REFSEQ:YP_214998.1"
FT                   /protein_id="ABX65456.1"
FT                   /translation="MRSVLTISASLLFGLALSSVAHANDHKILGVIAMPRNETNDLTLK
FT                   TPVCRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMARLKVIGDD"
FT   gene            11387..11512
FT                   /locus_tag="SPAB_00013"
FT   CDS_pept        11387..11512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65457"
FT                   /protein_id="ABX65457.1"
FT                   /translation="MATIQFCNLFFLLQFFCEWYSFFNLFHEYLSVWFSIAPSRH"
FT   gene            11682..13598
FT                   /locus_tag="SPAB_00014"
FT   CDS_pept        11682..13598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0016 0. dnaK; chaperone HSP70; DNA
FT                   biosynthesis; autoregulated heat shock proteins K04043;
FT                   COG: COG0443 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00014"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65458"
FT                   /db_xref="GOA:A9MXI2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MXI2"
FT                   /inference="protein motif:BlastProDom:IPR013126"
FT                   /inference="protein motif:FPrintScan:IPR001023"
FT                   /inference="protein motif:HMMPanther:IPR001023"
FT                   /inference="protein motif:HMMPfam:IPR013126"
FT                   /inference="protein motif:HMMTigr:IPR012725"
FT                   /inference="protein motif:ScanRegExp:IPR013126"
FT                   /protein_id="ABX65458.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTQARVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIIGADNGDAWLD
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDTRLINYLVDEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDINDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTPLITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVR
FT                   DAEANAESDRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALNALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQAGSADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   gene            13684..14823
FT                   /locus_tag="SPAB_00015"
FT   CDS_pept        13684..14823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cme:CMJ043C 6.0e-11 phycocyanobilin lyase
FT                   alpha subunit K02288; COG: COG0484 DnaJ-class molecular
FT                   chaperone with C-terminal Zn finger domain; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65459"
FT                   /db_xref="GOA:A9MXI3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MXI3"
FT                   /inference="protein motif:FPrintScan:IPR003095"
FT                   /inference="protein motif:HMMPfam:IPR001305"
FT                   /inference="protein motif:HMMPfam:IPR001623"
FT                   /inference="protein motif:HMMPfam:IPR002939"
FT                   /inference="protein motif:HMMSmart:IPR001623"
FT                   /inference="protein motif:HMMTigr:IPR012724"
FT                   /inference="protein motif:ScanRegExp:IPR001623"
FT                   /inference="protein motif:superfamily:IPR001623"
FT                   /inference="protein motif:superfamily:IPR008971"
FT                   /inference="similar to AA sequence:INSD:AAB02911.1"
FT                   /protein_id="ABX65459.1"
FT                   /translation="MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEA
FT                   KFKEIKEAYEVLTDAQKRAAYDQYGHAAFEQGGMGGGFGGGFNGGADFSDIFGDVFGDI
FT                   FGGGRGRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQT
FT                   CPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVKIPAG
FT                   VDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGG
FT                   EIEVPTLDGRVMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLSEKQ
FT                   KQLLKDLQESFGGPTGEKNSPRSKSFFDGVKKFFDDLTR"
FT   gene            14935..15048
FT                   /locus_tag="SPAB_00016"
FT   CDS_pept        14935..15048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00016"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65460"
FT                   /protein_id="ABX65460.1"
FT                   /translation="MFLLINKLMLISSFVYAYSLKKRDVMTLMIAFLDAVN"
FT   gene            15104..16051
FT                   /locus_tag="SPAB_00017"
FT   CDS_pept        15104..16051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00017"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0583 Transcriptional regulator; Psort
FT                   location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65461"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="similar to AA sequence:INSD:AAX63920.1"
FT                   /protein_id="ABX65461.1"
FT                   /translation="MGSKGANKSFDYNLIKILDAVILSGNAAMAAKKLGITPAAVSLAL
FT                   KRLQSYYPEELFSRGKGGLIPTAKAVDIHQNFSQVMKLVDDTFLCNSKKDEAFQITLLG
FT                   SDIVESYYLSQLYNSDIFDRILINHFTVRNMSREHISELLFTAQGDLLISAEPLLESGI
FT                   ENQIIDSFKSFVCICSSKHMLSTLSQLSLHHFYSSRHALYQPGMGASVIYHDSELFKDE
FT                   LYYTGRRIVGYRSDSISGLMSMIERTSLIALMPLKLALFYKNHRKYDIKFIQPPPELAL
FT                   KSVQVYASWNKNSRNISTINEMVSMLQTLSSFRR"
FT   gene            16220..16522
FT                   /locus_tag="SPAB_00018"
FT   CDS_pept        16220..16522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00018"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG17566 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65462"
FT                   /inference="similar to AA sequence:INSD:AAV76053.1"
FT                   /protein_id="ABX65462.1"
FT                   /translation="MELEILLTIISIGAWGGFVSYLLRKDKTEYNSSHESIKYCLTQIV
FT                   ISCFTSFLLSAIAIEKECSFNIVLLAAGLGGVFASPILKILGRRIKKIIEGNNSD"
FT   gene            complement(16583..17116)
FT                   /locus_tag="SPAB_00019"
FT   CDS_pept        complement(16583..17116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00019"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3926 Putative secretion activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00019"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65463"
FT                   /inference="protein motif:HMMPfam:IPR008565"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215003.1"
FT                   /protein_id="ABX65463.1"
FT                   /translation="MNPIIDGIIALEGGYVFNPKDKGGATHWGITEATARAHGYAGDMR
FT                   DLTHAEAYAILEEDYWIKPGFDVISTLSWPVSFELCDAAVNIGAYHPSAWLQRWLNVFN
FT                   HEGKRYPDIHVDGNIGPRTLAALEHYLAWRGQEGEAVLVKALNCSQGTYYLNVAEKNHN
FT                   NEQFIYGWIKNRVT"
FT   gene            complement(17133..17576)
FT                   /locus_tag="SPAB_00020"
FT   CDS_pept        complement(17133..17576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00020"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3710 DNA-binding winged-HTH domains"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65464"
FT                   /inference="protein motif:BlastProDom:IPR001867"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="similar to AA sequence:INSD:AAL18981.1"
FT                   /protein_id="ABX65464.1"
FT                   /translation="MKTYIINSNCIYNEGKYELRTVSNSQVIKMTAMRAKCLSFIIENA
FT                   HLEIIERQKITTALWGSRSHYVNDANLTQILYLIRRDLKALGINDLFITIPRQGLKVNS
FT                   DITIIATDSETKGRKKQIVRQTIAALTTVFSVTLGSLMYLHIH"
FT   gene            17755..17877
FT                   /locus_tag="SPAB_00021"
FT   CDS_pept        17755..17877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65465"
FT                   /protein_id="ABX65465.1"
FT                   /translation="MFSPERSKRALRGVVFSSLDGVVNLIFMIFISSKKMMFCD"
FT   gene            17957..20056
FT                   /locus_tag="SPAB_00022"
FT   CDS_pept        17957..20056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF1598 5.1e-46 exochitinase K01183; COG:
FT                   COG3325 Chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65466"
FT                   /inference="protein motif:Gene3D:IPR013781"
FT                   /inference="protein motif:HMMPfam:IPR001223"
FT                   /inference="protein motif:HMMPfam:IPR003610"
FT                   /inference="protein motif:HMMSmart:IPR003610"
FT                   /inference="protein motif:HMMSmart:IPR011583"
FT                   /inference="protein motif:superfamily:IPR003610"
FT                   /protein_id="ABX65466.1"
FT                   /translation="MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYNK
FT                   YKNSTTKPKVFGYYTDWSQYDSRLQGNMSQPGRGYDLTKVSPTAYDKLIFGFVGITGFR
FT                   KIDTEDRDVVAEAAALCGKVKYEPTFLDPWGDFQSYINLGFDVSGWDVDPKTVTQSNAK
FT                   GLLGALRDMQAKAKAAGHTLALSMSIGGWSMSNGFHETAASDSSRKIFAKGVVKLFKQF
FT                   PMFSEVDIDWEYPNNEGAGNPFGPEDGANYALLIAELRKQLDSAGLSNVKISIAASAVT
FT                   TIFDYAKVKDLMAAGLYGINLMTYDFFGTPWAETLGHHTNRKALEEGGWAVETIVDHLL
FT                   AEGFSADRINIGYAGYTRNARQVEIESLSPLKGSYNPSSGPTTGSFESGTSEWYDVIYS
FT                   YLDLENQKGRNGFNVYTDQVADADYLYSPESKLFLSLDTPRTVKAKGEYAAKLGLGGVF
FT                   TWTIDQDNGVLVNAVREGLGYEIESEVIDMEPFYFEGINVEKDEEQSDSDDAQKVNHAP
FT                   KAAIELMVVGGSTVQLSGAGSSDEDNDELSFSWGVPSQIDVADKTAEIIEVVVPEVSEK
FT                   TAFQFTLFVRDCYNEPSSQQRFVLTAVPALSQVQPEPEEEEEIIVPVPDEEEDTTPAED
FT                   DTPADDKTSPYAQWDASTVYGANWGSFEIVSWKGHNYQVKWWSMGDQPDLNCGVGGAWT
FT                   DLGAY"
FT   gene            20148..23144
FT                   /locus_tag="SPAB_00023"
FT   CDS_pept        20148..23144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00023"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG24950 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00023"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65467"
FT                   /protein_id="ABX65467.1"
FT                   /translation="MTISIHASAFDVNSWYQKITLTFINESGNAVDMNHAAISFTASGH
FT                   IDPWGNSGGTLKGNLPLTLNESSYGTLETNNIIINNSDALLLQPGERGTLSFSLAATQV
FT                   PVKMSAITLTLASSSSEDAESATPSDQETPAIPAADEQPAEPDVPEKDNDLQEHGLTLN
FT                   VSELNTASWYQRVTFTLTNLYAQAVDLNQLQLNFTASAHPDPYSPFQGTMLGNQAVTLA
FT                   SDGGWPIEKNTITINHDGALMLAAGDTAELQCYLAATQTPVAISDLNATLAHDPARQGK
FT                   VCVHFPAMTQTVALKPVIELLFPAGETRRFVGEWGEVLTIGDLSAGTYRLTVPVLANDE
FT                   MQIAPVESSFTVTLQSGDAAAQVQVSCLPIVRYASARLMIDAPALGNAKLTVEIADVTQ
FT                   ADERTVTLIANQPQLITRLLAGHHYTVNLQPAMINNRFIAAPIQLTGFIPAAAQVAEVA
FT                   VAYQQSALDTASFVTVDATLLGLPDGVAPQRYLFSSGKYQYSLMLESGSDRQTLALRFA
FT                   PGLYDVQTDDIFINSVPWRCEQAGPLRLLQKVNHVALEFLPGVTLQVKGWPDYLAHGGV
FT                   TVNAPETVSLYRDIPFSALFKYDGFDGGGDPVPAAEVDVNGDGFLDYATLPIHKTVALV
FT                   RQIEKEAGRSVMPVMVIYTANASGGSALADLQDAQKLRNHFGNFITQCLAAQSYKDETH
FT                   PVPATFVLNPDFLGALQQGPYGYTVVRQKNSVPVNAQLAAAIQALPAMAGFIVPSLPTF
FT                   SDDLYGYIQAVNYLVRQFAPDVAFGWQTNVWATGTADWVLRDTADPVAEGQAIAGFIHE
FT                   LGVYSGEYAPDFIAFDKFERDCFSPDALAHYGWNATCWLNYLAMVKQVTKALLTPAMLW
FT                   QIPGGHMPTVEEGVSKISAAHFASGGTFFMGDARIGSDPDTLSLQLLNTALNSATYGVP
FT                   TVGDFLRKDKGYDWGQMQALNLPDFNVFSILWGGGSTISITTIHSNGEDGGWLADKMVE
FT                   YYAAPRYFR"
FT   gene            23181..23330
FT                   /locus_tag="SPAB_00024"
FT   CDS_pept        23181..23330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65468"
FT                   /protein_id="ABX65468.1"
FT                   /translation="MRFEGAFFRISFPAPPDLSFFMRNLLLIFCNHFVLRIVLILKILR
FT                   ISAL"
FT   gene            23425..24129
FT                   /locus_tag="SPAB_00025"
FT   CDS_pept        23425..24129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00025"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG25589 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65469"
FT                   /inference="similar to AA sequence:INSD:AAX63925.1"
FT                   /protein_id="ABX65469.1"
FT                   /translation="MKKMMNDAFAKDNNENSLHSFLFSQQAKPHAAIDALFSALLPFGQ
FT                   PFTLGIGDEFYLQANDEHYIVLLESGVVSFCHDDKRLHISSSFAPSVVGMVDSYGATYN
FT                   VPARPEHFLLAETVCTGRFVRLPDFIKIADECDLWHDVARCLAYRLMVMSARDRELVGV
FT                   DSYLKVRALLTEIWAYPQAYRESIIVLNFIQRRTGISRSRTMKILSELKKGGYIHIDNG
FT                   RLTALGKLPVAY"
FT   gene            complement(24184..24288)
FT                   /locus_tag="SPAB_00026"
FT   CDS_pept        complement(24184..24288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65470"
FT                   /protein_id="ABX65470.1"
FT                   /translation="MFYINFTPVVRPISFSHIDFLKIAFITTFSKTFY"
FT   gene            24406..24516
FT                   /locus_tag="SPAB_00027"
FT   CDS_pept        24406..24516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65471"
FT                   /protein_id="ABX65471.1"
FT                   /translation="MAVLLPLTFISEQEDTFFRIRKSRDIAVKKYQQPFR"
FT   gene            24559..25101
FT                   /locus_tag="SPAB_00028"
FT   CDS_pept        24559..25101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00028"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3539 P pilus assembly protein, pilin FimA;
FT                   Psort location: Extracellular, score:9.72"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65472"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:HMMPfam:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:INSD:AAL18985.1"
FT                   /protein_id="ABX65472.1"
FT                   /translation="MKKPVLALMVSAIAFGGMLSTAQADTTTVTGGTVNFVGQVVDAAC
FT                   SVSADSVDQTVTLGQVRASKLTEAGMVANQKEDFTIKLEDCDTQTSQNAAVIFNGQQDA
FT                   NQPGSLANTAGAGSATNVALQLYGPDGQALNIGESSSTVTLNDGENVIPLSVDYIATGT
FT                   ATAGNVTATATFSMVYS"
FT   gene            25130..25888
FT                   /locus_tag="SPAB_00029"
FT   CDS_pept        25130..25888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00029"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3121 P pilus assembly protein, chaperone
FT                   PapD; Psort location: Periplasmic, score:9.76"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65473"
FT                   /inference="protein motif:BlastProDom:IPR001829"
FT                   /inference="protein motif:FPrintScan:IPR001829"
FT                   /inference="protein motif:Gene3D:IPR001829"
FT                   /inference="protein motif:HMMPfam:IPR001829"
FT                   /inference="protein motif:ScanRegExp:IPR001525"
FT                   /inference="protein motif:superfamily:IPR008962"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215008.1"
FT                   /protein_id="ABX65473.1"
FT                   /translation="MGGEKGALRASLRVTNRRHQDITQMKKNLPIFLRLLLLLSAAGLS
FT                   FAAQAGGIALGATRVIYPQGSKQTSLPIINSSASNVFLIQSWVANADGSRSTDFIITPP
FT                   LFVIQPKKENILRIMYVGPSLPTDRESVFYLNSKAIPSVDKNKLTGNSLQIATQSVIKL
FT                   FIRPKNLAEAPAHAPSTLRCRNERGQLTITNPSPYYVSMVELYSAGKKLPNTMVPPKGA
FT                   ITLPATPGQVSLRTVNDFGATTPARVCPAS"
FT   gene            25893..28514
FT                   /locus_tag="SPAB_00030"
FT   CDS_pept        25893..28514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00030"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3188 P pilus assembly protein, porin PapC;
FT                   Psort location: OuterMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65474"
FT                   /inference="protein motif:HMMPfam:IPR000015"
FT                   /inference="protein motif:ScanRegExp:IPR000015"
FT                   /protein_id="ABX65474.1"
FT                   /translation="MRNQLFMTRYYSSVTKPVLTPLALAIALAPAPGWAENYFNPAFLS
FT                   DDPSAVADLSTFSRNAQAAGMYRVDVYLNNTFLATRDIAFQAVKTTGKSAPTNDSGLRA
FT                   CLTPEMLKNMGVNTGAFPRLAKATAGSCPDLASAILAARTRFDFAQQRLDISIPQAAMV
FT                   ASARGYIPPQYWDEGINALLLNYTFTGANSQDRSPGGSAENSYFLGLNSGLNLGAWRLR
FT                   DYSTWNANSGDQNSDSDWQHISTYLERDVVFLQGELTAGDSYTPSALFDSLPFRGLQLA
FT                   SDDNMLPDSMKGFAPTIHGIARSNAQVTIRQNGYIINQRYVPPGAFTINDLYPTAASGD
FT                   LTVEVKESDGSINRYNVPYSAVPILQREGRLKYAATVAEYRSDSSQKEKVKFSQATLIW
FT                   GLPHGFTLYGGTQLSSHYHALAIGSGANLGDWGAVSLDVTQATSTLADNNTYQGQSLRF
FT                   LYAKSLAQSGTNLQLMGYRYSTSGFYTLDDTTWKRMSGYDDDSRTDSDKSRPEWADYYN
FT                   LYYTRRGKVQLDINQQLGGLGSLFITGSQQSYWHTDEKDSLLQVGYSDTLAGIAWSVSY
FT                   NNNKSAGDAERDQIFALNISVPLSQWLQHDDEVTRHHNVYATFSTSTDKQHNVTQNAGL
FT                   SGTLLDENNLSYNIQQGYQNHGIGESGAASLEYDGAKGNANIGYNVSDNGDYQQVNYGL
FT                   SGGLVAHAHGVTLSQPLGNTNILIAAPGAANVGVVDQPGIHTDARGYAVVPYATTYRQN
FT                   RMALDVNAMADDVDIDDAVTRVVPTEGALVLARFKARVGARALVTLNHNGKPVPFGATV
FT                   TVNDRHAEAIVDEAGEVYLSGLSAQGVLHVRWGNLPDQQCVASYHLSSSRQILSRQHAE
FT                   CH"
FT   gene            28515..29522
FT                   /locus_tag="SPAB_00031"
FT   CDS_pept        28515..29522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00031"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3539 P pilus assembly protein, pilin FimA"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65475"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:HMMPfam:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459029.1"
FT                   /protein_id="ABX65475.1"
FT                   /translation="MKIPLLFALLAGSVVSQYAFADVCKNVNGVPSSINYDLTTTLTAE
FT                   QNQVGKTVQLEKSQEVNVQAVCPAGASTYSQTYRSYVSPYPVVETSGNWKYLKLDPDYL
FT                   EGGMRIEDSSAGDIYPPMNNVLMGYDENVKAGQPFYVRDSNLEFQLKIVKPFVGTVNIS
FT                   PKTMFNVYVMTAAGDPLTDVVYSILYSGTVTVPQSCEINAGQTILINFGALYSGNFNHA
FT                   GQKPEGVRAKKFSVPVKCSGLDSQVNLTMRLIATPDSHVPQAIASDNADVGVVVETDEG
FT                   NALIPNDVQSVAPFITDSAGRANITLQAYPVSTTGETPAEGAFTALASLRVDFD"
FT   gene            29523..30068
FT                   /locus_tag="SPAB_00032"
FT   CDS_pept        29523..30068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00032"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3539 P pilus assembly protein, pilin FimA;
FT                   Psort location: Extracellular, score:9.72"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00032"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65476"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:HMMPfam:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215010.1"
FT                   /protein_id="ABX65476.1"
FT                   /translation="MNRSHCALFAMGLILCPQINASADDLAYNLEFTGTIVAQTCDIDI
FT                   SSLSQSIDLGQFAVGDFPSTGTTTKFKPFNINLKNCSRGIAGAKIWFTGEPDPDNPALL
FT                   AITDTGMGSGNMLASGVGVEILNDDQDTISINNADSVVYPLKAGRNTLSFYIRYKSTRP
FT                   TVTSGNATAVMYFDMQYE"
FT   gene            30084..30602
FT                   /locus_tag="SPAB_00033"
FT   CDS_pept        30084..30602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00033"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3539 P pilus assembly protein, pilin FimA;
FT                   Psort location: Extracellular, score:9.71"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65477"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:HMMPfam:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:INSD:AAF21714.1"
FT                   /protein_id="ABX65477.1"
FT                   /translation="MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENI
FT                   NVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASGVTVSFSGAADSRNTDLLALTAG
FT                   ESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQASAHLQFYARYLADGGAVTPGDANA
FT                   SATFILAYE"
FT   gene            complement(30693..30830)
FT                   /locus_tag="SPAB_00035"
FT   CDS_pept        complement(30693..30830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65479"
FT                   /protein_id="ABX65479.1"
FT                   /translation="MTTKGMIFPSFLVPGQRPPGKICVSINQDASEWLLTGTLNAGAPA
FT                   "
FT   gene            30814..31299
FT                   /locus_tag="SPAB_00034"
FT   CDS_pept        30814..31299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00034"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3121 P pilus assembly protein, chaperone
FT                   PapD; Psort location: Periplasmic, score:9.44"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65478"
FT                   /inference="protein motif:BlastProDom:IPR001829"
FT                   /inference="protein motif:Gene3D:IPR001829"
FT                   /inference="protein motif:HMMPfam:IPR001829"
FT                   /inference="protein motif:ScanRegExp:IPR001829"
FT                   /inference="protein motif:superfamily:IPR008962"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215012.1"
FT                   /protein_id="ABX65478.1"
FT                   /translation="MPFVVTPPLFMLSARQENSMRVVYTGAPLPADRESLFTLSIAAIP
FT                   SGKPEANRVQMAFRSALKLLYRPEGLAGNPQQAYRHLIWSLTPDGATVRNPTPYYVTLF
FT                   LLRANERAQDNAGVVAPFATRQTDWCRHTVRCTVRWQSINDYGRVITAQTVDLTRIH"
FT   gene            31362..32207
FT                   /locus_tag="SPAB_00036"
FT   CDS_pept        31362..32207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA2602 0.00037 dsbA; thiol:disulfide
FT                   interchange protein DsbA K03673; COG: COG1651
FT                   Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65480"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR001853"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215013.1"
FT                   /protein_id="ABX65480.1"
FT                   /translation="MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIV
FT                   SHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIAQQQAYVQLALQYRAELLSSSSPSV
FT                   GPNEAKAAVVMFFDYQCSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGLAAR
FT                   VGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSG
FT                   AVHDALLTNQALAQHMDFSGTPAFVVMPQTQNGDVKRVTVIPGSTTQDMLQMAIQKAKG
FT                   "
FT   gene            32246..32533
FT                   /locus_tag="SPAB_00037"
FT   CDS_pept        32246..32533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00037"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG31826 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65481"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149377.1"
FT                   /protein_id="ABX65481.1"
FT                   /translation="MKSMRCVIPVILLSFIVHEGTAKPTAQIHFMGSVVEAGCWNDVGT
FT                   LEIQCHNKEGVERYIIVENIITPISSPHATVKRDYLDEDKQLTVLRIVYD"
FT   gene            complement(32633..33082)
FT                   /locus_tag="SPAB_00038"
FT   CDS_pept        complement(32633..33082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00038"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3710 DNA-binding winged-HTH domains; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65482"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215015.1"
FT                   /protein_id="ABX65482.1"
FT                   /translation="MRQHKINNEFIYNESLREITSLRSNAAFKMTFMRAWCLSYLIENA
FT                   HQELIIREGVAYAVWGERSQFVSDANLTQLLYLLRRDLQQIGLFELFVTLPRQGIKIDE
FT                   RFIIDAADIPPQAIQYHTHRCNKIISIGIPILFLLMVLFFLAPFI"
FT   gene            33242..33370
FT                   /locus_tag="SPAB_00039"
FT   CDS_pept        33242..33370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65483"
FT                   /protein_id="ABX65483.1"
FT                   /translation="MLLCYCFCVLSISMLILFYQYLMRYAYNVSFKDSQTMFLSGK"
FT   gene            33830..34021
FT                   /locus_tag="SPAB_00040"
FT   CDS_pept        33830..34021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00040"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG14106 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65484"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215016.1"
FT                   /protein_id="ABX65484.1"
FT                   /translation="MYVNQQSSLAMPAPRAPMNQKIDTDNAMVQNHNAIYQQLLDQIRD
FT                   DNTYTHAVITLILMAPRR"
FT   gene            complement(34095..34541)
FT                   /locus_tag="SPAB_00041"
FT   CDS_pept        complement(34095..34541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4527 2.5e-11 hypothetical protein
FT                   K01081:K08077; COG: COG0737 5-nucleotidase/2,3-cyclic
FT                   phosphodiesterase and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65485"
FT                   /inference="protein motif:Gene3D:IPR008334"
FT                   /inference="protein motif:superfamily:IPR008334"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454644.1"
FT                   /protein_id="ABX65485.1"
FT                   /translation="MYPFTNDVMNVEISGKDLKAMMSHAADPKNGMLHVSKTAKFKHYN
FT                   TKPLGQRIVEFDIKGKQVADKTFSTVALTPLSVKAVADLTSLKVKMSKTLKGCKPRRQL
FT                   LIIWNISITSFRITPCVLTTSVNKTTLMRSLPGGGRLILSSRKR"
FT   gene            complement(34544..34663)
FT                   /locus_tag="SPAB_00042"
FT   CDS_pept        complement(34544..34663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00042"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65486"
FT                   /protein_id="ABX65486.1"
FT                   /translation="MQLYRCKQYLKTCQHSHHNNGALHHTIIDMTMITCSAMF"
FT   gene            complement(34728..34862)
FT                   /locus_tag="SPAB_00043"
FT   CDS_pept        complement(34728..34862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00043"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65487"
FT                   /protein_id="ABX65487.1"
FT                   /translation="MSRNVFFIKNNSMFIIKSTLHLFRSYRRFSVVLSFTFWITDSKD"
FT   gene            35160..35762
FT                   /locus_tag="SPAB_00044"
FT   CDS_pept        35160..35762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00044"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG25516 non supervised orthologous group;
FT                   Psort location: OuterMembrane, score:9.49"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00044"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65488"
FT                   /inference="protein motif:HMMPfam:IPR010786"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215018.1"
FT                   /protein_id="ABX65488.1"
FT                   /translation="MWKVTADFGVNFKEAEFYSFIESNVLNHAVAGRNHTVSAMTHVRL
FT                   FDSDYTFFGKIYGQWDNSWGDDLDMFYGAGYLGWSGSWGFFKPYIGLHNQSGDYVSQKY
FT                   GQTSGWNGYVIGWTAAYNFNLFGEDFVLSDWNEIELDRNDAYTEQQFGRNGLNGGLTLA
FT                   WKFYPRWKATVTYRYFANKLGYDGYGDQMIYMVGYSF"
FT   gene            35783..37276
FT                   /locus_tag="SPAB_00045"
FT   CDS_pept        35783..37276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0020 4.2e-243 hypothetical protein
FT                   K01134; COG: COG3119 Arylsulfatase A and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65489"
FT                   /inference="protein motif:HMMPfam:IPR000917"
FT                   /inference="protein motif:ScanRegExp:IPR000917"
FT                   /inference="similar to AA sequence:INSD:AAL18999.1"
FT                   /protein_id="ABX65489.1"
FT                   /translation="MKKTVIASMIGLALCATSTLSVVHAAAEKRPNLVFIVADDLGYGD
FT                   LATYGHQIVKTPNIDRLAKEGVKFTEYYAPAPLCSPSRAGMLTGRMPFRTGVRSWIPEG
FT                   TNVSIGRNELTIANLLKQQGYDTAMMGKLHLNAGGDRTDQPQPKELGFDYSLVNPAGFV
FT                   TDATLDNAKERPRYGVVHPTGWMRNGKHIDRADSISGEFVSSEVVNWLDNKKDDKPFFL
FT                   YVAFTEVHSPLASPKKYLDMYSQYMSEYQKQHPDLFYGDWADKPWRGTGEYYANISYMD
FT                   AQVGKVLDKIKAMGEEDNTIVIFTSDNGPVTREARKVYELNLAGETDGLRGRKDNLWEG
FT                   GIRVPAIIKYGKHIPQGVVTDTPVYGLDWMPTLANMMDFKLPTDRTYDGQSLVPLLEQK
FT                   TLKRNKPLIFGIDMPFQDDPTDEWAIRDGDWKMIIDRENKPKYLYNLKKDRFETLNQIG
FT                   KQPEIEKQLYGKFLKMKQDIDNDSLMKARGDKPTPVTWG"
FT   gene            37380..38576
FT                   /locus_tag="SPAB_00046"
FT   CDS_pept        37380..38576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syg:sync_2368 8.6e-17 arylsulfatase regulator;
FT                   COG: COG0641 Arylsulfatase regulator (Fe-S oxidoreductase)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65490"
FT                   /inference="protein motif:HMMPfam:IPR007197"
FT                   /inference="similar to AA sequence:INSD:AAX63938.1"
FT                   /protein_id="ABX65490.1"
FT                   /translation="MQRKSCQVMIKPTGSVCNLDCKYCFYLEKEMLYPDRKNHYKMTEE
FT                   TLALFVQQHIAAQDVDEVIFAWQGGEPTLMGLPFYRQAVALQQRYANGKAIVNTFQTNG
FT                   ILIDDEWARFFRAHDFLVGISIDGDAALHDEWRVTRAGQPTHHKVEQAIKCLASHGVEF
FT                   NTLTVVSQSNMLHPQRVYAYLKSIGSRYMQFIPLVERAANKDGMLAHPQDEQTAVTPWS
FT                   VDGLQFGKFLNAIFDIWIREDIGDIGIQLFEQTLAAWCGLPPQVCVFAPVCGSAFAMEM
FT                   NGDVYNCDHFVYPQYKLGNINDTPLRQMNNSAQNQQFGLDKSRTMAQECHTCPWQFACY
FT                   GGCPKHRFLPSACGPMKQNYLCAGYQCFFSHTAPMMKAMKTLYVNNLSPAEIRSVFFK"
FT   gene            38594..39847
FT                   /locus_tag="SPAB_00047"
FT   CDS_pept        38594..39847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00047"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG26060 non supervised orthologous group;
FT                   Psort location: OuterMembrane, score:9.49"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65491"
FT                   /inference="protein motif:HMMPfam:IPR003220"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215020.1"
FT                   /protein_id="ABX65491.1"
FT                   /translation="MFANINVDCCKTPGCKNLGVLNSPDYVRQGKDVLCRECGFLFPVI
FT                   SAGALNLFRHTVNRGWKGLVKQCPACGSTSLKKYGFSTQGEHRMACSQCRKTFIVPEKA
FT                   KSDCRQDELATLIEEGTSLAGIRSQLKLDSTGLNRALFKLSRNANLAERCQQFPAFDIA
FT                   LSTRAFRVNYNGGDSSLYVLVTAEEQSGRVVAISSNYSAQPLDKAWQYQSYYEERLPPG
FT                   TLAHMVQRKEAITARRETLFDIDYGPASLYKNDSGMIVKPVLPAYRHFELVRMLTDERS
FT                   LNVQHYLDHECFILGGCMMANMPHVHQGRCHISFVKERGTTPLQKDIPPRLFLSGGIRN
FT                   NVWRTFSTRDYAMAVCNLTGNKKITQQRYATLQGATAFINYLYAHPFLAQLNRLSPANV
FT                   TATLDYLKYEYNQSRKVG"
FT   gene            39966..40372
FT                   /pseudo
FT                   /locus_tag="SPAB_00048"
FT   gene            40535..41701
FT                   /locus_tag="SPAB_00049"
FT   CDS_pept        40535..41701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0022 1.6e-188 nhaA; Na(+)/H(+)
FT                   antiporter 1 K03313; COG: COG3004 Na+/H+ antiporter; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65492"
FT                   /db_xref="GOA:A9MYF8"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYF8"
FT                   /inference="protein motif:HMMPfam:IPR004670"
FT                   /inference="protein motif:HMMTigr:IPR004670"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215021.1"
FT                   /protein_id="ABX65492.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAALAMLMANMGATSGWYHDFLETP
FT                   VQLRVGALEINKNMLLWINDALMAVFFLLIGLEVKRELMQGSLASLRQAAFPVIAAIGG
FT                   MIVPALLYLAFNYSDPVTREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIID
FT                   DLGAIVIIALFYTSDLSIVSLGVAAFAIAVLALLNLCGVRRTGVYILVGAVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTI
FT                   DGLTSMLPLGIIAGLLIGKPLGISLFCWLALRFKLAHLPQGTTYQQIMAVGILCGIGFT
FT                   MSIFIASLAFGNVDPELINWAKLGILIGSLLSAVVGYSWLRARLNAPA"
FT   gene            41769..42662
FT                   /locus_tag="SPAB_00050"
FT   CDS_pept        41769..42662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00050"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0583 Transcriptional regulator; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65493"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:ScanRegExp:IPR001356"
FT                   /inference="similar to AA sequence:INSD:AAX63941.1"
FT                   /protein_id="ABX65493.1"
FT                   /translation="MSHINYNHLYYFWHVYKEGSVVGAAEALFLTPQTITGQIKALEER
FT                   LQGKLFKRKGRGLEPSELGELVFRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADALS
FT                   KRLVSSVLDAAVVVDEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLFSV
FT                   KIGECSVSFWCTNPLPEKAFPACLEERRLLVPGRRSMLGRKLLNWFNSQGLQVEILGEF
FT                   DDAALMKAFGATHDAIFVAPSLYSLDFYADESVIEIGRVENVMEEYHAIFAERMIQHPA
FT                   VQRICNADYSALFKLQ"
FT   gene            complement(42717..44756)
FT                   /locus_tag="SPAB_00051"
FT   CDS_pept        complement(42717..44756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sso:SSO3022 2.6e-94 xylS; alpha-xylosidase
FT                   K01238; COG: COG1501 Alpha-glucosidases, family 31 of
FT                   glycosyl hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65494"
FT                   /inference="protein motif:HMMPfam:IPR000322"
FT                   /protein_id="ABX65494.1"
FT                   /translation="MPFMQQDPRRLVWQQNDRYLWIEPWGENSLRVRSGRHLPVMRNED
FT                   WALTEPVAESQCHIDYEHHQATLTNGKIIAIVNQKGQVTFYRHPHKPLLQEFWRLRGEI
FT                   GEDESSHGQYVSALNLEGREFRPIQGGKYSLKARFEATEGEKIYGMGQYQQANLDLKGC
FT                   VLELAQRNSQASVPFMLSSLGYGFLWNNPAVGRVTFAQNVTEWEAQVSEQLDYWITAGD
FT                   TPAEISRAYALATGTPPMMPDYAMGFWQCKLRYRTQEELLEVAREYKRRNLPISVIVID
FT                   FFHWPNQGDWMFDARDWPDPDAMIAELKSLGIELMVSVWPTVDNRTESYREMRENGWLV
FT                   QTERGLPINMDFLGNTTYFDATHPGARDYVWGKAKRNYYDKGVKLFWLDEAEPEFSVYD
FT                   YDNYRYHAGPVLEVGNIYPRMYAKTFFDGMKADGEDQVINLLRCAWAGSQKFGALVWSG
FT                   DIHSSFRSLRNQFAAGLNMGIAGIPWWTTDIGGFHGGNIHDPKFHELLIRWFQWGVFSP
FT                   VMRLHGNRDPQILPAQPYRDGIAQCPTGAPNEVWSYGEEVCDVLTGCLALREKLKPYIK
FT                   ALMEETHKHNTPVMRPLFFEFPEQETSWAITDQYCFGPDLLIAPVMHEGMRERDVWLPE
FT                   GETWTDLATGESYSGGQTLQYATPLNRIPVFIREGGQYRSLLNL"
FT   gene            complement(44796..46211)
FT                   /locus_tag="SPAB_00052"
FT   CDS_pept        complement(44796..46211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4210 6.4e-50 yicJ; hypothetical
FT                   symporter YicJ K03292; COG: COG2211 Na+/melibiose symporter
FT                   and related transporters; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65495"
FT                   /inference="protein motif:HMMTigr:IPR001927"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459047.1"
FT                   /protein_id="ABX65495.1"
FT                   /translation="MFFWAYRTNIGVIIMSSVIEDTQPSGSASLSLLQRISYGSLDVAG
FT                   NLLYCFGSTYILYFYTDVAGISLAVAGVILLLARIIDGIDAPIWGIIIDKTRSRYGKCR
FT                   PWFLWLPLPFAVFSALSFWSPDISMTGKTIYAAISYMIASILFTGLNTPLSAILPLMTL
FT                   SPKERLVLNSWRMTGGQIGVLLMNATALPLVAFLGNGDDHAGFIYTAITFAIISCALTL
FT                   FAFKNIREMDADKIQHEPKLPMKKSFAAMKGNWPWILMVLANLIFWIALQQRNTTIVYY
FT                   LTYNLDRKDLVPLINSLATIQILFIIAIPFFSKYLAKTWIWVGGLLVATFGGVMMWLAA
FT                   DNITFLIAAWILGNIGSGIACSMPFAMLGFAVDFGAWKTGIKATGILIAFGSTFCIKMG
FT                   SGLGTAFAAWIMNSFGYVPNHAQSAAGLEGIIWAFIWAPALLFALAAIPLLFFRKYEAM
FT                   EEKIRHDLETVNS"
FT   gene            complement(46625..46810)
FT                   /locus_tag="SPAB_00053"
FT   CDS_pept        complement(46625..46810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00053"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0268 Ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65496"
FT                   /inference="protein motif:BlastProDom:IPR002583"
FT                   /inference="protein motif:Gene3D:IPR002583"
FT                   /inference="protein motif:HMMPfam:IPR002583"
FT                   /inference="protein motif:HMMTigr:IPR002583"
FT                   /inference="protein motif:superfamily:IPR002583"
FT                   /inference="similar to AA sequence:INSD:AAV76079.1"
FT                   /protein_id="ABX65496.1"
FT                   /translation="MMRTFIKKVYAAIEAGDKAAALKAFNEMQPIVDRQAAKGLIHKNK
FT                   AARHKANLTAQINKLA"
FT   gene            47063..47209
FT                   /locus_tag="SPAB_00054"
FT   CDS_pept        47063..47209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00054"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13907 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65497"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454655.1"
FT                   /protein_id="ABX65497.1"
FT                   /translation="MRKIALSGGFWGGVCRMAMKSIFFMFHQGNSRLTLTAVQGILLRF
FT                   SLF"
FT   gene            47268..48155
FT                   /locus_tag="SPAB_00055"
FT   CDS_pept        47268..48155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0045 1.0e-152 ribF; hypothetical
FT                   protein K00861:K00953; COG: COG0196 FAD synthase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65498"
FT                   /inference="protein motif:BlastProDom:IPR002606"
FT                   /inference="protein motif:HMMPfam:IPR002606"
FT                   /inference="protein motif:HMMTigr:IPR002606"
FT                   /inference="similar to AA sequence:INSD:AAO67780.1"
FT                   /protein_id="ABX65498.1"
FT                   /translation="MLTIGNFDGVHRGHRALLQGLQEEGRRRGLPVVVMIFEPQPLELF
FT                   ATDKAPARLTRLREKLHYLAQCGVDYVLCVKFDRRFAALTAQTFISELLVERLGVQFLA
FT                   VGDDFRFGASRAGDFLLLQKAGAEYGFAVSSTQTFCEGGVRISSTAVRQALAEDNLALA
FT                   ESLLGHPFTISGRVVHGDELGRTIGFPTANLPLRRQVSPVKGVYAVEVTGLGDKPLPGV
FT                   ANIGTRPTVAGVRQQLEVHLLDVVMDLYGRHIDVILRKKIRNEQRFASLDELKAQIARD
FT                   ELTARKFFGLAGQV"
FT   gene            48164..51034
FT                   /locus_tag="SPAB_00056"
FT   CDS_pept        48164..51034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0040 0. ileS; isoleucine tRNA synthetase
FT                   K01870; COG: COG0060 Isoleucyl-tRNA synthetase; Psort
FT                   location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65499"
FT                   /inference="protein motif:HMMPfam:IPR002300"
FT                   /inference="protein motif:HMMPfam:IPR010663"
FT                   /inference="protein motif:HMMPfam:IPR013155"
FT                   /inference="protein motif:HMMTigr:IPR002301"
FT                   /inference="protein motif:ScanRegExp:IPR001412"
FT                   /inference="protein motif:superfamily:IPR009008"
FT                   /inference="protein motif:superfamily:IPR009080"
FT                   /protein_id="ABX65499.1"
FT                   /translation="MFIKPKYGTENLMSDYKSTLNLPETGFPMRGDLAKREPGMLARWT
FT                   DDDLYGIIRAAKKGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGFDSPYV
FT                   PGWDCHGLPIELKVEQEFGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWS
FT                   HPYLTMDFKTEANIIRALGRIIKNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSI
FT                   DVAFRAVDQDAVKAKFGLPGVSGPVSLVIWTTTPWTLPANRAISLAPDFDYALVQIDGQ
FT                   AVILAKDLVESVMQRIGAADYTILGTVKGAELELLRFTHPFMGFDVPAILGDHVTLDAG
FT                   TGAVHTAPGHGPDDYVIGQKYGLETANPVGPDGAYLPGTYPTLDGVNVFKANDIVIELL
FT                   KEKGALLHVEKMQHSYPCCWRHKTPIIFRATPQWFVSMDKEGLRQQSLKEIKGVQWIPD
FT                   WGQARIESMVANRPDWCISRQRTWGVPMSLFVHKETQELLPIERTLAAMEEVAKRVEVD
FT                   GIQAWWDLDPKEILGEDADQYEKVPDTLDVWFDSGSTSYSVVDARPEFAGHAADMYLEG
FT                   SDQHRGWFMSSLMISVAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLG
FT                   ADILRLWVASTDYTGEMAVSDEILKRAADSYRRIRNTARFLLANLNGFNPATDMVKPEE
FT                   MVVLDRWAVGCAKTAQQEILKAYEAYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTAK
FT                   ADSVARRSCQTALYHIAEALVRWMAPIMSFTADEIWGYLPGEREKYVFTGEWYDGLFGL
FT                   EENEEFNDAFWDDVRYIKDQVNKELENQKANGIKSNLEAKVTLKYADDANGTIKKLKLL
FT                   GEEVRFIFITSQFVISEQAGGIDDENIQYNAGNTTVQAVVTRAEGDKCPRCWHYTTDVG
FT                   KVAEHADICGRCVSNIAGNGEQRKFA"
FT   gene            51088..51534
FT                   /locus_tag="SPAB_00057"
FT   CDS_pept        51088..51534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0048 1.0e-76 lspA; lipoprotein signal
FT                   peptidase K03101; COG: COG0597 Lipoprotein signal
FT                   peptidase; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65500"
FT                   /inference="protein motif:BlastProDom:IPR001872"
FT                   /inference="protein motif:FPrintScan:IPR001872"
FT                   /inference="protein motif:HMMPfam:IPR001872"
FT                   /inference="protein motif:HMMTigr:IPR001872"
FT                   /inference="protein motif:ScanRegExp:IPR001872"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149395.1"
FT                   /protein_id="ABX65500.1"
FT                   /translation="MLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSFLAD
FT                   SGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVV
FT                   DMIDFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA"
FT   gene            51689..52138
FT                   /locus_tag="SPAB_00058"
FT   CDS_pept        51689..52138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0042 2.1e-74 slpA; FKBP-type
FT                   peptidyl-prolyl cis-trans isomerase (rotamase) K03774; COG:
FT                   COG1047 FKBP-type peptidyl-prolyl cis-trans isomerases 2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65501"
FT                   /inference="protein motif:HMMPfam:IPR001179"
FT                   /inference="similar to AA sequence:INSD:AAL19012.1"
FT                   /protein_id="ABX65501.1"
FT                   /translation="MSKSVQSNSAILVHFTLKLDDGSTAESTRNNGKPALFRLGDTSLS
FT                   EGLEQQLLGLKEGEKKVFSLEPDAAFGVPSPDLIQYFSRREFMAAGEPEVGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGHTVHFDIEVLEIDPALEA"
FT   gene            52141..53091
FT                   /locus_tag="SPAB_00059"
FT   CDS_pept        52141..53091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0049 1.3e-163 lytB; regulates the
FT                   activity of guanosine 3',5'-bispyrophosphate synthetase I
FT                   (RelA) K03527; COG: COG0761 Penicillin tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65502"
FT                   /db_xref="GOA:A9MYG8"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYG8"
FT                   /inference="protein motif:HMMPfam:IPR003451"
FT                   /inference="protein motif:HMMTigr:IPR003451"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459054.1"
FT                   /protein_id="ABX65502.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRKRGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGS
FT                   KNSSNSNRLAELAQRMGRTAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIAR
FT                   LREFGGGEAVTLEGREENIVFEVPKELRVDVREVE"
FT   gene            complement(53203..53361)
FT                   /locus_tag="SPAB_00060"
FT   CDS_pept        complement(53203..53361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65503"
FT                   /protein_id="ABX65503.1"
FT                   /translation="MALVASIQKPMASNVGNPYFILPISLIPVGITTKKPATIVLIFQM
FT                   NSKKVGH"
FT   gene            53534..54493
FT                   /locus_tag="SPAB_00061"
FT   CDS_pept        53534..54493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00061"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG26437 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65504"
FT                   /inference="similar to AA sequence:INSD:AAL19014.1"
FT                   /protein_id="ABX65504.1"
FT                   /translation="MHLEERVKALSGYWNAEISSSEIKGEWTSADKKRHFPVALIYYKP
FT                   KNSPDIVLVTNTNDAGGYDPSKEIDCGNTPAISAIKLYRDGKLIQTLDTASVGTCSPFM
FT                   PQWGDVNFDGYPDLSIVTELLVGPDAPVQTWLYDPAKQRYVDAPASYQEITSPEIDAEH
FT                   KQIVSYWRGGCCSHGVNVYRWKGKTIELIDRGESYFQPVISKGKMYNCYMTPSYADGRI
FT                   IYPLVRKNGHLTPPLSLDGTCQSFWLTGNVRTVIQAEKPGAEPESLEIQWQENKASPGR
FT                   FCPLVPFVEGDKLSPRLVTDDDVPDACISRAEYEDIKQ"
FT   gene            54509..55429
FT                   /locus_tag="SPAB_00062"
FT   CDS_pept        54509..55429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0051 1.3e-161 rihC; putative purine
FT                   nucleoside hydrolase K01239; COG: COG1957 Inosine-uridine
FT                   nucleoside N-ribohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00062"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65505"
FT                   /db_xref="GOA:A9MYH1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYH1"
FT                   /inference="protein motif:BlastProDom:IPR001910"
FT                   /inference="protein motif:Gene3D:IPR001910"
FT                   /inference="protein motif:HMMPfam:IPR001910"
FT                   /inference="protein motif:superfamily:IPR001910"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459056.1"
FT                   /protein_id="ABX65505.1"
FT                   /translation="MTASLHIILDTDPGIDDAAAIAAALFAPQLDLQLITTVAGNVSVE
FT                   KTTRNALQLLHFWNSDIPLAQGAATPLLRPLRDAAYVHGESGMEGYDFVDHQRQPLAKP
FT                   AFIAIRDVLMNAPEPMTLVAIGPLTNIALLLMHYPECACNIHRLVLMGGSAGRGNFTPN
FT                   AEFNIAVDPEAAALVFRSGLEIVMCGLDVTNQAMLSPDFLNKLPALNRTGKMLHSLFNH
FT                   YRSGSMRTGVRMHDLCAIAWLVRPELFTLQSCFVAVETQGQYTAGTTVVDIEGRLGQPA
FT                   NAQVALALDVDGFRQWVAEVFAYAP"
FT   gene            complement(55451..56137)
FT                   /locus_tag="SPAB_00063"
FT   CDS_pept        complement(55451..56137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK0490 2.4e-20 response regulator
FT                   K02475; COG: COG4565 Response regulator of citrate/malate
FT                   metabolism; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00063"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65506"
FT                   /inference="protein motif:BlastProDom:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR001789"
FT                   /inference="protein motif:HMMPIR:IPR008247"
FT                   /inference="protein motif:HMMSmart:IPR001789"
FT                   /inference="protein motif:superfamily:IPR011006"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459057.1"
FT                   /protein_id="ABX65506.1"
FT                   /translation="MDSITTLIVEDEPMLAEILVDTIKIFPQFSIVGIADKLESAKKQI
FT                   RLYQPQLILLDNFLPDGKGIDLIRHTISTNYTGRIIFITADNHMDTISDALRMGVFDYL
FT                   IKPVHYQRLQHTLERFTRYRSSLRSSEQANQTHVDALFNIQAKEQTAEPNSGLRGIDEN
FT                   TFNRVRQIFADPQAVHTADTLAQILGSSKTTARRYLEQGVKNNFLEAEISYGKVGRPER
FT                   LYRGKV"
FT   gene            complement(56139..57797)
FT                   /locus_tag="SPAB_00064"
FT   CDS_pept        complement(56139..57797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0047 3.2e-293 citA; putative
FT                   transcription regulator, histidine kinase for citrate; COG:
FT                   COG3290 Signal transduction histidine kinase regulating
FT                   citrate/malate metabolism; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65507"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR000014"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215034.1"
FT                   /protein_id="ABX65507.1"
FT                   /translation="MQENTVIKYLNTNMFIREITRWFARRSFQNRIFLLILFTSTIVML
FT                   AITWYLTDITKERLHYQVGQRALIQAMQISAMPELVEAVEAHDLSRIKALIDPMRSFSD
FT                   ATYITVGNEKGQRLYHVNPDEIGKYMEGGDSDDALYNAKSYVSVRKGSLGSSLRGKSPI
FT                   QDSTGKVIGIVSVGYTLEQLESWLNLQISSLLFPMALLLLVLLYCARRFSLHIKKQMLN
FT                   MEPQQLSQLLIQQSVLFESVFEGLIAIDSHHRITAINQTARRLLNLSQPESELIGYAIH
FT                   HVVLPEAFFYDAPQKNKKDEIVTFNQMKVIASRMAVIIDNQPQGWVISFRNKDDINTLS
FT                   LQLSQVRQYADNLRAVQHEHRNLISTIAGLLFLKRYDNALALIQQQSESHQKVLDFISH
FT                   NFRDHHLAGLLIGKYYRAKELGLELIFDPSSFVEHLPSSLSHNEWISIVGNLLDNAYNA
FT                   TLLNREGSRQIECLINSEGNEVIIEVADQGCGIDENIRQHIFERGVTTHNNGDHGIGLW
FT                   LVHSYVKQANGDIIVDNNNPFGTIFTLYIPFTREE"
FT   gene            complement(57893..59194)
FT                   /locus_tag="SPAB_00065"
FT   CDS_pept        complement(57893..59194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0048 4.8e-219 oadB; putative oxalacetate
FT                   decarboxylase, subunit beta K01572; COG: COG1883
FT                   Na+-transporting methylmalonyl-CoA/oxaloacetate
FT                   decarboxylase, beta subunit; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65508"
FT                   /inference="protein motif:HMMPfam:IPR005661"
FT                   /inference="protein motif:HMMPIR:IPR005661"
FT                   /inference="protein motif:HMMTigr:IPR005661"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215753.1"
FT                   /protein_id="ABX65508.1"
FT                   /translation="MESLNALLQGMGLMHLGAGQAIMLLVSLLLLWLAIAKKFEPLLLL
FT                   PIGFGGLLSNIPEAGMALTALESLLAHHDAGQLAVIAAKLNCAPDVHAIKEALALALPS
FT                   VQGQMENLAVDMGYTPGVLALFYKVAIGSGVAPLVIFMGVGAMTDFGPLLANPRTLLLG
FT                   AAAQFGIFATVLGALTLNYFGIISFTLPQAAAIGIIGGADGPTAIYLSGKLAPELLGAI
FT                   AVAAYSYMALVPLIQPPIMRALTTETERKIRMVQLRTVSKREKILFPVVLLLLVALLLP
FT                   DAAPLLGMFCFGNLMRESGVVERLSDTVQNGLINIVTIFLGLSVGAKLVADKFLQPQTL
FT                   GILLLGVVAFGIGTAAGVLMAKLLNLCSKNKINPLIGSAGVSAVPMAARVSNKVGLESD
FT                   PQNFLLMHAMGPNVAGVIGSAIAAGVMLKYVLAM"
FT   gene            complement(59207..60979)
FT                   /locus_tag="SPAB_00066"
FT   CDS_pept        complement(59207..60979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0765 7.5e-301 oadA; putative sodium ion
FT                   pump oxaloacetate decarboxylase alpha chain K01571; COG:
FT                   COG5016 Pyruvate/oxaloacetate carboxyltransferase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00066"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65509"
FT                   /inference="protein motif:HMMPfam:IPR000089"
FT                   /inference="protein motif:HMMPfam:IPR000891"
FT                   /inference="protein motif:HMMPfam:IPR003379"
FT                   /inference="protein motif:HMMTigr:IPR005776"
FT                   /inference="protein motif:ScanRegExp:IPR001882"
FT                   /inference="protein motif:superfamily:IPR011053"
FT                   /inference="similar to AA sequence:INSD:AAX67196.1"
FT                   /protein_id="ABX65509.1"
FT                   /translation="MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAALDEVGYGSLECW
FT                   GGATFDACIRFLGEDPWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERA
FT                   VKNGMDVFRVFDAMNDPRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLL
FT                   ETGVDSIAIKDMSGILTPMAAYELVSEIKKRYDVRLHLHAHATTGMAEMALLKAIEAGV
FT                   DGVDTAISSMSATYGHPATEALVATLAGTKYDTGLDILKLENIAAYFREVRKKYHAFEG
FT                   QLKGYDSRILVAQVPGGMLTNLESQLKQQNAADKLDQVLAEIPRVRKDLGFIPLVTPTS
FT                   QIVGTQAVLNVLTGERYKTIAKETAGILKGEYGHTPVPVNAALQARVLDGGAPVTCRPA
FT                   DLLKPELAELEADVRRQAQEKGITLAGNAIDDVLTVALFPQIGLKFLENRHNPAAFEPV
FT                   PQAEAAQPVAKAEKPAASGVYTVEVEGKAFVVKVSDGGDISQLTAASSAPVQAASPVAP
FT                   AGAGTPVTAPLAGNIWKVIATEGQTVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKS
FT                   GDAVSVGDTLMTLA"
FT   gene            complement(60995..61234)
FT                   /locus_tag="SPAB_00067"
FT   CDS_pept        complement(60995..61234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0057 2.7e-35 oadG; oxaloacetate
FT                   decarboxylase gamma chain K01573; COG: COG3630
FT                   Na+-transporting methylmalonyl-CoA/oxaloacetate
FT                   decarboxylase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65510"
FT                   /db_xref="GOA:A9MYH6"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYH6"
FT                   /inference="protein motif:HMMPfam:IPR005899"
FT                   /inference="protein motif:HMMTigr:IPR005899"
FT                   /inference="similar to AA sequence:SwissProt:Q5PKI8"
FT                   /protein_id="ABX65510.1"
FT                   /translation="MNEAVLLGEGFTLMFLGMGFVLAFLFLLIFAIRGMSVAITRLFPE
FT                   PVAAPAPRAVPVVDDFTRLKPVIAAAIHHHRLNA"
FT   gene            complement(61393..62733)
FT                   /locus_tag="SPAB_00068"
FT   CDS_pept        complement(61393..62733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00068"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3493 Na+/citrate symporter; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65511"
FT                   /inference="protein motif:BlastProDom:IPR004679"
FT                   /inference="protein motif:HMMPfam:IPR004679"
FT                   /inference="protein motif:HMMTigr:IPR004679"
FT                   /inference="similar to AA sequence:INSD:CAD01212.1"
FT                   /protein_id="ABX65511.1"
FT                   /translation="MTNMTQASATEKKGASDLLRFKIFGMPLPLYAFALITLLLSHFYN
FT                   AIPTDLVGGFALMFVMGAIFGEIGKRLPIFNKYIGGAPVMIFLVAAYFVYAGIFTQKEI
FT                   DAISNVMDKSNFLNLFIAVLITGAILSVNRKLLLKSLLGYIPTILAGIVGASLFGIVIG
FT                   LCFGIPVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRSREEYYSTAIAILTIANIF
FT                   AIIFAALLDMIGKKYTWLSGEGELVRKASFKTEDDEKAGQITHRETAVGMVLSTTCFLL
FT                   AYVVAKKILPSIGGVSIHYFAWMVLIVAALNASGLCSPEIKAGAKRLSDFFSKQLLWVL
FT                   MVGVGVCYTDLQEIIDALTFANVVIAAIIVVGAVVGAAIGGWLIGFYPIESSITAGLCM
FT                   ANRGGSGDLEVLSACNRMNLISYAQISSRLGGGIVLVIASIVFSMMV"
FT   gene            complement(62854..63012)
FT                   /locus_tag="SPAB_00070"
FT   CDS_pept        complement(62854..63012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65513"
FT                   /protein_id="ABX65513.1"
FT                   /translation="MRLNIRFTLFCIRQQITSHISPAFVLLVWNRHHTFPLAFISFMVF
FT                   ISLINQS"
FT   gene            62990..64021
FT                   /locus_tag="SPAB_00069"
FT   CDS_pept        62990..64021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0058 1.4e-182 citC2; putative citrate
FT                   lyase synthetase K01910; COG: COG3053 Citrate lyase
FT                   synthetase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65512"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="protein motif:HMMPfam:IPR013166"
FT                   /inference="protein motif:HMMPIR:IPR005216"
FT                   /inference="protein motif:HMMSmart:IPR013166"
FT                   /inference="protein motif:HMMTigr:IPR004821"
FT                   /inference="protein motif:HMMTigr:IPR005216"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459063.1"
FT                   /protein_id="ABX65512.1"
FT                   /translation="MNLIFKRIYLQKDVLRRESVAMFLEGVGLALEDDCEIAVCAYWQG
FT                   EIVGCGSLAGNVLKCIAVSPVLQGEGLSLKLLTELLTLAYELNRSELFLFTKPQNRLLF
FT                   SGAGFWPIAQAGELAVLMENSSERLARFCRQLALYRQPGKTIGAIVMNANPFTLGHRYL
FT                   VEQAAAACDWLHLFVVKEDASFFSYTDRWALIEQGIGGIDNVTLHSGSAYMISRATFPG
FT                   YFLKEKGVVDDCHCQIDLQLFREHLAPALGITHRFVGSEPFCPLTCAYNQRMHDILHDP
FT                   KRSGPVIEVVELARVEKNGAAISASRVRKLYSERNWSAISALVPAGTLAYLQRHAARHT
FT                   ETI"
FT   gene            64051..64344
FT                   /locus_tag="SPAB_00071"
FT   CDS_pept        64051..64344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0060 9.0e-44 citD; citrate lyase acyl
FT                   carrier protein K01646; COG: COG3052 Citrate lyase, gamma
FT                   subunit; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65514"
FT                   /inference="protein motif:BlastProDom:IPR006495"
FT                   /inference="protein motif:HMMPfam:IPR006495"
FT                   /inference="protein motif:HMMPIR:IPR006495"
FT                   /inference="protein motif:HMMTigr:IPR006495"
FT                   /inference="similar to AA sequence:INSD:AAO67794.1"
FT                   /protein_id="ABX65514.1"
FT                   /translation="MKIIKDALAGTLESSDVMIRIGPSSEPGIRLELESLVKQQFGAAI
FT                   EQVVRETLAKLGVERALVSVDDKGALECILRARVQAAALRAAEQTEIQWSAL"
FT   gene            64341..65210
FT                   /locus_tag="SPAB_00072"
FT   CDS_pept        64341..65210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0060 3.8e-148 citE2; putative citrate
FT                   lyase beta chain (acyl lyase subunit) K01644; COG: COG2301
FT                   Citrate lyase beta subunit; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65515"
FT                   /inference="protein motif:HMMPfam:IPR005000"
FT                   /inference="protein motif:HMMPIR:IPR011206"
FT                   /inference="protein motif:HMMTigr:IPR006475"
FT                   /inference="protein motif:superfamily:IPR011076"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459065.1"
FT                   /protein_id="ABX65515.1"
FT                   /translation="MRPRRSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVALREKDTA
FT                   RLLVHHALQHPFYQDVEKVVRINPLNTPFGLADLEAVVRGGADIVRLPKTDSKNDVLEL
FT                   EAQVERIERECGREVGSTRLMAAIESAKGVVNAVDIATSSPRMVAIALAAFDYVMDMGT
FT                   SRGDGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLKEVQLAKGLGFNGKSLVN
FT                   PRQIELLHQAYSPTRKEVEHAYEVIAAAEEAESRGLGVVSLNGKMIDGPIIDHARKVVA
FT                   LSASGIRD"
FT   gene            65221..66741
FT                   /locus_tag="SPAB_00073"
FT   CDS_pept        65221..66741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0061 1.2e-268 citF2; putativ
FT                   bifunctional citrate lyase alpha chain/citrate-ACP
FT                   transferase K01643; COG: COG3051 Citrate lyase, alpha
FT                   subunit; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65516"
FT                   /inference="protein motif:HMMPfam:IPR006472"
FT                   /inference="protein motif:HMMPIR:IPR006472"
FT                   /inference="protein motif:HMMTigr:IPR006472"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459066.1"
FT                   /protein_id="ABX65516.1"
FT                   /translation="MKETVTMLNQQYVVPEGLQPYQGVTANSPWLASETEKRRRKICDS
FT                   LEEAIRRSGLKNGMTISFHHAFRGGDKVVNMVMAKLAEMGFRDLTLASSSLIDAHWPLI
FT                   EHIKNGVVRQIYTSGLRGKLGEEISAGLMENPVQIHSHGGRVKLIQSGELNIDVAFLGV
FT                   PCCDEFGNANGFSGKSRCGSLGYAQVDAQYAKCVVLLTEEWVEFPNYPASIAQDQVDLI
FT                   VQVDEVGDPEKITAGAIRLSSNPRELLIARQAANVIEHSGYFCDGFSLQTGTGGASLAV
FT                   TRFLEDKMRRHNITASFGLGGITGTMVDLHEKGLIKALLDTQSFDGDAARSLAQNPHHI
FT                   EISTNQYANPASKGAACERLNVVMLSALEIDVNFNVNVMTGSNGVLRGASGGHSDTAAG
FT                   ADLTIITAPLVRGRIPCVVEKVLTTVTPGASVDVLVTDHGIAVNPARQDLLDNLRAAGV
FT                   ALMTIEQLQQRAEQLTGKPQPIEFTDRVVAVVRYRDGSVIDVIRQVKG"
FT   gene            66741..67292
FT                   /locus_tag="SPAB_00074"
FT   CDS_pept        66741..67292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY0071 1.0e-97 citX2; citx protein; COG:
FT                   COG3697 Phosphoribosyl-dephospho-CoA transferase (holo-ACP
FT                   synthetase); Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65517"
FT                   /inference="protein motif:HMMPfam:IPR005551"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454673.1"
FT                   /protein_id="ABX65517.1"
FT                   /translation="MKGTDLLYQGQAVTLEEMLQARDKRAARQRQALNCYRLPLISLTL
FT                   VAPGAVKNSAVWRRVADYAIAEILALCEQKEWVNVWEMQVNERSGPEWMAAVCAPAMAL
FT                   KQHMSTLEMSHPLGRLWDIDIIDSDGKSLSRRELGHPARPCLICQQDAHLCARGKHHTL
FT                   DLLLDEIARRIECYERERCD"
FT   gene            67270..68178
FT                   /locus_tag="SPAB_00075"
FT   CDS_pept        67270..68178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0057 5.3e-158 citG2; putative modifier
FT                   of citrate lyase protein K05966; COG: COG1767
FT                   Triphosphoribosyl-dephospho-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65518"
FT                   /inference="protein motif:HMMPfam:IPR002736"
FT                   /inference="similar to AA sequence:INSD:AAL19027.1"
FT                   /protein_id="ABX65518.1"
FT                   /translation="MNVSVVTERRTPAYSSLAAGELNGLVARALLTEARLTPKPGLVDI
FT                   RNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVMLRPLGMACENDML
FT                   QATNGVNTHRGAIFAFGLLSAAIGRLLARGEPLEQNRICDQVARLSRNIVAHELSAKKA
FT                   GKLTKSETHFQCYGLSGARGEAESGFRTVRTQALPVFNRVVQEHDDTHLALLQTLLHLM
FT                   AWNDDTNLVSRGGLEGLYYVQQQAQKLLWQGGVLVEGGIEAMQSLDDELILRNLSPGGS
FT                   ADLLAVTWFLSHFPAGSLYPE"
FT   gene            complement(68270..68386)
FT                   /locus_tag="SPAB_00077"
FT   CDS_pept        complement(68270..68386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65520"
FT                   /protein_id="ABX65520.1"
FT                   /translation="MATRICASCIAILFCKNCVNRFQSNQRARRPPSKIADN"
FT   gene            68358..69179
FT                   /locus_tag="SPAB_00076"
FT   CDS_pept        68358..69179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY0073 4.3e-140 dapB; dihydrodipicolinate
FT                   reductase K00215; COG: COG0289 Dihydrodipicolinate
FT                   reductase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00076"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65519"
FT                   /db_xref="GOA:A9MYI6"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYI6"
FT                   /inference="protein motif:BlastProDom:IPR000846"
FT                   /inference="protein motif:HMMPfam:IPR000846"
FT                   /inference="protein motif:HMMPIR:IPR011770"
FT                   /inference="protein motif:HMMTigr:IPR011770"
FT                   /inference="protein motif:ScanRegExp:IPR000846"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454675.1"
FT                   /protein_id="ABX65519.1"
FT                   /translation="MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLL
FT                   GSDAGELAGAGKSGVIVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTT
FT                   GFDDAGKQAIREASQEIAIVFAANFSVGVNVMLKLLEKAAKVMGDYSDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAGALDKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTA
FT                   MFADIGERVEITHKASSRMTFANGALRSALWLKTKKNGLFDMRDVLGLDVL"
FT   gene            complement(69282..69404)
FT                   /locus_tag="SPAB_00078"
FT   CDS_pept        complement(69282..69404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00078"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65521"
FT                   /protein_id="ABX65521.1"
FT                   /translation="MDISLISLVEVPFAYGKPLRLNMPWAKKLSKHEWRKALFI"
FT   gene            69458..69598
FT                   /locus_tag="SPAB_00079"
FT   CDS_pept        69458..69598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65522"
FT                   /inference="similar to AA sequence:INSD:AAL19029.1"
FT                   /protein_id="ABX65522.1"
FT                   /translation="MAFLCCSEAGCGPIVCTCLKEKEAGSLYRDCNSYYIVLICCFLLI
FT                   L"
FT   gene            complement(69683..69829)
FT                   /locus_tag="SPAB_00080"
FT   CDS_pept        complement(69683..69829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65523"
FT                   /protein_id="ABX65523.1"
FT                   /translation="MTIENACASLSSQKTGWHDKKWTKWSNFTLKQQKTTIKTHLIAIN
FT                   AIK"
FT   gene            69875..69994
FT                   /locus_tag="SPAB_00081"
FT   CDS_pept        69875..69994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65524"
FT                   /protein_id="ABX65524.1"
FT                   /translation="MQNNIKNTRFKLTFIRLNFRMPPFARNPRVSKFALLHTD"
FT   gene            70043..71191
FT                   /locus_tag="SPAB_00082"
FT   CDS_pept        70043..71191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0067 2.9e-205 carA; carbamoyl-phosphate
FT                   synthase small chain K01956; COG: COG0505
FT                   Carbamoylphosphate synthase small subunit; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00082"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65525"
FT                   /inference="protein motif:HMMPfam:IPR000991"
FT                   /inference="protein motif:HMMPfam:IPR002474"
FT                   /inference="protein motif:HMMTigr:IPR006274"
FT                   /inference="protein motif:ScanRegExp:IPR012998"
FT                   /inference="protein motif:superfamily:IPR002474"
FT                   /inference="similar to AA sequence:INSD:AAV76101.1"
FT                   /protein_id="ABX65525.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNEADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDAKLALEKAKAFPGLNGMDLAKEVT
FT                   TTETYRWTQGSWTLKDGLPEAKSEDDLPFHVVAYDFGAKRNILRMLVDRGCRLTVVPAQ
FT                   TSAEEVLKMNPDGIFLSNGPGDPAPCDYAIEAIKKFLQTDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDMDRNVVMITAQNHGFAVDEDSLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRQSAK"
FT   gene            71210..74437
FT                   /locus_tag="SPAB_00083"
FT   CDS_pept        71210..74437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0067 0. carB; carbamoyl-phosphate
FT                   synthase, large subunit K01955; COG: COG0458
FT                   Carbamoylphosphate synthase large subunit (split gene in
FT                   MJ)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65526"
FT                   /inference="protein motif:Gene3D:IPR013816"
FT                   /inference="protein motif:Gene3D:IPR013817"
FT                   /inference="protein motif:HMMPfam:IPR005479"
FT                   /inference="protein motif:HMMPfam:IPR005480"
FT                   /inference="protein motif:HMMPfam:IPR005481"
FT                   /inference="protein motif:HMMPfam:IPR011607"
FT                   /inference="protein motif:HMMTigr:IPR006275"
FT                   /inference="protein motif:ScanRegExp:IPR005479"
FT                   /protein_id="ABX65526.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDIAMKKIGLDTARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICERGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNADFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEDECEANPSVDRDKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEQAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   RFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLTEQGVTQEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKQGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTAGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATTMALNADATEKVTSVQEMHAQIKKS"
FT   gene            74711..75106
FT                   /locus_tag="SPAB_00084"
FT   CDS_pept        74711..75106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00084"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09753 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00084"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65527"
FT                   /inference="similar to AA sequence:INSD:AAO67802.1"
FT                   /protein_id="ABX65527.1"
FT                   /translation="MCEKYVERPLYLLIADWMMAENRWITAREISRQFDIEHCKAINTL
FT                   SYILSEVGEIVCEVKMIPNQIAGRGCQCQRLVKVVSIDSQLYRRLNHNLQERKVSVAKA
FT                   PRLSAVPPTELNREQKWQMMLSKSMRR"
FT   gene            complement(75184..75780)
FT                   /locus_tag="SPAB_00085"
FT   CDS_pept        complement(75184..75780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0041 1.7e-88 caiE; carnitine operon
FT                   protein CaiE K08279; COG: COG0663 Carbonic
FT                   anhydrases/acetyltransferases, isoleucine patch
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65528"
FT                   /db_xref="GOA:A9MYJ4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYJ4"
FT                   /inference="protein motif:superfamily:IPR011004"
FT                   /inference="similar to AA sequence:REFSEQ:NP_803954.1"
FT                   /protein_id="ABX65528.1"
FT                   /translation="MSYYAFEGLIPVVHPDAFVHPSAVLIGDVIVGAGVYIGPLASLRG
FT                   DYGRLILEAGSNLQYGCIMHGYCDTDTIVHENGHIGHGAILHGCVVGRDALVGMNSVIM
FT                   DGAVIGEESIVAAMSFVKAGFQGEARQLLVGSPARVLRQVTDQELHWKRLNTKEYQDLA
FT                   IRCRTGLSETKPLTQVEENRPRLKGTTDVKPKSAQ"
FT   gene            complement(75890..76675)
FT                   /locus_tag="SPAB_00086"
FT   CDS_pept        complement(75890..76675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0064 9.4e-136 caiD; carnitine racemase
FT                   K08299; COG: COG1024 Enoyl-CoA hydratase/carnithine
FT                   racemase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65529"
FT                   /db_xref="GOA:A9MYJ5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYJ5"
FT                   /inference="protein motif:HMMPfam:IPR001753"
FT                   /inference="protein motif:ScanRegExp:IPR001753"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149417.1"
FT                   /protein_id="ABX65529.1"
FT                   /translation="MSESLHLTRNGPILEITLDRPKANAIDAKTSFAMGEAFLNFRDDP
FT                   ELRVAIITGGGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFDLDKPVIAAVNGY
FT                   AFGGGFELALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGR
FT                   RMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAALKEIYRATSEMPVEEG
FT                   YRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKGR"
FT   gene            complement(76729..78282)
FT                   /locus_tag="SPAB_00087"
FT   CDS_pept        complement(76729..78282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0072 1.7e-280 caiC; probable
FT                   crotonobetaine/carnitine-CoA ligase K02182; COG: COG0318
FT                   Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00087"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65530"
FT                   /db_xref="GOA:A9MYJ6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYJ6"
FT                   /inference="protein motif:FPrintScan:IPR000873"
FT                   /inference="protein motif:HMMPfam:IPR000873"
FT                   /inference="protein motif:ScanRegExp:IPR000873"
FT                   /inference="similar to AA sequence:INSD:CAD01225.1"
FT                   /protein_id="ABX65530.1"
FT                   /translation="MDIVGGQNLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNE
FT                   EINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWI
FT                   LQNSQVSLLVTSAQFYPMYREIRQDNSTPLNHICLIGEQLPADDGVSHFTQRQSRQSTT
FT                   LCYTPALSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQIALRDDDVYMTVMP
FT                   AFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPA
FT                   APTDRQHHLREVMFYLNLSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWP
FT                   SIGRVGFSYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATARALEPEGW
FT                   LHTGDSGYQDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAI
FT                   RDEAIKAFIVLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK
FT                   "
FT   gene            complement(78345..79565)
FT                   /locus_tag="SPAB_00088"
FT   CDS_pept        complement(78345..79565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0066 3.9e-224 caiB; L-carnitine
FT                   dehydratase K08298; COG: COG1804 Predicted acyl-CoA
FT                   transferases/carnitine dehydratase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65531"
FT                   /inference="protein motif:HMMPanther:IPR003673"
FT                   /inference="protein motif:HMMPfam:IPR003673"
FT                   /inference="similar to AA sequence:INSD:AAL19036.1"
FT                   /protein_id="ABX65531.1"
FT                   /translation="MMNHLPMPTFGPLAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIE
FT                   NVAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFAR
FT                   RGITDEVLWEHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQAFSGYLIQNGDVDQPMP
FT                   AFPYTADYFSGMTATTAALAALHKVRETGKGESIDIAMYEVMLRMGQYFMMDYFNGGEI
FT                   CPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILGTPEVPEGTQL
FT                   IHRVECPYGPLVEEKLDAWLATHTIADVQARFAELNIACAKVLTIPELEGNPQYVARES
FT                   ITQWQTMDGRTCKGPNIMPKFKNNPGKIWRGMPSHGMDTAAILKNIGYSEADIKELVGK
FT                   GLAKVED"
FT   gene            complement(79562..79699)
FT                   /locus_tag="SPAB_00089"
FT   CDS_pept        complement(79562..79699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65532"
FT                   /protein_id="ABX65532.1"
FT                   /translation="MRYLSNTANRSLVGLIRRGASPSGNHAGWRCAYPAYIPQKMPGEK
FT                   "
FT   gene            complement(79674..80816)
FT                   /locus_tag="SPAB_00090"
FT   CDS_pept        complement(79674..80816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0074 5.2e-206 caiA; probable carnitine
FT                   operon oxidoreductase CaiA K08297; COG: COG1960 Acyl-CoA
FT                   dehydrogenases; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65533"
FT                   /db_xref="GOA:A9MYJ9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYJ9"
FT                   /inference="protein motif:Gene3D:IPR006091"
FT                   /inference="protein motif:Gene3D:IPR013764"
FT                   /inference="protein motif:Gene3D:IPR013786"
FT                   /inference="protein motif:HMMPfam:IPR006090"
FT                   /inference="protein motif:HMMPfam:IPR006091"
FT                   /inference="protein motif:HMMPfam:IPR006092"
FT                   /inference="protein motif:ScanRegExp:IPR006089"
FT                   /inference="protein motif:superfamily:IPR009075"
FT                   /inference="protein motif:superfamily:IPR009100"
FT                   /inference="similar to AA sequence:INSD:AAV76108.1"
FT                   /protein_id="ABX65533.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLEAGFVTVAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRKNGKVYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKAGIKVNKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLLEAAWKADNGTITSGDAAMCKYFCANAAFEVVDTAMQVLGGVG
FT                   IAGNHRITRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   gene            complement(80851..82368)
FT                   /locus_tag="SPAB_00091"
FT   CDS_pept        complement(80851..82368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00091"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_2719 8.8e-53
FT                   choline/carnitine/betaine transporter K01718; COG: COG1292
FT                   Choline-glycine betaine transporter; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65534"
FT                   /db_xref="GOA:A9MYK0"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYK0"
FT                   /inference="protein motif:BlastProDom:IPR000060"
FT                   /inference="protein motif:HMMPfam:IPR000060"
FT                   /inference="protein motif:HMMTigr:IPR000060"
FT                   /inference="protein motif:ScanRegExp:IPR000060"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459079.1"
FT                   /protein_id="ABX65534.1"
FT                   /translation="MKNEKKKSGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGDEKPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFGLEPNSTGAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFV
FT                   RKMDVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWL
FT                   FGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMHLPRMLFYTDAIGKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVMGLTASTWILWTVLGSNTLLLMDKNILNIPQLIEQHGVARAIIETWA
FT                   ALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCREVRDGEEPPLLVRIGWSVLVGI
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWKDK"
FT   gene            complement(82427..82531)
FT                   /locus_tag="SPAB_00093"
FT   CDS_pept        complement(82427..82531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65536"
FT                   /protein_id="ABX65536.1"
FT                   /translation="MTKITESPEVNTHHELLIEASQRLKTYQQIINNK"
FT   gene            82510..82626
FT                   /locus_tag="SPAB_00092"
FT   CDS_pept        82510..82626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65535"
FT                   /protein_id="ABX65535.1"
FT                   /translation="MILLSSSHFFALIILCLNFDFCFIYQLIGCGFLTFLSI"
FT   gene            82849..83619
FT                   /locus_tag="SPAB_00094"
FT   CDS_pept        82849..83619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00094"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2086 Electron transfer flavoprotein, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65537"
FT                   /db_xref="GOA:A9MYK3"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYK3"
FT                   /inference="protein motif:BlastProDom:IPR000049"
FT                   /inference="protein motif:HMMPfam:IPR000049"
FT                   /inference="protein motif:HMMPIR:IPR012255"
FT                   /inference="protein motif:ScanRegExp:IPR000049"
FT                   /inference="similar to AA sequence:INSD:AAL19039.1"
FT                   /protein_id="ABX65537.1"
FT                   /translation="MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAA
FT                   CQLKQQLGDAQVVAMSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQHTATAL
FT                   AAAAQKSGFDLLICGDGSSDLYAQQVGLLVGEALNIPAINGVSKILSLTDSTLTVEREL
FT                   EDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLNSVPAYSAQ
FT                   QVAAPKQRERQRVVIEGDGEEQIAAFVENLRKII"
FT   gene            83635..84576
FT                   /locus_tag="SPAB_00095"
FT   CDS_pept        83635..84576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN1424 7.1e-26 acyl-CoA dehydrogenase,
FT                   short-chain specific K00248; COG: COG2025 Electron transfer
FT                   flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65538"
FT                   /inference="protein motif:HMMPfam:IPR000049"
FT                   /inference="protein motif:HMMPfam:IPR001308"
FT                   /inference="protein motif:HMMPIR:IPR001308"
FT                   /inference="protein motif:ScanRegExp:IPR001308"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215058.1"
FT                   /protein_id="ABX65538.1"
FT                   /translation="MNKFSSVWVFSDTPSRLPELMSGAQAVGEKVNAFVLNEADSATAC
FT                   HLGADHVWLLSGKPEDRMIEDYAAAMAETIRQHSEGGAVLLPNTRRGKLLAAKLGYRLS
FT                   AAVSNDASEVALQDGKAAVKHMVYGGLAIGAETIASPFAVITLSSGTFDAQQPDASRSG
FT                   EMHTVQWQAPAITVTRTATQARQSNSVDLDKARLVVSVGRGIGSKENISLAEALCQTIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANGAQTIFAIN
FT                   KDKNAPIFQYADFGIVGDALKILPALTAALAR"
FT   gene            84626..85912
FT                   /locus_tag="SPAB_00096"
FT   CDS_pept        84626..85912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00096"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY0087 3.7e-221 fixC; FixC protein
FT                   K00313; COG: COG0644 Dehydrogenases (flavoproteins); Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65539"
FT                   /inference="protein motif:HMMPfam:IPR006076"
FT                   /inference="similar to AA sequence:INSD:CAD01231.1"
FT                   /protein_id="ABX65539.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLERIIPGFADQAPIERMITHEKLAFMTDKGAMTMDYCNGEDAASSQVSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNVVQRDGKVVGVEADGDILEAKVVILADGVN
FT                   SLLAEKLGMAKRVEASHVAVGVKELIELPKSVIEDRFQLQGNEGAACLFAGAPTDGLMG
FT                   GGFLYTNETTLSLGLVCGLHHLKDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYAAHVV
FT                   PEAGMNMQPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAISAGEAAAKTVLSAMKRDDF
FT                   SKQSLDEYRQHLDEGPMRDMRMYQKLPAFLDNPRMFTAYPEMAVSIARDLFTVDGSAPV
FT                   PMRKKILRHAKKVGFINLMKDGLKGVTVL"
FT   gene            85909..86196
FT                   /locus_tag="SPAB_00097"
FT   CDS_pept        85909..86196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00097"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0094 3.9e-06 ydiS; flavoprotein
FT                   probably electron transport K00313; COG: COG2440
FT                   Ferredoxin-like protein; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65540"
FT                   /inference="protein motif:HMMPIR:IPR012206"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZRW8"
FT                   /protein_id="ABX65540.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEDSPHIILKTDPDKQALEVLIKACPA
FT                   GLYKKQDDGSVCFDYAGCLECGTCRILGLDTALEKWEYPRGTFGVEFRYG"
FT   gene            86259..87683
FT                   /locus_tag="SPAB_00098"
FT   CDS_pept        86259..87683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00098"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:orf19.4384 5.5e-16 HXT10; fructose
FT                   symporter K01804; COG: COG0477 Permeases of the major
FT                   facilitator superfamily; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00098"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65541"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215061.1"
FT                   /protein_id="ABX65541.1"
FT                   /translation="MWRQCRMAAETPYPAYRCALPVLKQDITMQQPRNFDDLKFSSIHR
FT                   RIMLWGSGGPFLDGYVLVIIGVALEQLTPLLHLDAEWIGALGAATLAGLFIGTSLFGYI
FT                   CDKVGRRKMFLLDIIAIGVISVATMFVSTPLELLVMRVLIGIVIGADYPIATSMITEFS
FT                   NTRQRAFSIGFIAAMWYVGATCANLVGYWLYDMEGGWRWMLGSAFIPCLIILIGRFDLP
FT                   ESPRWLLRKGRVKECEQMMIKLFGEPVCFDDEPPQETRFLQLFNRRHFPFVLFVAAIWT
FT                   CQVIPMFAIYTFGPQIVGLLGWEQGRNAALGNVVISLFFMLGCIPAMFWLNSIGRRPLL
FT                   VGSFAMMTIALALLGLVSNLGIILVVVAFAVYAFFSGGPGILQWLYPNELFPTDIRASA
FT                   VGVIMSLSRIGTIVSTWALPIFITRYGINNVMLIGALISLVGLGVSVMFAPETRGLTLT
FT                   QTGNMTLRGTPSDNPR"
FT   gene            87772..88002
FT                   /locus_tag="SPAB_00099"
FT   CDS_pept        87772..88002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EF0685 0.0030 rotamase family protein
FT                   K07533; COG: NOG17119 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65542"
FT                   /inference="protein motif:HMMPfam:IPR010305"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149427.1"
FT                   /protein_id="ABX65542.1"
FT                   /translation="MQKRLMTALFTAATLFTVAGCSSNQAVETTDGKTIVTDGKPEVDN
FT                   DTGMVSYKNAATGKTEQINRDQLKNMSELDN"
FT   gene            complement(88043..88177)
FT                   /locus_tag="SPAB_00100"
FT   CDS_pept        complement(88043..88177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65543"
FT                   /protein_id="ABX65543.1"
FT                   /translation="MSVTSCKRTARWGKREHERTYFDVFRRPCLFRHPFIRMGINGCA"
FT   gene            88288..88710
FT                   /locus_tag="SPAB_00101"
FT   CDS_pept        88288..88710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00101"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG27675 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65544"
FT                   /inference="similar to AA sequence:INSD:AAV76116.1"
FT                   /protein_id="ABX65544.1"
FT                   /translation="MKLKPIPFYLLALFSAASGATEINACKDLIGTWKTTADNPPYTMT
FT                   ILPPVEGCGEKCVKLNVQYELDVTHRNALYCHEGQEGVKGQGPMVIAFEGAYGGHAIGT
FT                   YNRQLQLLWAGVIPKNKKGKWITKMENYWFRQVKAH"
FT   gene            complement(88714..88869)
FT                   /locus_tag="SPAB_00102"
FT   CDS_pept        complement(88714..88869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65545"
FT                   /protein_id="ABX65545.1"
FT                   /translation="MLRHNPLRAVWKQMLALFFINSSSGAGKSVEYMRAGSKPFVNKTV
FT                   LRAVLR"
FT   gene            complement(88934..89224)
FT                   /locus_tag="SPAB_00103"
FT   CDS_pept        complement(88934..89224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00103"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG31170 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65546"
FT                   /inference="protein motif:HMMPfam:IPR010854"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454692.1"
FT                   /protein_id="ABX65546.1"
FT                   /translation="MKKRIIAAALLATVASFSTLAAEQVSKQEISHFKLVKVGTINVSQ
FT                   SGGQISSPSDLREKLSELADAKGGKYYHIIAAREHGPNFEAVAEVYNDATK"
FT   gene            89434..89628
FT                   /locus_tag="SPAB_00104"
FT   CDS_pept        89434..89628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00104"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG34507 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65547"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215065.1"
FT                   /protein_id="ABX65547.1"
FT                   /translation="MLLGTHSLAAFKQLELFWVITSVDYLKIALFGVTVLYLVIVTSLC
FT                   CCQYKIMHCQLKRNLTPCK"
FT   gene            90122..92011
FT                   /locus_tag="SPAB_00105"
FT   CDS_pept        90122..92011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B0315 3.1e-137 arylsulfatase K01130;
FT                   COG: COG3119 Arylsulfatase A and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65548"
FT                   /inference="protein motif:HMMPfam:IPR000917"
FT                   /protein_id="ABX65548.1"
FT                   /translation="MSNKKNLSAEETDLTRRKLLTSAGILAAGGMLSGAVKADEKCAVK
FT                   AKPAWDKPFTGEIPEKLPEGYNILLVVTDQERFFPTFPFPVPGRERLMKTGVTFCNHQN
FT                   TSNVCTPSRSVLYTGLHMPQTKMFDNLGLPWMPYDLDPALGTTGHMMRELGYYTAYKGK
FT                   WHLTEKLEKPLPDEKDEDIDVGDIPEPELHKIMEKYGFADYHGIGDIIGHSKGGYFYDS
FT                   TTTAQTINWLRCKGQPLNDQHKPWFLAVNLVNPHDVMFIDTDKEGEKVQWRGELDQDDN
FT                   TLAPTQPPENELYQASWPNYPLPANRHQSFNEQGRPPAHLEYQTARAALEGQFPDEDRR
FT                   WRKLLDYYFNCIRDCDTHLDRILNELDALKLTDKTIVVFTADHGELGGSHQMHGKGASV
FT                   YKEQIHVPMIISHPAYPGNKKCQALTCHLDIAPTLVGLTGLPEEKQHQALGNRKGVNFS
FT                   GLLKNPEGVAVNAVRNASLYCYGMILYTDAHYLHRVIALQRDKQKTVAQIKQEISHLHP
FT                   DFSHRSGTRMINDGRYKFARYFSLREHNTPETWEDLIKYNDLELYDLKNDPDENHNLAA
FT                   DKQKYQDLILTMNEKLNKIIKDEIGVDDGSFMPDAAHEPWDLTIEQFNRMAKD"
FT   gene            complement(92029..92133)
FT                   /locus_tag="SPAB_00106"
FT   CDS_pept        complement(92029..92133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65549"
FT                   /protein_id="ABX65549.1"
FT                   /translation="MLKPVWGRPARRNRSVHVVREDFEHCPDPKWRIK"
FT   gene            92208..92330
FT                   /locus_tag="SPAB_00107"
FT   CDS_pept        92208..92330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65550"
FT                   /protein_id="ABX65550.1"
FT                   /translation="MSGGSDAVGAALIGPVSSCNGLILQSLQANLAQRRPVRRP"
FT   gene            92336..92617
FT                   /locus_tag="SPAB_00108"
FT   CDS_pept        92336..92617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65551"
FT                   /protein_id="ABX65551.1"
FT                   /translation="MVNDLRLPSSPTFPHRIALFRKRLRPFESVFRGQDGVNSWLALIQ
FT                   FFLVSRSIIFTISLANLSLHFVIKNRSSQANHDPHYLCASVSASFSCE"
FT   gene            92622..93095
FT                   /locus_tag="SPAB_00109"
FT   CDS_pept        92622..93095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0080 2.9e-86 yabF; putative NAD(P)H
FT                   oxidoreductase; COG: COG2249 Putative NADPH-quinone
FT                   reductase (modulator of drug activity B)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65552"
FT                   /inference="protein motif:HMMPfam:IPR003680"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215067.1"
FT                   /protein_id="ABX65552.1"
FT                   /translation="MLEQAGTLENVEIRSLYHLYPDFNIDVAAEQEALSRASLIVWQHP
FT                   MQWYSVPPLLKLWMDKVLTHGWAYGHGGTALHGKHLLWAVTTGGGENHFAIGSHPGFDV
FT                   LSQPLQATALYCGLKWLPPFAMHCTFICDNDTLQAQARQYKQRLLAWQEVNHG"
FT   gene            93088..94950
FT                   /locus_tag="SPAB_00110"
FT   CDS_pept        93088..94950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00110"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saz:Sama_1053 0.0074 oxaloacetate
FT                   decarboxylase K01570; COG: COG0475 Kef-type K+ transport
FT                   systems, membrane components; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65553"
FT                   /db_xref="GOA:A9MYL9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYL9"
FT                   /inference="protein motif:HMMPfam:IPR003148"
FT                   /inference="protein motif:HMMPfam:IPR006153"
FT                   /inference="protein motif:HMMTigr:IPR004771"
FT                   /protein_id="ABX65553.1"
FT                   /translation="MDSHTLLQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMVVCGGLIGLF
FT                   CMFLGLRWQVAELIGMTLALSSTAIAMQAMNERNLTVSQVGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLAASGASTTLGAFALSALKVAGALALVVVLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLVENPLRILLLLAGFLAIKIVMLWLVARPLGVPAKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMADVLEPEWAKALTLAVALSMAATPIFLVLLTRMEKTATGEAREADEIDEEQ
FT                   PRVIVAGFGRFGQIAGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLSELVKSHFPHLQIIARARDVDHYIRLRQAGVAMPERE
FT                   TFEGALKSGRQALEALGLGRYEARERADLFRHFNTRMVEEMAKGENDPLSRAAAYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTAEGKHSGEVADEPEVKPSI"
FT   gene            complement(94947..95072)
FT                   /locus_tag="SPAB_00111"
FT   CDS_pept        complement(94947..95072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65554"
FT                   /protein_id="ABX65554.1"
FT                   /translation="MSTKIFRSAGDATHLMWSASITVVQKQPISSKVCRTSHFLL"
FT   gene            95149..95628
FT                   /locus_tag="SPAB_00112"
FT   CDS_pept        95149..95628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0082 1.6e-85 folA; dihydrofolate
FT                   reductase type I; trimethoprim resistance K00287; COG:
FT                   COG0262 Dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65555"
FT                   /inference="protein motif:FPrintScan:IPR001796"
FT                   /inference="protein motif:HMMPfam:IPR001796"
FT                   /inference="protein motif:HMMPIR:IPR012259"
FT                   /inference="protein motif:ScanRegExp:IPR001796"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215069.1"
FT                   /protein_id="ABX65555.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRH
FT                   TWESIGRPLPGRKNIVISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   gene            complement(95734..96582)
FT                   /locus_tag="SPAB_00113"
FT   CDS_pept        complement(95734..96582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY0103 6.9e-156 apaH;
FT                   bis(5'-nucleosyl)-tetraphosphatase K01525; COG: COG0639
FT                   Diadenosine tetraphosphatase and related serine/threonine
FT                   protein phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65556"
FT                   /db_xref="GOA:A9MYM2"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYM2"
FT                   /inference="protein motif:HMMPfam:IPR004843"
FT                   /inference="protein motif:HMMPIR:IPR004617"
FT                   /inference="protein motif:HMMTigr:IPR004617"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX65556.1"
FT                   /translation="MATYLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGS
FT                   LDVLRYVKSLGNSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRR
FT                   QPLLQVDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELSGLARLRFITNAFTRMRYCFPNGQLDMYSKASPENAPAPLKPWFAIPGPVSEAYS
FT                   IAFGHWASLEGKGTPEGIYALDTGCCWGGELTCLRWEDKQYFVQPSNRQMDMGEGEAVN
FT                   A"
FT   gene            complement(96593..96970)
FT                   /locus_tag="SPAB_00114"
FT   CDS_pept        complement(96593..96970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00114"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2967 Uncharacterized protein affecting
FT                   Mg2+/Co2+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00114"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65557"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYM3"
FT                   /inference="protein motif:HMMPfam:IPR007474"
FT                   /inference="similar to AA sequence:INSD:AAV76123.1"
FT                   /protein_id="ABX65557.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGHGRETEVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDE
FT                   NGDAFTIDIPVFRLAVPTLIH"
FT   gene            complement(96973..97794)
FT                   /locus_tag="SPAB_00115"
FT   CDS_pept        complement(96973..97794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0093 2.8e-143 ksgA; dimethyladenosine
FT                   transferase K02528; COG: COG0030 Dimethyladenosine
FT                   transferase (rRNA methylation)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65558"
FT                   /db_xref="GOA:A9MYM4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYM4"
FT                   /inference="protein motif:HMMPanther:IPR001737"
FT                   /inference="protein motif:HMMPfam:IPR001737"
FT                   /inference="protein motif:HMMSmart:IPR001737"
FT                   /inference="protein motif:HMMTigr:IPR011530"
FT                   /inference="protein motif:ScanRegExp:IPR001737"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454702.1"
FT                   /protein_id="ABX65558.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDRFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDKLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELSAQL
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPYPVKDIRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVETLTEMGIDPAMRAENISVAQYCQMANYLSENAPLKES"
FT   gene            complement(97791..98780)
FT                   /locus_tag="SPAB_00116"
FT   CDS_pept        complement(97791..98780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0094 1.4e-173 pdxA; pyridoxal phosphate
FT                   biosynthetic protein PdxA K00097; COG: COG1995 Pyridoxal
FT                   phosphate biosynthesis protein; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65559"
FT                   /inference="protein motif:HMMPfam:IPR005255"
FT                   /inference="protein motif:HMMTigr:IPR005255"
FT                   /inference="similar to AA sequence:INSD:CAD01247.1"
FT                   /protein_id="ABX65559.1"
FT                   /translation="MSSAQRVVITPGEPAGIGPDLVVQLAQRAWPIELVVCADGALLTE
FT                   RAAMLGLPLSLLPYSPDVPAAPQPAGTLTLLPVSLRAPAIPGQLTVENGPYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRAIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGKADVGSFITALNLAIKMIVNTQ"
FT   gene            complement(98780..100066)
FT                   /locus_tag="SPAB_00117"
FT   CDS_pept        complement(98780..100066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0093 7.4e-223 surA; survival protein
FT                   SurA precursor K03771; COG: COG0760 Parvulin-like
FT                   peptidyl-prolyl isomerase; Psort location: Periplasmic,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00117"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65560"
FT                   /inference="protein motif:HMMPfam:IPR000297"
FT                   /inference="protein motif:ScanRegExp:IPR000297"
FT                   /inference="similar to AA sequence:INSD:AAL19056.1"
FT                   /protein_id="ABX65560.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIA
FT                   KQNNMTMDQMRSRLAYDGLNYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQ
FT                   IGTQNDASTELNLSHILIALPENPTSEQVNDAQRQAENIVEEARNGADFGKLAITYSAD
FT                   QQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGQSQSIS
FT                   VTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGD
FT                   LGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAATWMQEQRASAYVKILSN"
FT   gene            complement(100120..102447)
FT                   /locus_tag="SPAB_00118"
FT   CDS_pept        complement(100120..102447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00118"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1452 Organic solvent tolerance protein OstA;
FT                   Psort location: OuterMembrane, score:9.49"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65561"
FT                   /inference="protein motif:HMMPfam:IPR005653"
FT                   /inference="protein motif:HMMPfam:IPR007543"
FT                   /protein_id="ABX65561.1"
FT                   /translation="MIASALYSHQGLAADLASQCMLGVPSYDRPLVKGDTNDLPVTINA
FT                   DNAKGNYPDDAVFTGNVDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDN
FT                   QVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGSFTSCL
FT                   PGSDTWSVVGSEVIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGDKRRSGFLIPNA
FT                   KYTTKNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLTQAGEGVMELDYL
FT                   PSDKVYEDDHPKEGDKHRWLFYWQHSGVMDQVWRFNVDYTKVSDSSYFNDFDSKYGSST
FT                   DGYATQKFSVGYAVQNFDATVSTKQFQVFNDQNTSSYSAEPQLDVNYYHNDLGPFDTRI
FT                   YGQAVHFVNTKDNMPEATRVHLEPTINLPLSNRWGSLNTEAKLMATHYQQTNLDSYNSD
FT                   PNNKNKLEDSVNRVMPQFKVDGKLIFERDMAMLAPGYTQTLEPRVQYLYVPYRDQSGIY
FT                   NYDSSLLQSDYNGLFRDRTYGGLDRIASANQVTTGVTTRIYDDAAVERFNVSVGQIYYF
FT                   TESRTGDDNIKWENDDKTGSLVWAGDTYWRISERWGLRSGVQYDTRLDSVATSSSSLEY
FT                   RRDQDRLVQLNYRYASPEYIQATLPSYYSTAEQYKNGINQVGAVASWPIADRWSIVGAY
FT                   YFDTNSSKPADQMLGLQYNSCCYAIRVGYERKLNGWDNDKQHAIYDNAIGFNIELRGLS
FT                   SNYGLGTQEMLRSNILPYQSSM"
FT   gene            102449..102613
FT                   /locus_tag="SPAB_00119"
FT   CDS_pept        102449..102613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65562"
FT                   /protein_id="ABX65562.1"
FT                   /translation="MARRVGIRFFIRCIYCSIIGSVARDKRSQPNLLIFAAPVLILPFS
FT                   VCGVRHGIE"
FT   gene            102734..103546
FT                   /locus_tag="SPAB_00120"
FT   CDS_pept        102734..103546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00120"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1076 DnaJ-domain-containing proteins 1;
FT                   Psort location: CytoplasmicMembrane, score:9.59"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65563"
FT                   /inference="protein motif:HMMPfam:IPR001623"
FT                   /inference="protein motif:HMMSmart:IPR001623"
FT                   /inference="protein motif:superfamily:IPR001623"
FT                   /inference="similar to AA sequence:SwissProt:Q5PDE4"
FT                   /protein_id="ABX65563.1"
FT                   /translation="MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGDSRTAAQNAFRVG
FT                   KADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEELGI
FT                   SRVQFDQFLRMMQGGAQFGGGYHQQSGGGWQQAQRGPTLEDACNVLGVKTTDDATTIKR
FT                   AYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK"
FT   gene            complement(103641..104300)
FT                   /locus_tag="SPAB_00121"
FT   CDS_pept        complement(103641..104300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0095 1.6e-117 rluA; 23S rRNA
FT                   pseudouridylate 746 synthase K06177; COG: COG0564
FT                   Pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65564"
FT                   /inference="protein motif:BlastProDom:IPR006145"
FT                   /inference="protein motif:HMMPfam:IPR006145"
FT                   /inference="protein motif:ScanRegExp:IPR006224"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459100.1"
FT                   /protein_id="ABX65564.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDEHIMVVNKPSGLLSVPGRLEAHKDS
FT                   IMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYNVVEFAADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEALSLAPRLQLHAEMLTITHPAYGNSMTFKVPADF"
FT   gene            complement(104312..107218)
FT                   /locus_tag="SPAB_00122"
FT   CDS_pept        complement(104312..107218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0091 0. hepA; RNA polymerase associated
FT                   protein, putative SNF2 family RNA helicase K03580; COG:
FT                   COG0553 Superfamily II DNA/RNA helicases, SNF2 family;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65565"
FT                   /db_xref="GOA:A9MYN1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYN1"
FT                   /inference="protein motif:HMMPfam:IPR000330"
FT                   /inference="protein motif:HMMPfam:IPR001650"
FT                   /inference="protein motif:HMMSmart:IPR001650"
FT                   /inference="protein motif:HMMSmart:IPR014001"
FT                   /protein_id="ABX65565.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAMDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHEGWQLHIDEVKEENGLLVYVGTRLDTEETNVTLREVLLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPYSGLRGQRTNLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYTEAQHDAYNPFETEQLVICSLDFARRNKQRLEHLCDAEWDLLVVDE
FT                   AHHLVWSTDAPSREYMAIEQLAERVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFE
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNRLGDLIGEQDIEPLLQAANSDRDDAQAA
FT                   RDELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTVKLPLPTQYQTAIKVSGIMGARK
FT                   SAEDRARDMLYPEQIYQEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLVICAKATTAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   NLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRAIYDSAYASLINYLAAPEETDGFDDLIKSCREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQQLAQSIEEQDDDTNLIAFAMNLFDIVGINQDDRGDNLIVLTPSDHMLVPDFPG
FT                   LPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELVYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLSAVNRH
FT                   TGSKLVNAVQQDVHAILQLGETQIEKSARALIDNARREADEKLSGELSRLEALRAVNPN
FT                   IRDDELAAIDSNRQQVLESLNQAGWRLDALRLIVVTHQ"
FT   gene            complement(107392..109650)
FT                   /locus_tag="SPAB_00123"
FT   CDS_pept        complement(107392..109650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0098 0. polB; DNA polymerase II K02336;
FT                   COG: COG0417 DNA polymerase elongation subunit (family B);
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65566"
FT                   /inference="protein motif:FPrintScan:IPR006172"
FT                   /inference="protein motif:HMMPanther:IPR006172"
FT                   /inference="protein motif:HMMPfam:IPR006133"
FT                   /inference="protein motif:HMMPfam:IPR006134"
FT                   /inference="protein motif:HMMSmart:IPR006172"
FT                   /inference="protein motif:ScanRegExp:IPR006172"
FT                   /inference="protein motif:superfamily:IPR012337"
FT                   /protein_id="ABX65566.1"
FT                   /translation="MQATLAPQESVAFIPTSQTSRAASLLQAEKDYRLTPLQLRDFHRQ
FT                   PVSGLYCRTHRQLMRMEKLLRENGVTVYEADVRPPERYLMERFITSPVWVDGEMRNGVI
FT                   RNARLKPHPDYRPPLKWVSLDIETTRHGELYCIGLEGCGQRTVYMLGPANGDDRQLDFE
FT                   LVYVASRPQLLEKLNAWFAEHDPDVIIGWNVVQFDLRMLQKHAERYRIPLRLGRDNSEL
FT                   EWREHGFKNGVFFAQARGRVIIDGIDALKSAFWNFSSFSLEAVSQELLGEGKSIDNPWD
FT                   RMDEIDRRFAQDKPALATYNLKDCELVTRIFHKTEIMPFLLERATINGLPVDRHGGSVA
FT                   AFGHLYFPRMHRAGYVAPNLGEVPPLASPGGYVMDSQPGLYDSVLVLDYKSLYPSIIRT
FT                   FLIDPVGLVEGMAQPDPEHSTEGFLDAWFSREKHCLPEIVSQIWHGRDEAKRQGNKPLS
FT                   QALKIIMNAFYGVLGTTACRFFDPRLASSITMRGHAIMRQTKALIEAQGYDVIYGDTDS
FT                   TFVWLRRAHSEADAAEIGHRLVRHVNEWWAQTLQQQNLTSALELEFETHFCRFLMPTIR
FT                   GADTGSKKRYAGLIQEGDSQRMVFKGLETVRTDWTPLAQRFQQELYLRVFRNEPYQDYV
FT                   RETIDKLMAGELDAQLVYRKRLRRPLHEYQRNIPPHVRAARLADEQNLKQGRPAQYQNR
FT                   GAIIYVWTVNGPEPLDYQQSPLDYEHYLTRQLQPVAEGILPFVEDNFATLLTGQLGLF"
FT   gene            109658..109774
FT                   /locus_tag="SPAB_00124"
FT   CDS_pept        109658..109774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65567"
FT                   /protein_id="ABX65567.1"
FT                   /translation="MSVASQKETSVPCGVSRQCRVKMKPACATMITCLKNSR"
FT   gene            complement(109787..110500)
FT                   /locus_tag="SPAB_00125"
FT   CDS_pept        complement(109787..110500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00125"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1434 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65568"
FT                   /inference="protein motif:HMMPfam:IPR003848"
FT                   /inference="similar to AA sequence:INSD:AAL19062.1"
FT                   /protein_id="ABX65568.1"
FT                   /translation="MINIRQQKYLTLKAILSLKYPLHPSRGTNSFMKYRYIIRIAAGII
FT                   LIMATVFIHNAIAIYQFSQQNQTRVADCAIVAGAGVSGKTPSPVFQARLDHAIWLYQQH
FT                   IVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENIRYAKQILRQ
FT                   QQWRTALLVSDPLHMLRLKTIAQDNGIDSRSSPTRSTRYKSWWAQTRFLLRETFYYSGY
FT                   RLLRYMPVQNNSITP"
FT   gene            110597..110710
FT                   /locus_tag="SPAB_00126"
FT   CDS_pept        110597..110710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65569"
FT                   /inference="similar to AA sequence:INSD:AAL19063.1"
FT                   /protein_id="ABX65569.1"
FT                   /translation="MCQVCFHTLSIFQKGACSNLLLISRINKKAIFFVCFT"
FT   gene            110924..111343
FT                   /locus_tag="SPAB_00127"
FT   CDS_pept        110924..111343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00127"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG28502 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65570"
FT                   /inference="similar to AA sequence:INSD:AAL19064.1"
FT                   /protein_id="ABX65570.1"
FT                   /translation="MNVFMQARLVGNDRYLFVNTQRANPSIKTVSRFFEYKTWTEQIWR
FT                   TEIIENGNAFFHWQGHDRKNGHRDTIINYLLNGQRWQSTIEDYIFFHALEGKAWQGHYD
FT                   NIIEYVSSDHYVYQSAFAEYITDQIHQRAPHGTRF"
FT   gene            complement(111349..112113)
FT                   /locus_tag="SPAB_00128"
FT   CDS_pept        complement(111349..112113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0095 5.4e-124 araD;
FT                   L-ribulose-5-phosphate 4-epimerase K01786; COG: COG0235
FT                   Ribulose-5-phosphate 4-epimerase and related epimerases and
FT                   aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65571"
FT                   /inference="protein motif:Gene3D:IPR001303"
FT                   /inference="protein motif:HMMPfam:IPR001303"
FT                   /inference="protein motif:HMMTigr:IPR004661"
FT                   /inference="protein motif:superfamily:IPR001303"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215082.1"
FT                   /protein_id="ABX65571.1"
FT                   /translation="MSPSGTPSLVGRISEAPSGREKTMLEDLKRQVLEANLALPKHNLV
FT                   TLTWGNVSAVDRERGVLVIKPSGVDYSVMTAEDMVVVSLETGEVVEGHKKPSSDTPTHR
FT                   LLYQAFPTIGGIVHTHSRHATIWAQAGQPIPATGTTHADYFYGTIPCTRKMTEAEINGE
FT                   YEWETGNVIVEAFEKQGIDAAQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIF
FT                   CRQLAPQLPDMQQSLLDKHYLRKHGAKAYYGQ"
FT   gene            complement(112185..113687)
FT                   /locus_tag="SPAB_00129"
FT   CDS_pept        complement(112185..113687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0104 6.9e-275 araA; L-arabinose
FT                   isomerase K01804; COG: COG2160 L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65572"
FT                   /db_xref="GOA:A9MYN8"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYN8"
FT                   /inference="protein motif:BlastProDom:IPR003762"
FT                   /inference="protein motif:HMMPfam:IPR003762"
FT                   /inference="protein motif:HMMPIR:IPR003762"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149449.1"
FT                   /protein_id="ABX65572.1"
FT                   /translation="MTIFDNYEVWFVIGSQHLYGAETLRQVTQHAEHVVNALNTEAKLP
FT                   CKLVLKPLGTSPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLSILNKPLLQFH
FT                   TQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKEAHTRIGAW
FT                   MRQAVSKQDTRQLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIG
FT                   DGDINALIDEYESSYTLTPATRIHGDKRQNVREAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFE
FT                   KGNDLVLGSHMLEVCPSIAVEEKPILDVQHLGIGGKEDPARLIFNTQTGPAIVASLIDL
FT                   GDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALD
FT                   LNDMRQFAEIHDIEIAVIDNDTRLPAFKDALRWNEVYYGLKR"
FT   gene            complement(113698..115407)
FT                   /locus_tag="SPAB_00130"
FT   CDS_pept        complement(113698..115407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00130"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0103 0. araB; L-ribulokinase K00853;
FT                   COG: COG1069 Ribulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65573"
FT                   /db_xref="GOA:A9MYN9"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MYN9"
FT                   /inference="protein motif:HMMPanther:IPR000577"
FT                   /inference="protein motif:HMMPfam:IPR000577"
FT                   /inference="protein motif:HMMTigr:IPR005929"
FT                   /protein_id="ABX65573.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVDCATGDEIATSVEWYPRWQEGRYCDG
FT                   PNNQFRHHPRDYMESMEAALKAVLAQLSAAQRANVVGIGVDSTGSTPAPIDADGNVLAL
FT                   RPEFAENPNAMFVLWKDHTAVEEADEITRLCHKPGKVDYSRYIGGIYSSEWFWAKILHV
FT                   TRQDSAVAQAAVSWIELCDWVPALLSGTTRPQDIRRGRCSAGHKTLWHESWGGLPPASF
FT                   FDELDPCINRHLRYPLFSETFTADLPVGTLCAEWAQRLDLPESVVISGGAFDCHMGAVG
FT                   AGAQSNTLVKVIGTSTCDILIADKQSVGDRAVKGICGQVDGSVVPNFIGLEAGQSAFGD
FT                   IYAWFSRVLSWPLEQLAAQHPELKTQINASQKQLLPALTDAWAKNPSLDHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDAPALFGGLVASTAFGARAIQECFTDQGIAVNNVMAL
FT                   GGIARKNQVIMQVCCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIPAAQQSMASA
FT                   VERTLRPHPEQAQRFEQLYRRYQQWALSAEQHYLPTAAPAPTTPANQAILTH"
FT   gene            115748..116593
FT                   /locus_tag="SPAB_00131"
FT   CDS_pept        115748..116593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK2914 7.1e-07 adaA;
FT                   methylphosphotriester-DNA alkyltransferase K00567; COG:
FT                   COG2207 AraC-type DNA-binding domain-containing proteins;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65574"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR000005"
FT                   /inference="protein motif:HMMPfam:IPR003313"
FT                   /inference="protein motif:HMMSmart:IPR000005"
FT                   /inference="protein motif:ScanRegExp:IPR000005"
FT                   /inference="protein motif:superfamily:IPR003313"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:INSD:AAD22473.1"
FT                   /protein_id="ABX65574.1"
FT                   /translation="MAETQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
FT                   ILNLTIRGEGVINNNGEQFVCRPGDILLFPPGEIHHYGRHPDASEWYHQWVYFRPRAYW
FT                   QEWLTWPTIFAQTGFFRPDEARQPHFSELFGQIISAGQGEGRYSELLAINLLEQLLLRR
FT                   MAVINESLHPPMDSRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGIS
FT                   VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
FT                   "
FT   gene            116712..117479
FT                   /locus_tag="SPAB_00132"
FT   CDS_pept        116712..117479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsl:LSL_1322 0.0087 alkaline phosphatase
FT                   K01077; COG: COG0586 Uncharacterized membrane-associated
FT                   protein; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65575"
FT                   /inference="protein motif:superfamily:IPR008934"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215086.1"
FT                   /protein_id="ABX65575.1"
FT                   /translation="MQALLEHFITQSTLYSLIAVLLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELNFWHAWLVGIIGCLMGDWISFWLGWRFKKPLHRWSFMKKNKSLLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFIGPNLIGCLLWPPFYFLPGILAG
FT                   AAIDIPSDMQSGDFKWLLLATALLLWVGGWLCWRLWRSGKAAVDRLTAYFPRSRLLYLA
FT                   PLTLGIGVVALVVLVRHPLMPVYIDILRKVVGY"
FT   gene            complement(117518..118225)
FT                   /locus_tag="SPAB_00133"
FT   CDS_pept        complement(117518..118225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sme:SMb20363 6.9e-37 putative iron ABC
FT                   transporter ATP-binding protein K02010; COG: COG3840
FT                   ABC-type thiamine transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65576"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR005968"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="similar to AA sequence:INSD:CAD01263.1"
FT                   /protein_id="ABX65576.1"
FT                   /translation="MLKLIDITWLYHHLPMRFTLAVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLAPASGTLLIADEDHTLTPPSRRPVSMLFQENNLFSHLNVQQNIGLGLNPGLTLNA
FT                   SQREKRDAIARQMGIESLMARLPGELSGGQRQRVALARCLVREQPVLLLDEPFSALDPA
FT                   LRQEMLTLVSDICRERQLTLLMVSHSVEDAARIAPRSIVVADGRIAWQGNTDELLSGQA
FT                   SASALLGIKSHIL"
FT   gene            complement(118209..119819)
FT                   /locus_tag="SPAB_00134"
FT   CDS_pept        complement(118209..119819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdi:DIP0495 1.1e-10 putative molybdenum ABC
FT                   transport system (integral membrane and ATP-binding
FT                   proteins) K02017:K02018; COG: COG1178 ABC-type Fe3+
FT                   transport system, permease component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65577"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR005947"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459112.1"
FT                   /protein_id="ABX65577.1"
FT                   /translation="MATRRQPLIPGWLIPGLCAAALMITVSLAAFLALWLNAPSGAWST
FT                   IWRDSYLWHVVRFSFWQAFLSAVLSVVPAVFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLWQMLGLQWTFSPYGLQGILLAHVFFNLPMASRLLLQSLE
FT                   SIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIFQALSYDYDPARAAMLALIQMVCCLALVLLSQRLSKAIAPGMTLTQGWRDP
FT                   DDRLHSRLTDALLIVLALLLLLPPLVAVVVDGVNRSLPEVLAQPILWQAVWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELRQRQQLFAGQTLELSGMLILAMPGIVLATGFFLLLNNSVG
FT                   LPESADGIVIFTNALMAIPYALKVLENPMRDITARYGMLCQSLGIEGWSRLKVVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDNFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFTLFTLIEKLPGRHAKTD"
FT   gene            complement(119795..120778)
FT                   /locus_tag="SPAB_00135"
FT   CDS_pept        complement(119795..120778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00135"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4143 ABC-type thiamine transport system,
FT                   periplasmic component; Psort location: Periplasmic,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65578"
FT                   /inference="protein motif:BlastProDom:IPR011587"
FT                   /inference="protein motif:HMMTigr:IPR005948"
FT                   /inference="protein motif:HMMTigr:IPR005967"
FT                   /inference="protein motif:ScanRegExp:IPR006061"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX65578.1"
FT                   /translation="MLKKYLPLLLLCAAPAFAKPVLTVYTYDSFAADWGPGPAVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKSGVANE
FT                   AVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPRTSTP
FT                   GLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   IIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGNWM
FT                   YPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWISEWQRAVSR"
FT   misc_feature    complement(120810..120909)
FT                   /note="TPP riboswitch (THI element)"
FT                   /inference="nucleotide motif:Rfam:RF00059"
FT   gene            complement(120957..122615)
FT                   /locus_tag="SPAB_00136"
FT   CDS_pept        complement(120957..122615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00136"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4533 ABC-type uncharacterized transport
FT                   system, periplasmic component; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65579"
FT                   /inference="protein motif:HMMPfam:IPR000914"
FT                   /protein_id="ABX65579.1"
FT                   /translation="MPSGRLQQQFIRLWQCCDGKTQDTTLNELADLLNCSRRHMRTLLN
FT                   TMQARGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKSAVR
FT                   QMLISHLGRSFRQGRHILRVLYYRPMHNLLPGTALRRSETHIARQIFSSLTRVNEENGE
FT                   LEADIAHHWQQISPLLWRFYLRPGIHFHHGRELEMEDVITSLTRINTLPLYSHITKIDS
FT                   PTAWTLDIHLSQPDRWLPWLLGQVPAMILPREWETLANFASHPIGTGPYAVRRNTPNQL
FT                   KILAFDDYFGYRALIDEVNVWVLPDISEEPACGLMLEGPIQGGEKAIESRLEEGCYYLL
FT                   FDARTPRGAHPQVREWVSHVLSPTNLLYHADEPLQQLWFPAYGLLPRWHHARPGPGEKP
FT                   AGLETLTLTFYREHIEHRVIARIMSALLAEHQVHLHIQEIDYDQWHAGEIESDIWLNSA
FT                   NFTLPLDFSLFAHLCEVPLLQNCIPRDWQGDAAQWRAGEMNLANWCQQLLVNKAIVPLI
FT                   HHWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
FT   gene            122708..122830
FT                   /locus_tag="SPAB_00137"
FT   CDS_pept        122708..122830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00137"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65580"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215091.1"
FT                   /protein_id="ABX65580.1"
FT                   /translation="MRQFWLRYFAATEKTSWLACLSAPQRLKMLAELMQWEATD"
FT   gene            122835..122919
FT                   /locus_tag="SPAB_00138"
FT   misc_RNA        122835..122919
FT                   /locus_tag="SPAB_00138"
FT                   /product="sgrS RNA"
FT                   /note="Rfam score 76.59"
FT                   /inference="nucleotide motif:Rfam:RF00534"
FT   gene            123031..123144
FT                   /locus_tag="SPAB_00139"
FT   CDS_pept        123031..123144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00139"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65581"
FT                   /protein_id="ABX65581.1"
FT                   /translation="MPEYPRHERLMSNQALDGTTLIRPTEYSGNLVILHTL"
FT   gene            complement(123165..123770)
FT                   /locus_tag="SPAB_00140"
FT   CDS_pept        complement(123165..123770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00140"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0110 3.5e-106 leuD; 3-isopropylmalate
FT                   isomerase (dehydratase), subunit with LeuC K01704; COG:
FT                   COG0066 3-isopropylmalate dehydratase small subunit; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65582"
FT                   /inference="protein motif:HMMPfam:IPR000573"
FT                   /inference="protein motif:HMMPIR:IPR012305"
FT                   /inference="protein motif:HMMTigr:IPR004431"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459115.1"
FT                   /protein_id="ABX65582.1"
FT                   /translation="MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPEFVLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVTLSDAQVDEMFALVKANPGIKFEVDLEAQVVKAGDKTYSFK
FT                   IDDFRRHCMLNGLDSIGLTLQHEDAIAEYENKQPAFMR"
FT   gene            complement(123781..125181)
FT                   /locus_tag="SPAB_00141"
FT   CDS_pept        complement(123781..125181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0111 1.1e-251 leuC; 3-isopropylmalate
FT                   isomerase (dehydratase), subunit with LeuD K01703; COG:
FT                   COG0065 3-isopropylmalate dehydratase large subunit; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65583"
FT                   /inference="protein motif:BlastProDom:IPR001030"
FT                   /inference="protein motif:HMMPfam:IPR001030"
FT                   /inference="protein motif:HMMPIR:IPR012095"
FT                   /inference="protein motif:HMMTigr:IPR004430"
FT                   /inference="protein motif:ScanRegExp:IPR001030"
FT                   /inference="protein motif:superfamily:IPR001030"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459116.1"
FT                   /protein_id="ABX65583.1"
FT                   /translation="MAKTLYEKLFDAHVVFEAPNETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHHRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCNEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVTGNAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGDAIRALSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGRDFDEAVEYWKTLKTDDGATFDTVVALRA
FT                   EEIAPQVTWGTNPGQVISVTDIIPDPASFSDPVERASAEKALAYMGLQPGVPLTDVAID
FT                   KVFIGSCTNSRIEDLRAAAEVAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRSIK"
FT   gene            complement(125184..126275)
FT                   /locus_tag="SPAB_00142"
FT   CDS_pept        complement(125184..126275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0108 1.5e-192 leuB; 3-isopropylmalate
FT                   dehydrogenase K00052; COG: COG0473
FT                   Isocitrate/isopropylmalate dehydrogenase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65584"
FT                   /inference="protein motif:Gene3D:IPR013814"
FT                   /inference="protein motif:HMMPanther:IPR001804"
FT                   /inference="protein motif:HMMPfam:IPR001804"
FT                   /inference="protein motif:HMMTigr:IPR004429"
FT                   /inference="protein motif:ScanRegExp:IPR001804"
FT                   /inference="similar to AA sequence:INSD:AAX64014.1"
FT                   /protein_id="ABX65584.1"
FT                   /translation="MSKNYHIAVLPGDGIGPEVMAQALKVMDAVRSRFDMRITTSHYDV
FT                   GGIAIDNHGHPLPKATVEGCEQADAILFGSVGGPKWENLPPESQPERGALLPLRKHFKL
FT                   FSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEKAFD
FT                   TEVYHRFEIERIARIAFESARKRRRKVTSIDKANVLQSSILWREIVNDVAKTYPDVELA
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLALLLRYSLDANDAATAIEQAINRALEEGVRTGDLA
FT                   RGAAAVSTDEMGDIIARYVAEGV"
FT   gene            complement(126275..127846)
FT                   /locus_tag="SPAB_00143"
FT   CDS_pept        complement(126275..127846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0113 1.1e-276 leuA; 2-isopropylmalate
FT                   synthase K01649; COG: COG0119
FT                   Isopropylmalate/homocitrate/citramalate synthases; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65585"
FT                   /db_xref="GOA:A9MZK0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZK0"
FT                   /inference="protein motif:HMMPfam:IPR000891"
FT                   /inference="protein motif:HMMPfam:IPR013709"
FT                   /inference="protein motif:HMMTigr:IPR005671"
FT                   /inference="protein motif:ScanRegExp:IPR002034"
FT                   /inference="similar to AA sequence:INSD:AAL19077.1"
FT                   /protein_id="ABX65585.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSAKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARTIKNSRVCALARCVEKDIDVAAQALKVADAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAVYMVKRARNYTDDVEFSCEDAGRTPVDDLARVVEAAINAGA
FT                   RTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGIAVGNSLAAVHAGA
FT                   RQVEGAMNGIGERAGNCALEEVIMAIKVRKDIMNVHTNINHHEIWRTSQTVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHR
FT                   MEEMGYKDTDYNMDHLYDAFLKLADKKGQVFDYDLEALAFINKQQEEPEHFRLDYFSVQ
FT                   SGSSDIATASVKLACGEEIKAEAANGNGPVDAIYQAINRITGYDVELVKYDLNAKGQGK
FT                   DALGQVDIVVNHHGRRFHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQNKE
FT                   NNKETV"
FT   misc_feature    complement(127887..128034)
FT                   /note="leucine operon leader"
FT                   /inference="nucleotide motif:Rfam:RF00512"
FT   gene            complement(128079..128189)
FT                   /locus_tag="SPAB_00144"
FT   CDS_pept        complement(128079..128189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65586"
FT                   /protein_id="ABX65586.1"
FT                   /translation="MSTRSFILYWTRSPAQLAKVRIRIWSTKCNGDRNQS"
FT   gene            128463..128606
FT                   /locus_tag="SPAB_00145"
FT   CDS_pept        128463..128606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65587"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215099.1"
FT                   /protein_id="ABX65587.1"
FT                   /translation="MRNLNIMNRNGVTQDTLRLRWHSICLCQRLYVFRILTLSLFLILY
FT                   AW"
FT   gene            128596..129621
FT                   /locus_tag="SPAB_00146"
FT   CDS_pept        128596..129621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00146"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0583 Transcriptional regulator; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65588"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:INSD:AAD26693.1"
FT                   /protein_id="ABX65588.1"
FT                   /translation="MHGKSYFQELFLPSARKRELSVTVELNMPEVKTEKPHLLDMGKPQ
FT                   LRMVDLNLLTVFDAVMQEQNITRAAHTLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQ
FT                   PTARAFQLFGSVRQALQLVQNELPGSGFEPTSSERVFNLCVCSPLDNILTSQIYNRVEK
FT                   IAPNIHVVFKASLNQNTEHQLRYQETEFVISYEEFRRPEFTSVPLFKDEMVLVASRKHP
FT                   RISGPLLEGDVYNEQHAVVSLDRYASFSQPWYDTADKQSSVAYQGMALISVLNVVSQTH
FT                   LVAIAPRWLAEEFAESLDLQILPLPLKLNSRTCYLSWHEAAGRDKGHQWMEDLLVSVCK
FT                   R"
FT   gene            129967..131667
FT                   /locus_tag="SPAB_00147"
FT   CDS_pept        129967..131667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00147"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0118 0. ilvI; acetolactate synthase
FT                   isozyme III large subunit K01652; COG: COG0028 Thiamine
FT                   pyrophosphate-requiring enzymes [acetolactate synthase,
FT                   pyruvate dehydrogenase (cytochrome), glyoxylate
FT                   carboligase, phosphonopyruvate decarboxylase]"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65589"
FT                   /inference="protein motif:HMMPfam:IPR011766"
FT                   /inference="protein motif:HMMPfam:IPR012000"
FT                   /inference="protein motif:HMMPfam:IPR012001"
FT                   /inference="protein motif:HMMPIR:IPR000399"
FT                   /inference="protein motif:HMMPIR:IPR004407"
FT                   /inference="protein motif:HMMTigr:IPR012846"
FT                   /inference="protein motif:ScanRegExp:IPR000399"
FT                   /protein_id="ABX65589.1"
FT                   /translation="MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQA
FT                   AVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVATSLIGYDA
FT                   FQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILNPAKK
FT                   MPYAWPETVSMRSYNPTTSGHKGQIKRALQTLASAKKPVVYVGGGAISAACYAPLRHII
FT                   ETFNLPVVSSLMGLGAFPATHRQSLGMLGMHGTYEANMTMHNADVIFAVGVRFDDRTTN
FT                   NLAKYCPNATVLHIDIDPTSISKTVNADIPVVGDARLVLEQMLELLAQDAPSQPQDDIR
FT                   DWWQQIEIWRARQCLKYDAESESIKPQAVIETLWRLTKGDAYVTSDVGQHQMFAALYYP
FT                   FDKPRRWINSGGLGTMGFGLPAALGVKMALPKEMVVCVTGDGSIQMNIQELSTALQYEL
FT                   PVLVLNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGLQINRPDELE
FT                   SKLSEALEHVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
FT   gene            131667..132161
FT                   /locus_tag="SPAB_00148"
FT   CDS_pept        131667..132161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0114 2.8e-79 ilvH; acetolactate synthase
FT                   III, small subunit K01653; COG: COG0440 Acetolactate
FT                   synthase, small (regulatory) subunit; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00148"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65590"
FT                   /inference="protein motif:BlastProDom:IPR004789"
FT                   /inference="protein motif:HMMPfam:IPR002912"
FT                   /inference="protein motif:HMMTigr:IPR004789"
FT                   /inference="similar to AA sequence:INSD:AAV76152.1"
FT                   /protein_id="ABX65590.1"
FT                   /translation="MMRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLS
FT                   RMTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGREEVKR
FT                   NTEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVVGLSRGDKIM
FT                   R"
FT   gene            132168..132344
FT                   /locus_tag="SPAB_00149"
FT   CDS_pept        132168..132344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00149"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65591"
FT                   /protein_id="ABX65591.1"
FT                   /translation="MPDDDARAFYPVYRLISGPGPISVTPSGRFAGYQPTGIIAQPNIT
FT                   GWAFFCEIRGNPE"
FT   gene            132445..133449
FT                   /locus_tag="SPAB_00150"
FT   CDS_pept        132445..133449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EF1922 6.4e-07 transcriptional regulator,
FT                   LacI family/carbohydrate kinase, PfkB family protein
FT                   K00852; COG: COG1609 Transcriptional regulators; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65592"
FT                   /inference="protein motif:HMMPfam:IPR000843"
FT                   /inference="protein motif:HMMPfam:IPR001761"
FT                   /inference="protein motif:HMMSmart:IPR000843"
FT                   /inference="protein motif:HMMTigr:IPR012781"
FT                   /inference="protein motif:ScanRegExp:IPR000843"
FT                   /inference="protein motif:superfamily:IPR010982"
FT                   /inference="similar to AA sequence:INSD:AAL19082.1"
FT                   /protein_id="ABX65592.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVNFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDHELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIRRNLYRRGILSRS"
FT   gene            133892..134029
FT                   /locus_tag="SPAB_00151"
FT   CDS_pept        133892..134029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65593"
FT                   /protein_id="ABX65593.1"
FT                   /translation="MRAGRKLINADIRRKHWLFYFGKRCDLLDKLFLRSVNSFEWEFVG
FT                   "
FT   gene            complement(133910..134056)
FT                   /locus_tag="SPAB_00153"
FT   CDS_pept        complement(133910..134056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00153"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65595"
FT                   /protein_id="ABX65595.1"
FT                   /translation="MPVSPLLTTLSHKFPLEGVYGAEEKLVKQVTTLTEVKKPMFTANI
FT                   CVD"
FT   gene            134055..134513
FT                   /locus_tag="SPAB_00152"
FT   CDS_pept        134055..134513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00152"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2001 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65594"
FT                   /db_xref="GOA:A9MZL0"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZL0"
FT                   /inference="protein motif:BlastProDom:IPR003444"
FT                   /inference="protein motif:HMMPfam:IPR003444"
FT                   /inference="protein motif:HMMTigr:IPR003444"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZRU9"
FT                   /protein_id="ABX65594.1"
FT                   /translation="MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQDLSL"
FT   gene            134515..135456
FT                   /locus_tag="SPAB_00154"
FT   CDS_pept        134515..135456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0120 6.3e-162 yabC; putative S-adenosyl
FT                   methionine adenyltransferase K03438; COG: COG0275 Predicted
FT                   S-adenosylmethionine-dependent methyltransferase involved
FT                   in cell envelope biogenesis; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65596"
FT                   /db_xref="GOA:A9MZL1"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZL1"
FT                   /inference="protein motif:BlastProDom:IPR002903"
FT                   /inference="protein motif:HMMPanther:IPR002903"
FT                   /inference="protein motif:HMMPfam:IPR002903"
FT                   /inference="protein motif:HMMTigr:IPR002903"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZRU8"
FT                   /protein_id="ABX65596.1"
FT                   /translation="MMENFKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAQTINDPRFSIIHGPFSALADYVAERELTGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTFGEERFAKR
FT                   IARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLSVLAPGGRLSIISFHSLEDRIVKRFMREQSRGPQIPAGLPMTEAQLKKLGGREL
FT                   RALGKLMPGEKEVAENPRARSSVLRIAERTNA"
FT   gene            135609..135818
FT                   /locus_tag="SPAB_00155"
FT   CDS_pept        135609..135818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00155"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3116 Cell division protein; Psort location:
FT                   CytoplasmicMembrane, score:8.02"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65597"
FT                   /inference="protein motif:HMMPfam:IPR007082"
FT                   /inference="protein motif:HMMTigr:IPR011922"
FT                   /inference="similar to AA sequence:INSD:ABF02362.1"
FT                   /protein_id="ABX65597.1"
FT                   /translation="MVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRV
FT                   ERIATEKLQMQHVDPSQENIVVQK"
FT   gene            135834..137600
FT                   /locus_tag="SPAB_00156"
FT   CDS_pept        135834..137600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0126 0. ftsI; penicillin-binding protein
FT                   3 precursor K03587; COG: COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65598"
FT                   /inference="protein motif:HMMPfam:IPR001460"
FT                   /inference="protein motif:HMMPfam:IPR005311"
FT                   /inference="protein motif:superfamily:IPR005311"
FT                   /inference="protein motif:superfamily:IPR012338"
FT                   /protein_id="ABX65598.1"
FT                   /translation="MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWL
FT                   QIIAPDMLVRQGDMRSLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALSTALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLAGTPKDAMRNRTITDVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERI
FT                   FPESTVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGEKNEF
FT                   VINQGEGTGGRS"
FT   gene            137587..139074
FT                   /locus_tag="SPAB_00157"
FT   CDS_pept        137587..139074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0123 2.4e-263 murE;
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase K01928; COG: COG0769
FT                   UDP-N-acetylmuramyl tripeptide synthase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65599"
FT                   /inference="protein motif:HMMPfam:IPR000713"
FT                   /inference="protein motif:HMMPfam:IPR004101"
FT                   /inference="protein motif:HMMPfam:IPR013221"
FT                   /inference="protein motif:HMMPIR:IPR012237"
FT                   /inference="protein motif:HMMTigr:IPR005761"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459128.1"
FT                   /protein_id="ABX65599.1"
FT                   /translation="MADRNLRDLLAPWVAGLPARELREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKDEASDGEIREMHGVPVVYLSQLNERLSALAGRFYHE
FT                   PSENMRLVAVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAV
FT                   DVQHVLASLVAQGATFGAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMAHYE
FT                   AAKWMLYSTHHHGQAIVNADDEVGRRWLASLPDAVAVSMEGHINPNCHGRWLKAEAVEY
FT                   HDRGATIRFASSWGDGEIESRLMGAFNVSNLLLALATLLALGYPLTDLLKTAARLQPVC
FT                   GRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADIVVVTDDNPRTEEPRAIINDILAGMLDAGQVRVMEGRAEAVTNAIMQAKDN
FT                   DVVLIAGKGHEDYQIVGTQRLDYSDRVTAARLLGVIA"
FT   gene            139071..140429
FT                   /locus_tag="SPAB_00158"
FT   CDS_pept        139071..140429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0126 4.2e-236 murF;
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diami
FT                   nopimelate--D-alan alanyl ligase K01929; COG: COG0770
FT                   UDP-N-acetylmuramyl pentapeptide synthase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65600"
FT                   /inference="protein motif:HMMPfam:IPR000713"
FT                   /inference="protein motif:HMMPfam:IPR004101"
FT                   /inference="protein motif:HMMPfam:IPR013221"
FT                   /inference="protein motif:HMMPIR:IPR012237"
FT                   /inference="protein motif:HMMTigr:IPR005863"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149471.1"
FT                   /protein_id="ABX65600.1"
FT                   /translation="MISVTLSKIADVLGAEHRGADLTLDTVITDTRKVTPGCLFVALKG
FT                   ERFDAHDFADKAKANGAGALLVSRPLDIDLPQVIVKDTRQAFGQLAAWVRMQVPARVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTAGNFNNDIGVPITLLRLNHDYDYAVIELGANH
FT                   QGEIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIYTGLPENGIAIMNADNN
FT                   DWLNWQSIIGDRQVWRFSPNAANSDFTAANIHVTSHGTEFTLQTPMGSIDVLLPLPGRH
FT                   NIANALAAAALSMAVGATLTAVKAGLAALKAVPGRLFPIQLSENQLVLDDAYNANVGSM
FT                   TAAVQVLSEMPGYRVLVVGDMAELGAESEACHIQVGEAAKAAGIDRVLSTGKLSQAISH
FT                   ASGVGEHFADKAALIARLHALLQEQPMMTILVKGSRSAAMEDVVHALQEKGSC"
FT   gene            140423..141505
FT                   /locus_tag="SPAB_00159"
FT   CDS_pept        140423..141505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY0145 4.0e-192 mraY;
FT                   phospho-N-acetylmuramoyl-pentapeptide- transferase K01000;
FT                   COG: COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65601"
FT                   /db_xref="GOA:A9MZL6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZL6"
FT                   /inference="protein motif:HMMPanther:IPR003524"
FT                   /inference="protein motif:HMMPfam:IPR000715"
FT                   /inference="protein motif:HMMTigr:IPR003524"
FT                   /inference="protein motif:ScanRegExp:IPR003524"
FT                   /inference="similar to AA sequence:INSD:CAD01282.1"
FT                   /protein_id="ABX65601.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   ARLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVV
FT                   LIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQLVVP
FT                   FFKDVMPQLGLFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNM
FT                   NFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            141508..142824
FT                   /locus_tag="SPAB_00160"
FT   CDS_pept        141508..142824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0128 2.8e-230 murD;
FT                   UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase K01925;
FT                   COG: COG0771 UDP-N-acetylmuramoylalanine-D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65602"
FT                   /inference="protein motif:HMMPfam:IPR004101"
FT                   /inference="protein motif:HMMPfam:IPR013221"
FT                   /inference="protein motif:HMMPIR:IPR012237"
FT                   /inference="protein motif:HMMTigr:IPR005762"
FT                   /inference="protein motif:ScanRegExp:IPR006162"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149473.1"
FT                   /protein_id="ABX65602.1"
FT                   /translation="MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLD
FT                   KLPQDVERHVGGLNDEWLLAADLIVASPGIALAHPSLSAAASAGVEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDADRELYVLELSSFQ
FT                   LETTSSLQAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVR
FT                   GADERCVSFGVNMGDYHLNRQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALAD
FT                   AVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHVDGTL
FT                   HLLLGGDGKSADFSPLARYLTGDRIRLYCFGRDGAQLAALRPEIAQQTETMEEAMRLLA
FT                   PRVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKELG"
FT   gene            142824..144068
FT                   /locus_tag="SPAB_00161"
FT   CDS_pept        142824..144068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00161"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0772 Bacterial cell division membrane
FT                   protein; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65603"
FT                   /inference="protein motif:HMMPfam:IPR001182"
FT                   /inference="protein motif:HMMTigr:IPR013437"
FT                   /inference="protein motif:ScanRegExp:IPR001182"
FT                   /inference="similar to AA sequence:INSD:AAO67863.1"
FT                   /protein_id="ABX65603.1"
FT                   /translation="MRLSLPRLRMPRVPGFGLLAWLFAALKGWVMASRDKDADSLIMYD
FT                   RTLLWLTFGLAAIGFVMVTSASMPVGQRLANDPFLFAKRDALYIFLAFCLAMVTLRLPM
FT                   TFWQKYSTTMLIASIIMLLIVLVVGSSVNGASRWIALGPLRIQPAEFTKLSLFCYLANY
FT                   LVRKVDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVILLILAEPYRIRRVTSFWNPWEDPFGSGYQLTQSLMAFGRGEIWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYIGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMFLLRIDY
FT                   ETRLEKAQAFTRGSR"
FT   gene            144065..145132
FT                   /locus_tag="SPAB_00162"
FT   CDS_pept        144065..145132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0128 1.2e-188 murG;
FT                   UDP-N-acetylglucosamine:N-acetylmuramyl- (pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
FT                   K02563; COG: COG0707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase; Psort location:
FT                   CytoplasmicMembrane, score:9.59"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65604"
FT                   /db_xref="GOA:A9MZL9"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZL9"
FT                   /inference="protein motif:HMMPfam:IPR004276"
FT                   /inference="protein motif:HMMPfam:IPR007235"
FT                   /inference="protein motif:HMMTigr:IPR006009"
FT                   /protein_id="ABX65604.1"
FT                   /translation="MSGQPKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRM
FT                   EADLVPKHGIDIDFIRISGLRGKGVKALLAAPLRIFNAWRQARAIMKRFKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATTVMQAFPGAFPNAEVVGNPVR
FT                   TDVLALPLPQVRLAGRDGPIRVLVVGGSQGARVLNQTMPQVAARLGDTVTIWHQSGKGA
FT                   QLTVEQAYAGAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPAIFVPF
FT                   QHKDRQQYWNALPLENAGAAKIFEQPQFTVEAVADTLAGWSREALLTMAERARAVSIPD
FT                   ATERVASEVSRVART"
FT   gene            145251..146726
FT                   /locus_tag="SPAB_00163"
FT   CDS_pept        145251..146726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0129 2.2e-262 murC;
FT                   UDP-N-acetylmuramate--alanine ligase K01924; COG: COG0773
FT                   UDP-N-acetylmuramate-alanine ligase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65605"
FT                   /db_xref="GOA:A9MZM0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZM0"
FT                   /inference="protein motif:HMMPfam:IPR000713"
FT                   /inference="protein motif:HMMPfam:IPR004101"
FT                   /inference="protein motif:HMMPfam:IPR013221"
FT                   /inference="protein motif:HMMPIR:IPR012237"
FT                   /inference="protein motif:HMMTigr:IPR005758"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459134.1"
FT                   /protein_id="ABX65605.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLTSLGATIFFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQGMPD
FT                   LHVTLNAPGRHNALNAAAAVAVATEEGIADDAILRALESFQGTGRRFDFLGEFPLEPVN
FT                   GKAGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRYTRTRDLYDDFANVLT
FT                   QVDALLMLDVYPAGEAPIPGADSRSLCRTIRNRGKIDPILVSDPAQVATMLAPVLTGND
FT                   LILVQGAGNVGKIARYLSEIKLKPQIQEEEQHG"
FT   gene            146719..147639
FT                   /locus_tag="SPAB_00164"
FT   CDS_pept        146719..147639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0130 3.2e-158 ddlB; D-alanine-D-alanine
FT                   ligase B, affects cell division K01921; COG: COG1181
FT                   D-alanine-D-alanine ligase and related ATP-grasp enzymes;
FT                   Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65606"
FT                   /inference="protein motif:Gene3D:IPR013816"
FT                   /inference="protein motif:Gene3D:IPR013817"
FT                   /inference="protein motif:HMMPfam:IPR011095"
FT                   /inference="protein motif:HMMPfam:IPR011127"
FT                   /inference="protein motif:HMMTigr:IPR005905"
FT                   /inference="protein motif:ScanRegExp:IPR000291"
FT                   /inference="similar to AA sequence:INSD:AAL19094.1"
FT                   /protein_id="ABX65606.1"
FT                   /translation="MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGINAHPVDPQEV
FT                   DVAQLKAMGFQKAFIALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLW
FT                   QGAGLPVAPWVALTRAEFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEENAL
FT                   QGALSLAFQHDDEILIEKWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLSDETQ
FT                   YFCPAGLEASQEAALQSLVLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSFSQLVVRILELAD"
FT   gene            147641..148471
FT                   /locus_tag="SPAB_00165"
FT   CDS_pept        147641..148471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_0415 1.3e-07 D-alanine--D-alanine
FT                   ligase K01921; COG: COG1589 Cell division septal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65607"
FT                   /inference="protein motif:HMMPfam:IPR005548"
FT                   /inference="protein motif:HMMPfam:IPR013685"
FT                   /inference="similar to AA sequence:INSD:CAD01288.1"
FT                   /protein_id="ABX65607.1"
FT                   /translation="MSQAALNTRNSDEETPSSRRNNGTRLAGILFLLTVLCTVFVSGWV
FT                   VLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQAILALGAPGTFMTQDVNIIQSQIERLP
FT                   WIKQASVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPSDRIGKQVLPMLYGP
FT                   EGSASEVLQGYREMGQVLAKDKFTLKEAAMTARRSWQLTLNNGIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESNQQQNQAQAEQQ"
FT   gene            148468..149730
FT                   /locus_tag="SPAB_00166"
FT   CDS_pept        148468..149730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00166"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hpa:HPAG1_1318 8.1e-05 rod shape-determining
FT                   protein K01529; COG: COG0849 Actin-like ATPase involved in
FT                   cell division; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65608"
FT                   /inference="protein motif:HMMPfam:IPR003494"
FT                   /inference="protein motif:HMMTigr:IPR003494"
FT                   /inference="similar to AA sequence:INSD:AAO67868.1"
FT                   /protein_id="ABX65608.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   gene            149792..150943
FT                   /locus_tag="SPAB_00167"
FT   CDS_pept        149792..150943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0104 7.0e-195 ftsZ; cell division;
FT                   forms circumferential ring; tubulin-like GTP-binding
FT                   protein and GTPase K03531; COG: COG0206 Cell division
FT                   GTPase; Psort location: CytoplasmicMembrane, score:9.59"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65609"
FT                   /inference="protein motif:HMMPfam:IPR003008"
FT                   /inference="protein motif:HMMPfam:IPR008280"
FT                   /inference="protein motif:HMMTigr:IPR000158"
FT                   /inference="protein motif:ScanRegExp:IPR000158"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149480.1"
FT                   /protein_id="ABX65609.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVLDRYQ
FT                   QHGMAPLTQEQKTVAKVVNDNTPQAAKEPDYLDIPAFLRKQAD"
FT   gene            151044..151961
FT                   /locus_tag="SPAB_00168"
FT   CDS_pept        151044..151961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0134 9.0e-163 lpxC; UDP-3-O-acyl
FT                   N-acetylglucosamine deacetylase K02535; COG: COG0774
FT                   UDP-3-O-acyl-N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65610"
FT                   /db_xref="GOA:A9MZM5"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZM5"
FT                   /inference="protein motif:BlastProDom:IPR004463"
FT                   /inference="protein motif:HMMPfam:IPR004463"
FT                   /inference="protein motif:HMMTigr:IPR004463"
FT                   /inference="similar to AA sequence:INSD:AAL19098.1"
FT                   /protein_id="ABX65610.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIM
FT                   DGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVEDGDKWAEFRPYNGFTLDFTIDFNH
FT                   PAIDSSSQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEFVTFQDDAELPLAFKAPSTVLA"
FT   gene            152240..152737
FT                   /locus_tag="SPAB_00169"
FT   CDS_pept        152240..152737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00169"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG07871 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65611"
FT                   /db_xref="GOA:A9MZM6"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZM6"
FT                   /inference="protein motif:HMMPfam:IPR009502"
FT                   /inference="similar to AA sequence:SwissProt:Q5PDD0"
FT                   /protein_id="ABX65611.1"
FT                   /translation="MSGILTRWRQLGRRYFWPHLLLGMVAASFGLPALSNAAETNTPAR
FT                   TTASTASKVNFSHLALLEASNRRPNFTVDYWHQHAIRTVIRHLSFAMAPQTLPVADAPS
FT                   PLQAHHIALLNTLSAMLTQEGTPPAIVRRLSLAYFAPQTAFSIPAWISQAQGIRAGPQR
FT                   LS"
FT   gene            152799..155504
FT                   /locus_tag="SPAB_00170"
FT   CDS_pept        152799..155504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN4477 0. secA; preprotein translocase
FT                   SecA subunit; COG: COG0653 Preprotein translocase subunit
FT                   SecA (ATPase, RNA helicase); Psort location:
FT                   CytoplasmicMembrane, score:9.59"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65612"
FT                   /db_xref="GOA:A9MZM7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZM7"
FT                   /inference="protein motif:HMMPfam:IPR004027"
FT                   /inference="protein motif:HMMPfam:IPR011115"
FT                   /inference="protein motif:HMMPfam:IPR011116"
FT                   /inference="protein motif:HMMPfam:IPR011130"
FT                   /inference="protein motif:HMMTigr:IPR000185"
FT                   /inference="protein motif:ScanRegExp:IPR000185"
FT                   /protein_id="ABX65612.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKAVSLINAMEPEMEKLSDDELKA
FT                   KTNEFRARIEKGESVESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEMRT
FT                   GEGKTLTATLPAYLNALSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMSVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKKVNKIIPHLIRQEKEDSDTFQGEGHFSVDEKARQVNLTERGLVL
FT                   IEELLVQEGIMDEGESLYSPGNIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVEIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTANGQPVLVGTIS
FT                   IEKSEVVSRELTKAGIKHNVLNAKFHANEAGIVAQAGYPAAVTIATNMAGRGTDIMLGG
FT                   SWQAEVAALEAPTEEQIAQIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYTQRNELLDVSDVSDTINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLELPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFAMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEAMEMQRREEAERLAQMQQLSHQDDDAAVAADLA
FT                   AQTGERKIGRNDPCPCGSGKKYKQCHGRLS"
FT   gene            155656..156051
FT                   /locus_tag="SPAB_00171"
FT   CDS_pept        155656..156051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0141 5.4e-69 mutT;
FT                   7,8-dihydro-8-oxoguanine-triphosphatase K03574; COG:
FT                   COG0494 NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65613"
FT                   /inference="protein motif:Gene3D:IPR000086"
FT                   /inference="protein motif:HMMPfam:IPR000086"
FT                   /inference="protein motif:HMMTigr:IPR003561"
FT                   /inference="protein motif:ScanRegExp:IPR000086"
FT                   /inference="protein motif:superfamily:IPR000086"
FT                   /inference="similar to AA sequence:INSD:CAD01294.1"
FT                   /protein_id="ABX65613.1"
FT                   /translation="MKKLQIAVGIIRNPNDEIFITRRAADAHMANKLEFPGGKIEADET
FT                   PEQALIRELQEEVGITPTQVTLFDTLEYQFPDRHITLWFWLVERWEGEPWGKEGQPGRW
FT                   IAQNALNTDDFPPANEPIIRKLRQFAP"
FT   gene            156192..156368
FT                   /locus_tag="SPAB_00172"
FT   CDS_pept        156192..156368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00172"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65614"
FT                   /inference="similar to AA sequence:INSD:CAD01296.1"
FT                   /protein_id="ABX65614.1"
FT                   /translation="MITRQGFLAQWRLRFCYSLISPVYWYYPGRAHMAPKLRVFIDYFC
FT                   HKAILPSQQSYHR"
FT   gene            complement(156365..156556)
FT                   /locus_tag="SPAB_00173"
FT   CDS_pept        complement(156365..156556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1027 3.4e-05 ribonuclease G;
FT                   COG: COG3024 Uncharacterized protein conserved in bacteria;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65615"
FT                   /db_xref="GOA:A9MZN0"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZN0"
FT                   /inference="protein motif:HMMPfam:IPR005584"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215124.1"
FT                   /protein_id="ABX65615.1"
FT                   /translation="MSDVTVVNCPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIASSGDQSDSDDWSEER"
FT   gene            complement(156566..157267)
FT                   /locus_tag="SPAB_00174"
FT   CDS_pept        complement(156566..157267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00174"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4582 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65616"
FT                   /inference="protein motif:HMMPfam:IPR009777"
FT                   /inference="similar to AA sequence:SwissProt:P67693"
FT                   /protein_id="ABX65616.1"
FT                   /translation="MRTWLRIEFLIQQLSINLPIADHAGALHFFRNISDLLDVFERGEV
FT                   RTELLKELERQQRKLQAWVEVPGVDQDRIEALRQQLKSAGSVLISAPRIGQQLREDRLI
FT                   ALVRQRLSIPGGCCSFDLPTLHIWLHLQQAQRDAQIESWLASLNPLTQALTLVLDLIRN
FT                   SAPFRKQTSLNGFYQDNGDDADLLRLMLTLDSQLYPQISGHKSRFAIRFMPLDSENGLV
FT                   PERLDFELACC"
FT   gene            complement(157309..157929)
FT                   /locus_tag="SPAB_00175"
FT   CDS_pept        complement(157309..157929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY0162 4.6e-104 yacE; dephospho-CoA
FT                   kinase K00859; COG: COG0237 Dephospho-CoA kinase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65617"
FT                   /inference="protein motif:BlastProDom:IPR001977"
FT                   /inference="protein motif:HMMPanther:IPR001977"
FT                   /inference="protein motif:HMMPfam:IPR001977"
FT                   /inference="protein motif:HMMTigr:IPR001977"
FT                   /inference="protein motif:ScanRegExp:IPR001977"
FT                   /inference="similar to AA sequence:SwissProt:P63829"
FT                   /protein_id="ABX65617.1"
FT                   /translation="MRYTVALTGGIGSGKSTVADAFADLGITVIDADIIARQMVEPGQP
FT                   ALNAIAEHFGSELIAADGTLRRRALRERIFSHPEEKAWLNALLHPLIQQETQRQFQQAT
FT                   SPYVLWVVPLLVENRLYQKANRVLVVDVTPETQLIRTMQRDDVTREHVEHILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHASYLKLASQFVSQEKP"
FT   gene            158155..159198
FT                   /locus_tag="SPAB_00176"
FT   CDS_pept        158155..159198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0141 1.2e-183 guaC; GMP reductase
FT                   K00364; COG: COG0516 IMP dehydrogenase/GMP reductase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00176"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65618"
FT                   /db_xref="GOA:A9MZN3"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZN3"
FT                   /inference="protein motif:HMMPfam:IPR001093"
FT                   /inference="protein motif:HMMTigr:IPR005993"
FT                   /inference="protein motif:ScanRegExp:IPR001093"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459146.1"
FT                   /protein_id="ABX65618.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQTWS
FT                   GVPIIAANMDTVGTFEMAQALAGFDILTAVHKHYTVEEWAAFINTASADVLKHVMVSTG
FT                   TSDADFEKTVQILALDPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVSDGGC
FT                   TMPGDVAKAFGGGADFVMLGGMLAGHEESGGSVVEENGEKFMLFYGMSSESAMNRHVGG
FT                   VAKYRAAEGKTVKLPLRGPVGNTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRIFNSL"
FT   gene            complement(159229..160431)
FT                   /locus_tag="SPAB_00177"
FT   CDS_pept        complement(159229..160431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00177"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1459 Type II secretory pathway, component
FT                   PulF; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65619"
FT                   /inference="protein motif:FPrintScan:IPR003004"
FT                   /inference="protein motif:HMMPfam:IPR001992"
FT                   /inference="protein motif:superfamily:IPR011028"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459147.1"
FT                   /protein_id="ABX65619.1"
FT                   /translation="MSVKQLWRWQGVNDKGQLEQGVVWVDNRLALIITLQHQRIMPLRI
FT                   KRMGVNAALWKEEQSAEIIHQLATLIHAGLTLSEGLELLAQQHPHRQWQALLRTLAHEL
FT                   EQGVPFSSALVSWPQVFPPLYQTMIRTGELTGKLAECCFELARQQKAQRQITVSVKKAL
FT                   RYPAIILTMAALVVFAMLHFVLPEFAAIYRSFNTPLPLLTRGIIAIAQWGSAWGWLILF
FT                   LAMLVAIAHRRVKQKPSWQAQRQRLLLRLPVMGRLIRGQKLAQIFTVLALTQSAGIPFL
FT                   QGLESAIDSLGCPYWSQRLTQVHQEIAAGNPVWLALKNTQEFSPLCLQLVRTGEASGSL
FT                   DIMLHNLARHHSETTLALADNLASLLEPALLIITGLIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   gene            complement(160421..161806)
FT                   /locus_tag="SPAB_00178"
FT   CDS_pept        complement(160421..161806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN2333 1.2e-80 xcpR-2; type II
FT                   secretion pathway protein E K01509; COG: COG2804 Type II
FT                   secretory pathway, ATPase PulE/Tfp pilus assembly pathway,
FT                   ATPase PilB; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65620"
FT                   /inference="protein motif:BlastProDom:IPR001482"
FT                   /inference="protein motif:HMMPfam:IPR001482"
FT                   /inference="protein motif:HMMPfam:IPR007831"
FT                   /inference="protein motif:ScanRegExp:IPR001482"
FT                   /inference="similar to AA sequence:INSD:AAX64048.1"
FT                   /protein_id="ABX65620.1"
FT                   /translation="MKDAQLNTLCQRHQAVLINSASNSITVAVVDAPSHALLDALHFAT
FT                   QKQIDIVCWTRQQMENHRHKPDQAPSANAAKGGETAAQLLNQTLRSAMAKRASDIHLEP
FT                   GASRYRIRLRIDGVLHILQDIAKETGLALTARLKVLGNLDIAEHRLPQDGQFTVDLAGD
FT                   SISFRIATLPCKEGEKVVLRLLHQVEQTLDLDTLGMYGAQLTAFRQALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQTRNMPGINLCSVEDPIEIPLDGINQTQIHPRAGLTFQNVLRALL
FT                   RQDPDIIMVGEIRDGDTAEIAIKAAQTGHLVLSTLHTNSTSETLIRLQQMGVARWMISS
FT                   ALTLVVAQRLVRKLCPHCKQRLSDPVVLSPNLWPSALPRWQASGCQHCYHGFYGRTALF
FT                   EVLTVTPTLRQLIASGASAQALEAHLQQTGTGTLFENGCRAVEQGMTSFEEILRVLGMP
FT                   HER"
FT   gene            complement(161816..162253)
FT                   /locus_tag="SPAB_00179"
FT   CDS_pept        complement(161816..162253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00179"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4969 Tfp pilus assembly protein, major pilin
FT                   PilA"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65621"
FT                   /inference="protein motif:BlastProDom:IPR001082"
FT                   /inference="protein motif:HMMPfam:IPR012902"
FT                   /inference="protein motif:HMMTigr:IPR012902"
FT                   /inference="protein motif:ScanRegExp:IPR001120"
FT                   /inference="similar to AA sequence:INSD:AAV76181.1"
FT                   /protein_id="ABX65621.1"
FT                   /translation="MEKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGTSTCDAGVNGIPSPVITRYVSGMSVEKGVITLTGQESLSGLN
FT                   VIMTPAWDNANGIIGWTRNCNIQSDSALQQACEDVFRFDAN"
FT   gene            complement(162279..162461)
FT                   /locus_tag="SPAB_00180"
FT   CDS_pept        complement(162279..162461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65622"
FT                   /protein_id="ABX65622.1"
FT                   /translation="MALRRRVYKSPVRRSASLFGKIFVAPRNNVAVSCNAAKIFRIRLP
FT                   VLPFAARPLFPRLPQ"
FT   gene            complement(162475..163410)
FT                   /locus_tag="SPAB_00181"
FT   CDS_pept        complement(162475..163410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0144 1.9e-162 nadC; quinolinate
FT                   phosphoribosyltransferase K00767; COG: COG0157
FT                   Nicotinate-nucleotide pyrophosphorylase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65623"
FT                   /inference="protein motif:BlastProDom:IPR002638"
FT                   /inference="protein motif:HMMPfam:IPR002638"
FT                   /inference="protein motif:HMMTigr:IPR004393"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215131.1"
FT                   /protein_id="ABX65623.1"
FT                   /translation="MFLPYDSLAIWSFIMPPRRYNPDDRRDALLERINLDIPAAVAQAL
FT                   REDLGGEVDAGNDITAQLLPADTQAHATVITREDGVFCGKRWVEEVFIQLAGDDVRLTW
FT                   HVDDGDAIYANQTVFELNGPARVLLTGERTALNFVQTLSGVASEVRRYVGLLAGTQTQL
FT                   LDTRKTLPGLRTALKYAVLCGGGANHRLGLTDAFLIKENHIIASGSVRQAVEKAFWLHP
FT                   DVPVEVEVENLNELDDALKAGADIIMLDNFNTDQMREAVKRVNGQARLEVSGNVTAETL
FT                   REFAETGVDFISVGALTKHVRALDLSMRFC"
FT   gene            163456..164019
FT                   /locus_tag="SPAB_00182"
FT   CDS_pept        163456..164019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0118 8.3e-89 ampD; AmpD protein
FT                   K03806; COG: COG3023 Negative regulator of beta-lactamase
FT                   expression; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00182"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65624"
FT                   /inference="protein motif:HMMPfam:IPR002502"
FT                   /inference="protein motif:HMMSmart:IPR002502"
FT                   /inference="similar to AA sequence:INSD:AAX64051.1"
FT                   /protein_id="ABX65624.1"
FT                   /translation="MLPDKGWLVEARRVPSPHYDCRPDDEKPSLLVVHNISLPPGEFGG
FT                   PWIDALFTGTIDPDAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSNYQG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRTLIACYPAIADNMTGHCNIAPDRKT
FT                   DPGPAFDWPRFRALVALSSHKEMT"
FT   gene            164016..164870
FT                   /locus_tag="SPAB_00183"
FT   CDS_pept        164016..164870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0119 3.0e-130 ampE; AmpE K03807;
FT                   COG: COG3725 Membrane protein required for beta-lactamase
FT                   induction; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65625"
FT                   /inference="similar to AA sequence:INSD:AAL19111.1"
FT                   /protein_id="ABX65625.1"
FT                   /translation="MTLFTTLLVLIVERLFKLGEHWQLDHRLEALFRRITHFSMLRTMG
FT                   MTAIAMVVTFLLLQALKGLLFNVPTLVVWILLGVLCIGAGKVRVHYHAWLKAASRNDPH
FT                   PCEAMASELTLIHGVPPDCNEREFLRELQNALLWINFRFYLAPLFWFIVGGPWGPVTLV
FT                   GYAFLRAWQTWLARYQTPHQRLQSGIDAILHVLDWIPVRLAGVVYALLGHGEKALPAWF
FT                   ASLADLHTSQYQVLTRLAQFSLAREPHTDKVETPKAAVSMAKKASFVVVVIIALLTIYG
FT                   ALV"
FT   gene            complement(164962..165912)
FT                   /locus_tag="SPAB_00184"
FT   CDS_pept        complement(164962..165912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00184"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_0777 2.6e-101 ribosomal protein L11
FT                   methyltransferase K01209; COG: COG3940 Predicted
FT                   beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65626"
FT                   /inference="protein motif:HMMPfam:IPR006710"
FT                   /inference="similar to AA sequence:INSD:AAL19112.1"
FT                   /protein_id="ABX65626.1"
FT                   /translation="MANWPNPFIEQRADPFILRDGSDYYFIASVPEYDRLEIRRADSLE
FT                   GLRAADPVVVWRKPKTGPMSQLIWAPEMHRINGKWYIYFAATHTQALDKLGMFQHRMFA
FT                   LECADADPLTGKWTEKGQIKTSFDTFALDATTFYHQGKQWYLWAQKAPDIAGNSNIYLA
FT                   ELENPWTIKGEPVRLSKPEYDWECRGFWVNEGPAVLAHGDKLFISYSASATDENYCMGL
FT                   LWINVNDDPRDPANWHKSPRPVFTTSYENRQYGPGHNSFTQTPEGEDVLVYHARNYTEI
FT                   EGDPLYDPNRHTRLKRVRWDENGMPDFGVPPADTI"
FT   gene            complement(165912..167318)
FT                   /locus_tag="SPAB_00185"
FT   CDS_pept        complement(165912..167318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4210 1.3e-113 yicJ; hypothetical
FT                   symporter YicJ K03292; COG: COG2211 Na+/melibiose symporter
FT                   and related transporters; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65627"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="protein motif:HMMTigr:IPR001927"
FT                   /inference="similar to AA sequence:INSD:AAX64054.1"
FT                   /protein_id="ABX65627.1"
FT                   /translation="MDKGRLSVREKIGYGMGDAGCNIIFGAIMLFVNYFYTDIFGLAPA
FT                   LVGVLLLSVRVIDAVTDPVMGALADRTQSKYGRFRPWLLWIAFPYALFSVLMFTTPDWS
FT                   YNSKVVYAFVTYFLLSVTYTAINIPYCSLGGVITNDPKERVACQAYRFVLVGIATLLLS
FT                   LTLLPMVDWFGGGDKAKGYQLAMTVLAIIGMGMFLFCFASVRERVRPAVPTHDDMKNDF
FT                   KDVWKNDQWVRILLLTLCNVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVVGMMIG
FT                   SMLAKVLTDRWCKLKVFFWTNIALAIFSCAFYFFDPKATVMIVALYFLLNILHQIPSPL
FT                   HWSLMADVDDYGEWKTGKRITGISFSGNLFFLKLGLAIAGAMVGFLLSWYGYDASAKAQ
FT                   SASAMNGIMLLFTVIPGVGYLITAGVVRLLKVDRELMKKIQDDLEKRRTNYRELSELQE
FT                   LKAAESVRKA"
FT   gene            complement(167482..168852)
FT                   /locus_tag="SPAB_00186"
FT   CDS_pept        complement(167482..168852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00186"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0120 3.0e-226 aroP; aromatic amino
FT                   acid transport protein AroP K03293; COG: COG1113
FT                   Gamma-aminobutyrate permease and related permeases; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65628"
FT                   /inference="protein motif:HMMPanther:IPR002293"
FT                   /inference="protein motif:HMMPfam:IPR004841"
FT                   /inference="protein motif:ScanRegExp:IPR004840"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454764.1"
FT                   /protein_id="ABX65628.1"
FT                   /translation="MDSQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGP
FT                   GIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVLYVL
FT                   VAMAELTAVGKYIQFWYPEIPTWASAAAFFVIINAINLTNVKVFGEMEFWFAIIKVIAV
FT                   IAMILFGAWLLFSDTAGPQATVRNLWEQGGFLPHGWTGLVMMMAIIMFSFGGLELVGIT
FT                   AAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLLPWTRVTADTSPFVLIFHELGDT
FT                   FVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLNVDKRGVPVSSILVSA
FT                   VVTALCVLLNYLAPESAFGLLMALVVSALVINWAMISLAHMMFRRAKQQQGVKTRFPAL
FT                   FYPFGNVLCLLFMAAVLIIMLMTPGMAISVWLIPVWLLILGVGYLCKEKTAKTVKAH"
FT   gene            169061..169183
FT                   /locus_tag="SPAB_00187"
FT   CDS_pept        169061..169183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00187"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65629"
FT                   /protein_id="ABX65629.1"
FT                   /translation="MRKKKALVNTSFYFPLQMLICFYSLFMHKNAFNLLLNRFR"
FT   gene            169418..170182
FT                   /locus_tag="SPAB_00188"
FT   CDS_pept        169418..170182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_3817 9.2e-08 transcriptional
FT                   regulator, GntR family K07979; COG: COG2186 Transcriptional
FT                   regulators; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00188"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65630"
FT                   /inference="protein motif:Gene3D:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR011711"
FT                   /inference="protein motif:HMMSmart:IPR000524"
FT                   /inference="similar to AA sequence:INSD:CAD01310.1"
FT                   /protein_id="ABX65630.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQFDLLETR
FT                   HALEGIAAYYAALRSTDEDKDRIRELHHAIELAQESGDLDAESEAVLQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYARREMLPLVSTHRTRIFEAIMAGKPEEAREASH
FT                   RHLAFIEEIMLDRSREESRRERALRRLEQRKN"
FT   gene            170342..173005
FT                   /locus_tag="SPAB_00189"
FT   CDS_pept        170342..173005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0151 0. aceE; pyruvate dehydrogenase,
FT                   decarboxylase component K00163; COG: COG2609 Pyruvate
FT                   dehydrogenase complex, dehydrogenase (E1) component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65631"
FT                   /inference="protein motif:Gene3D:IPR009014"
FT                   /inference="protein motif:HMMPfam:IPR005474"
FT                   /inference="protein motif:HMMPIR:IPR004660"
FT                   /inference="protein motif:HMMTigr:IPR004660"
FT                   /inference="protein motif:superfamily:IPR009014"
FT                   /protein_id="ABX65631.1"
FT                   /translation="MSERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLSEAR
FT                   KGGVKVAAGAGASNYINTIAVEDEPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGIYARAFLEGRLTQEQM
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIVNELEG
FT                   IFAGAGWNVIKVMWGGRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKVYAALKKAQETKGKATVILAHTIKGYGMGD
FT                   TAEGKNIAHQVKKMNMDGVRYVRDRFNVPVADADLEKLPYITFPEGSEEHKYLHERRQA
FT                   LHGYLPSRQPNFTEKLELPQLSDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   ASWLAAATSYSTNDLPMIPFYIYYSMFGFQRIGDLCWQAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAMPAGAEEGIRKGIYKLETLEGSKGKVQLLGSGSILRHVREAAQILANDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   ITKFNIDADKVNPRLA"
FT   gene            173020..174906
FT                   /locus_tag="SPAB_00190"
FT   CDS_pept        173020..174906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0157 0. aceF; dihydrolipoamide
FT                   acetyltransferase component (E2) of pyruvate dehydrogenase
FT                   K00627; COG: COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes; Psort location: Cytoplasmic,
FT                   score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65632"
FT                   /inference="protein motif:BlastProDom:IPR001078"
FT                   /inference="protein motif:HMMPfam:IPR000089"
FT                   /inference="protein motif:HMMPfam:IPR001078"
FT                   /inference="protein motif:HMMPfam:IPR004167"
FT                   /inference="protein motif:HMMTigr:IPR006256"
FT                   /inference="protein motif:ScanRegExp:IPR003016"
FT                   /inference="protein motif:superfamily:IPR011053"
FT                   /protein_id="ABX65632.1"
FT                   /translation="MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGVVKEIKVSVGDKTETGALIMIFDSADGAADAAPAKAEEKKEAAPAAAPAAAA
FT                   AKDVHVPDIGSDEVEVTEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVN
FT                   TGDKVSTGSLIMVFEVAGAAPAAAPAKAEAAPAAAAPAATGVKDVNVPDIGGDEVEVTE
FT                   VMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEG
FT                   AAPAAAPAKQEAAAPAPAAKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGV
FT                   NLAKVKGTGRKGRILREDVQAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEVE
FT                   EVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPV
FT                   VFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSV
FT                   TELSRELTTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKS
FT                   AMEPVWNGKEFVPRLMMPISLSFDHRVIDGADGARFITIINNMLSDIRRLVM"
FT   gene            complement(174948..175070)
FT                   /locus_tag="SPAB_00191"
FT   CDS_pept        complement(174948..175070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65633"
FT                   /protein_id="ABX65633.1"
FT                   /translation="MIAHHPPGRSIRPYLTKLLTILKQQTDHELSLSLITSQNT"
FT   gene            175108..176532
FT                   /locus_tag="SPAB_00192"
FT   CDS_pept        175108..176532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0160 8.7e-252 lpdA; dihydrolipoamide
FT                   dehydrogenase K00382; COG: COG1249 Pyruvate/2-oxoglutarate
FT                   dehydrogenase complex, dihydrolipoamide dehydrogenase (E3)
FT                   component, and related enzymes; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65634"
FT                   /inference="protein motif:BlastProDom:IPR001327"
FT                   /inference="protein motif:Gene3D:IPR004099"
FT                   /inference="protein motif:HMMPfam:IPR001327"
FT                   /inference="protein motif:HMMPfam:IPR004099"
FT                   /inference="protein motif:HMMPfam:IPR013027"
FT                   /inference="protein motif:HMMTigr:IPR006258"
FT                   /inference="protein motif:ScanRegExp:IPR012999"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454768.1"
FT                   /protein_id="ABX65634.1"
FT                   /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVITQLTGGLAGM
FT                   AKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRVW
FT                   DSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVF
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLD
FT                   AGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKH
FT                   YFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEI
FT                   FEGSITDLPNPKAKKK"
FT   gene            176619..176738
FT                   /locus_tag="SPAB_00193"
FT   CDS_pept        176619..176738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65635"
FT                   /protein_id="ABX65635.1"
FT                   /translation="MMAKDNETAKFIFSAAVRFSNLMPSVVPLSVIFDQLIVS"
FT   gene            176821..177105
FT                   /locus_tag="SPAB_00194"
FT   CDS_pept        176821..177105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00194"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hne:HNE_1624 0.0086 sodA; superoxide
FT                   dismutase, Mn K00518; COG: NOG32314 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65636"
FT                   /inference="similar to AA sequence:INSD:AAL19119.1"
FT                   /protein_id="ABX65636.1"
FT                   /translation="MKLFLTTAALTATLISGMAFASDPVIPWATNSGGTESTHIAAMGE
FT                   DLNAQHQQITHTHEGVWAANSGSIQADEAALTSNKPPVQGHPELMPHQG"
FT   gene            complement(177143..177934)
FT                   /locus_tag="SPAB_00195"
FT   CDS_pept        complement(177143..177934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00195"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09806 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65637"
FT                   /inference="similar to AA sequence:INSD:AAL19120.1"
FT                   /protein_id="ABX65637.1"
FT                   /translation="MKKVMLSALLLSLPLLGYAQERFPSPEAAASAFAAAVAGKNETQL
FT                   TALLGDDWRQFLPPEGADPEAVARFNRDWREGHRIVQKDNTAHLNVGREDWQLPVPMVK
FT                   EAGGWRFDMAAAGNEILTRTIGRNELSTLQAMHAYVDAQQDYYLQNHRWAHRIISSEGQ
FT                   KDGLYWPTKAGDAPSPLGPNFSPAAPDEGYHGYHFRIISDNDGHGAALLAWPMHYGETG
FT                   VMSFMVNQDDRIYQADLGKETESKVQAITRFAPDAQWQVAE"
FT   gene            complement(177947..179542)
FT                   /locus_tag="SPAB_00196"
FT   CDS_pept        complement(177947..179542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB0231210 0.0042 putative CDC7 family
FT                   protein kinase K02214; COG: NOG06276 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00196"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65638"
FT                   /inference="similar to AA sequence:INSD:AAL19121.1"
FT                   /protein_id="ABX65638.1"
FT                   /translation="MTLPFKPHLIALVCSAGLFAASGVLYVKSRAPEAPAQAAAPAPEP
FT                   TQTAVPAPVAKTTFTTAQIDQWVAPVALYPDALLSQVLMASTYPANVVQAVQWSRDNPT
FT                   LQGDAAIQAVASQPWDPSVKSLVAFPQLMALMGENPQWVQNLGDAFLAQPQDVMDAVQR
FT                   LRLLAQQTGSLKSTPQQTVTSVPKSSASSAVTTTTTTSASTPATPSTVIKIEPANPQVV
FT                   YVPNYNPATVYGAWPNTAYPPVYLPPPPGQQFADSFVKGFGYSLGVATTYALFSSIDWD
FT                   DDDHHHHDDDHHDDDYHHGGNGYQHNGDNININVNNFNRISGQNLPGQTMGWQHNPAWR
FT                   NGVPYPNNTVAQRFHPTNVSGGLSATQQAPVSRDSQRQTAMTQFQQRSHTANASLPAPG
FT                   TRDAQRKAASQQLNQIARRNNYRGYDNQYDSARRQTAQQHSATLKSQTQQHPLSQQQRN
FT                   AAHQRIASSTPQQRQAFRQNMHANVFSGNDSRSPSWQSQQLRGLESRRGSHLNTEQHAA
FT                   AREHFSEHHEFHRR"
FT   gene            179982..182528
FT                   /locus_tag="SPAB_00197"
FT   CDS_pept        179982..182528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0158 0. acnB; aconitate hydratase 2
FT                   K01682; COG: COG1049 Aconitase B"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65639"
FT                   /inference="protein motif:BlastProDom:IPR001030"
FT                   /inference="protein motif:HMMPanther:IPR004406"
FT                   /inference="protein motif:HMMPfam:IPR001030"
FT                   /inference="protein motif:HMMPfam:IPR004406"
FT                   /inference="protein motif:HMMPIR:IPR004406"
FT                   /inference="protein motif:HMMTigr:IPR004406"
FT                   /inference="protein motif:ScanRegExp:IPR001030"
FT                   /inference="protein motif:superfamily:IPR001030"
FT                   /protein_id="ABX65639.1"
FT                   /translation="MPKPLDATQMAALVELLKTPPVGEEEFLLDLLINRVPPGVDEAAC
FT                   VKAGFLAAVAKGDTTSPLVSPEKAIELLGTMQGGYNIHPLIDALDDAKLAPIAAKALSH
FT                   TLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLSRPPLAEKITVTVFKVTGETNTD
FT                   DLSPAPDAWSRPDIPLHAQAMLKNAREGIEPDQPGVVGPIKQIEALQKKGYPLAYVGDV
FT                   VGTGSSRKSATNSVLWFMGDDIPNVPNKRGGGLCLGGKIAPIFFNTMEDAGALPIEVDV
FT                   SNLNMGDVIDVYPYKGEVRNHETGELLATFELKTDVLIDEVRAGGRIPLIIGRGLTTKA
FT                   REALGLPHSDVFRQAKDVAESSRGFSLAQKMVGRACGVKGIRPGAYCEPKMTSVGSQDT
FT                   TGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVTTHHTLPDFIMNRGGVSLRPG
FT                   DGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLV
FT                   RFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSGRILEIEGLPDLKVEQAF
FT                   ELTDASAERSAAGCTIKLNKEPIIEYLTSNIVLLKWMIAEGYGDRRTLERRIQGMEKWL
FT                   ADPQLLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARLLSDVQGEKIDEVFIGSCM
FT                   TNIGHFRAAGKLLDNHKGQLPTRLWVAPPTRMDAAQLTEEGYYSVFGKSGARIEIPGCS
FT                   LCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAAVAALIGKLPTPEEYQTF
FT                   VAQVDKTAVDTYRYLNFDQLSQYTEKADGVIFQTAV"
FT   gene            182717..183079
FT                   /locus_tag="SPAB_00198"
FT   CDS_pept        182717..183079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00198"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3112 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65640"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZQ5"
FT                   /inference="protein motif:BlastProDom:IPR008249"
FT                   /inference="protein motif:HMMPfam:IPR008249"
FT                   /inference="protein motif:HMMPIR:IPR008249"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZRS6"
FT                   /protein_id="ABX65640.1"
FT                   /translation="MDYEFLRDVTGGVKVRMSMGHEVVGHWFNEEVKDNLSLLDEVEQA
FT                   ARTVKGSERSWQRAGHEYTIWMDGEEVMIRANQLDFSGDEMEEGMSYYDEESLSLCGME
FT                   DFLRVVAAYREFVSKA"
FT   gene            complement(183181..183285)
FT                   /locus_tag="SPAB_00199"
FT   CDS_pept        complement(183181..183285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65641"
FT                   /protein_id="ABX65641.1"
FT                   /translation="MNKIITIIFNQIKITNASDHSFKMINKNQKIILQ"
FT   gene            183313..184266
FT                   /locus_tag="SPAB_00200"
FT   CDS_pept        183313..184266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_3090 0.0017 ribose transport system
FT                   permease protein RbsC; COG: NOG06082 non supervised
FT                   orthologous group; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65642"
FT                   /inference="protein motif:HMMPfam:IPR004684"
FT                   /inference="similar to AA sequence:INSD:AAV76197.1"
FT                   /protein_id="ABX65642.1"
FT                   /translation="MNIKKAIERVPGGMMVVPLVIGAVINTFAPQALDIGGFTTALFKN
FT                   GAAPLIGAFLLCMGAGISVKAAPQALLQGGTITLTKLLVAIGIGLGVEHLFGAEGIFGL
FT                   SGVAIIAAMSNSNGGLYAALVGEFGNERDVSAISILSLNDGPFFTMIALGAAGMANIPI
FT                   MALVAVLVPLVVGMILGNLDPHMRDFLTKGGPLLIPFFAFALGAGINLEMLLQGGLAGI
FT                   LLGVLTTFVGGFFNIRADRLVGGTGIAGAAASSTAGNAVATPLAIAQADPSLAEVAAAA
FT                   APLIAASVITTAILTPVLTSWVAKKQARQASLEKNA"
FT   gene            184263..185534
FT                   /locus_tag="SPAB_00201"
FT   CDS_pept        184263..185534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_1035 3.3e-16
FT                   4-hydroxythreonine-4-phosphate dehydrogenase K00097; COG:
FT                   COG3395 Uncharacterized protein conserved in bacteria;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65643"
FT                   /inference="protein motif:HMMPfam:IPR010737"
FT                   /inference="similar to AA sequence:INSD:AAV76198.1"
FT                   /protein_id="ABX65643.1"
FT                   /translation="MKMIVIADDFTGSNDTGVQLAKKGARTEVMLSASQKPSRRADVLV
FT                   INTESRAMPADQAASAVYAALSPWCETSPAPLVYKKIDSTFRGNIGAEVTAAMRASQRK
FT                   LAVIAAAIPAAGRTTLEGKCLVNGVPLLETEFASDPKTPIVSSRIAEIVALQSEIPVYE
FT                   VFLQDVRRGGLSALLTAYAAEGEGIIVVDAVEERDLTLIAQAACEQPSMPLLVGAAGLA
FT                   NALPVELFMQDRQRLPVLVVAGSMSEATRRQVDNALCRGRAEVVDIDAARMVSDSAEQE
FT                   IASVVEQACALLSQHRHTILRTSRRAEDRQLIDALCEKSAMSRQQLGERLSQRLGVVTL
FT                   NIIEQARIGGLFLTGGDIATAVAGALGAEGYRIQSEVAPCIPCGTFVNSEIDDLPVITK
FT                   AGGFGSDSTLCDALYYIEEMYCGD"
FT   gene            185524..186507
FT                   /locus_tag="SPAB_00202"
FT   CDS_pept        185524..186507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00202"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0163 3.0e-171
FT                   4-hydroxythreonine-4-phosphate dehydrogenase 2 K00097; COG:
FT                   COG1995 Pyridoxal phosphate biosynthesis protein; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00202"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65644"
FT                   /inference="protein motif:HMMPfam:IPR005255"
FT                   /inference="protein motif:HMMTigr:IPR005255"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459168.1"
FT                   /protein_id="ABX65644.1"
FT                   /translation="METKTVAITMGDPAGIGPEIIVKALSEDGLNGAPLVVIGCLATLK
FT                   RLQAKGITPNVELRAIERVAEARFAPGIIHVIDEPLAQPEALEAGKVQAQAGDLAYRCV
FT                   KRATELALRGDVQAIATAPLNKEALHLAGHNYPGHTELLATLTHSRDYAMVLYTDKLKV
FT                   IHVSTHIALRKFLDTLSTARVETVIGIADTFLKRVGYVKPRIAVAGVNPHAGENGLFGD
FT                   EETRILTPAITDARAKGMDVYGPCPPDTVFLQAYEGQYDMVVAMYHDQGHIPLKLLGFY
FT                   DGVNITAGLPFIRTSADHGTAFDIAWTGKAKSESMAVSIKLAMQLA"
FT   gene            186517..187284
FT                   /locus_tag="SPAB_00203"
FT   CDS_pept        186517..187284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00203"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1349 Transcriptional regulators of sugar
FT                   metabolism; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00203"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65645"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR001034"
FT                   /inference="protein motif:HMMSmart:IPR001034"
FT                   /inference="protein motif:ScanRegExp:IPR001034"
FT                   /inference="similar to AA sequence:INSD:AAO67901.1"
FT                   /protein_id="ABX65645.1"
FT                   /translation="MKGQHRLDLIVAYLKNHTLVTVEQLVEAVDASPATIRRDLIKLDE
FT                   QGVISRSHGGVALRRFEPAQPTTNEKQLRSPAEKRAIARVAASLVNAGDAVVLDAGTTM
FT                   MELAKCLTHLPLRVITVDLHIALFLAEFRQIEVTIVGGRIDDSSQSCIGEHGRKLLRSV
FT                   YPNIAFMSCNSWGVKTGVTTPTEDKAGLKQEIIANAQRKVLLADSSKYGVHSLFNVVPL
FT                   ERFNDVITDVNLPPSAQVELKGRAFALTLVQPE"
FT   gene            complement(187314..188108)
FT                   /locus_tag="SPAB_00204"
FT   CDS_pept        complement(187314..188108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0165 2.5e-142 speD;
FT                   S-adenosylmethionine decarboxylase, proenzyme K01611; COG:
FT                   COG1586 S-adenosylmethionine decarboxylase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65646"
FT                   /db_xref="GOA:A9MZR1"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZR1"
FT                   /inference="protein motif:HMMPfam:IPR003826"
FT                   /inference="protein motif:HMMPIR:IPR009165"
FT                   /inference="similar to AA sequence:INSD:AAO47363.1"
FT                   /protein_id="ABX65646.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPIDPKLIDQTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV"
FT   gene            complement(188129..188989)
FT                   /locus_tag="SPAB_00205"
FT   CDS_pept        complement(188129..188989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0166 1.4e-157 speE; spermidine synthase
FT                   (putrescine aminopropyltransferase) K00797; COG: COG0421
FT                   Spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65647"
FT                   /db_xref="GOA:A9MZR2"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZR2"
FT                   /inference="protein motif:HMMPanther:IPR001045"
FT                   /inference="protein motif:HMMPfam:IPR001045"
FT                   /inference="protein motif:HMMTigr:IPR001045"
FT                   /inference="protein motif:ScanRegExp:IPR001045"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215153.1"
FT                   /protein_id="ABX65647.1"
FT                   /translation="MAENTMWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVETI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFTLVIDDGVNFVNQTHQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQDEALDSHRKLSHYFSDVGFYQAA
FT                   IPTYYGGIMTFAWATNNDALRHLSSEIIQARFHAAGLKCRYYNPAIHAAAFALPQYLHD
FT                   ALSAQ"
FT   gene            complement(189096..189443)
FT                   /locus_tag="SPAB_00206"
FT   CDS_pept        complement(189096..189443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00206"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09835 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00206"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65648"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454780.1"
FT                   /protein_id="ABX65648.1"
FT                   /translation="MKTFFRPVLFGSLMALCANSYALTESEAEDMADLTAVFVFLKNDC
FT                   GYQNLPNSQIRRALVFFAQQNQWDLSNYDTFDMKSLGEDSYRDLSGIGIPVAKKCKALA
FT                   RDSLSLLAYVK"
FT   gene            189645..191255
FT                   /locus_tag="SPAB_00207"
FT   CDS_pept        189645..191255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0136 1.5e-240 cueO; blue copper
FT                   oxidase CueO precursor; COG: COG2132 Putative multicopper
FT                   oxidases; Psort location: Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65649"
FT                   /inference="protein motif:HMMPfam:IPR011706"
FT                   /inference="protein motif:HMMPfam:IPR011707"
FT                   /inference="protein motif:ScanRegExp:IPR002355"
FT                   /inference="protein motif:superfamily:IPR008972"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZRS2"
FT                   /protein_id="ABX65649.1"
FT                   /translation="MLRRDFLKYSVALGVASALPLWSRAAFAAERPALPIPDLLTADAS
FT                   NRMQLIVKAGQSTFAGKNATTWGYNGNLLGPAVQLHKGKSVTVDIHNQLAEDTTLHWHG
FT                   LEIPGIVDGGPQGIIPAGGTRTVTFTPEQRAATCWIHPHKHGKTGRQVAMGLAGLVLIE
FT                   DDEIRKLRLPKQWGIDDVPVIIQDKRFSADGQIDYQLDIMTAAVGWFGDTLLTNGAIYP
FT                   QHSAPKGWLRLRLLNGCNARSLNIAASDNRPLYVIASDGGLLAEPVKVTELPLLMGERF
FT                   EVLVDISDGKAFDLVTLPVSQMGMAIAPFDKPHPVMRIQPLRITASGTLPDTLTTMPAL
FT                   PSLEGLTVRNLKLSMDPRLDMMGMQMLMKKYGAQAMSGMDHDSMNAHMQGGNMGHGEMD
FT                   HGNMDHSGMNHGAMGNMNHGGKFDFHNANFINGQVFDMNKPMFAAQKGRHERWVISGVG
FT                   DMMLHPFHIHGTQFRILSENGKAPAAHRTGWKDTVRVEGGISEVLVKFDHDAPKEHAYM
FT                   AHCHLLEHEDTGMMLGFTV"
FT   gene            complement(191333..193723)
FT                   /locus_tag="SPAB_00208"
FT   CDS_pept        complement(191333..193723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0169 0. gcd; glucose dehydrogenase
FT                   K00117; COG: COG4993 Glucose dehydrogenase; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65650"
FT                   /inference="protein motif:HMMPfam:IPR002372"
FT                   /inference="protein motif:HMMSmart:IPR002372"
FT                   /inference="protein motif:ScanRegExp:IPR001479"
FT                   /inference="protein motif:superfamily:IPR011047"
FT                   /protein_id="ABX65650.1"
FT                   /translation="MAENNARSPRLLVTLTALFAALCGLYLLIGGVWLVAIGGSWYYPI
FT                   AGLVMLVVAGLLWRSKRAALWLYAALLLATMIWGVWEVGFDFWALTPRSDILVFFGIWL
FT                   ILPFVWHRLVVPSSGAVAALVVALLISGGILTWAGFNDPQEINGTLRADATPAATSSSI
FT                   ADEDWPAYGRNQEGQRYSPLKQITADNVHQLKEAWVFRTGDLKQPNDPGEITNEVTPIK
FT                   VGDTLYLCTAHQRLFALDAASGKEKWHFDPQLKTDSSFQHVTCRGVSYHEAKADTASPE
FT                   VIADCPRRIILPVNDGRLFAVNAETGKLCETFANKGVLNLQTNMPDTTPGLYEPTSPPI
FT                   ITDKTIVIAGSVTDNFSTRETSGVIRGFDVNTGKLLWAFDPGAKDPNAIPADEHAFTFN
FT                   SPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNATTGKLAWSYQ
FT                   TVHHDLWDMDLPAQPTLADITVNGTTVPVIYAPAKTGNIFVLDRRNGELVVPAPEKPVP
FT                   QGAAKGDYVAKTQPFSDLTFRPKKDLSGADMWGATMFDQLVCRVMFHQLRYEGIFTPPS
FT                   EQGTLVFPGNLGMFEWGGISVDPDRQVAIANPMALPFVSKLIPRGPGNPMEPPKDAKGT
FT                   GTEAGIQPQYGVPFGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEIVWKKRIGTPRDS
FT                   MPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEKLWQGRLPAGG
FT                   QATPMTYEVNGKQYVVVSAGGHGSFGTKMGDYIVAYALPDDAK"
FT   gene            193902..194465
FT                   /locus_tag="SPAB_00209"
FT   CDS_pept        193902..194465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0170 4.6e-95 hpt; hypoxanthine
FT                   phosphoribosyltransferase K00760; COG: COG0634
FT                   Hypoxanthine-guanine phosphoribosyltransferase; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00209"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65651"
FT                   /inference="protein motif:HMMPfam:IPR000836"
FT                   /inference="protein motif:HMMTigr:IPR005904"
FT                   /inference="protein motif:ScanRegExp:IPR002375"
FT                   /inference="similar to AA sequence:INSD:AAX64076.1"
FT                   /protein_id="ABX65651.1"
FT                   /translation="MFLNHMVINMKHTIEVMIPEAEIKARIAELGRQITERYKDSGSEM
FT                   VLVGLLRGSFMFMADLCREVQVPHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDV
FT                   LIVEDIIDSGNTLSKVREILGLREPKSLAICTLLDKPSRREVDVPVEFVGFSIPDEFVV
FT                   GYGIDYAQRYRHLPYVGKVVLLDE"
FT   gene            complement(194523..195185)
FT                   /locus_tag="SPAB_00210"
FT   CDS_pept        complement(194523..195185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0174 1.4e-118 yadF; carbonic anhydrase
FT                   K01673; COG: COG0288 Carbonic anhydrase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65652"
FT                   /inference="protein motif:Gene3D:IPR001765"
FT                   /inference="protein motif:HMMPfam:IPR001765"
FT                   /inference="protein motif:ScanRegExp:IPR001765"
FT                   /inference="protein motif:superfamily:IPR001765"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149519.1"
FT                   /protein_id="ABX65652.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHSGCGGI
FT                   KAAVENPELGLINNWLLHIRDIWLKHSSLLGKMPEEQRLDALYELNVMEQVYNLGHSTI
FT                   MQSAWKRGQNVTIHGWAYSINDGLLRDLDVTATNKKTLENGYHKGISALSLKYIPHQ"
FT   gene            195368..196219
FT                   /locus_tag="SPAB_00211"
FT   CDS_pept        195368..196219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00211"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN1596 5.3e-94 ABC transporter,
FT                   ATP-binding protein; COG: COG1131 ABC-type multidrug
FT                   transport system, ATPase component; Psort location:
FT                   CytoplasmicMembrane, score:7.88"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65653"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459177.1"
FT                   /protein_id="ABX65653.1"
FT                   /translation="MQVEAGDFYALLGPNGAGKSTTIGIISSLVNKTSGRVNVFGYDLE
FT                   KDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAGYYGVEHKEAVLRSEKYLKQLDLWEK
FT                   RHERARMLSGGMKRRLMIARALMHEPKLLILDEPTAGVDIELRRSMWGFLKDLNAKGTT
FT                   IILTTHYLEEAEMLCRNIGIIQHGELVENTSMKNLLSKLKSETFILDLAPKSPLPKLAG
FT                   YQYRLVDTSTLEVEVLREQGVNSVFSQLSEQGVQVLSMRNKANRLEELFVSLVHEKQGD
FT                   RA"
FT   gene            196216..196986
FT                   /locus_tag="SPAB_00212"
FT   CDS_pept        196216..196986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00212"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0842 ABC-type multidrug transport system,
FT                   permease component; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65654"
FT                   /inference="protein motif:FPrintScan:IPR013526"
FT                   /inference="protein motif:HMMPfam:IPR013525"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149521.1"
FT                   /protein_id="ABX65654.1"
FT                   /translation="MMQLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGEMHGFSYMQFIVPGLIMMAVITNSYANVASSFFSAKFQRNIEELLVAPVPTHV
FT                   IIAGFVGGGVARGLCVGILVTAISLFFVPFQVHSWVFVALTLILTAILFSLAGLLNAVF
FT                   AKTFDDISLIPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIH
FT                   DVPLVTTFGVLVIFIAAFYLLCWSLIQRGRGLRS"
FT   gene            complement(197104..198180)
FT                   /locus_tag="SPAB_00213"
FT   CDS_pept        complement(197104..198180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00213"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3539 P pilus assembly protein, pilin FimA"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00213"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65655"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:HMMPfam:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459179.1"
FT                   /protein_id="ABX65655.1"
FT                   /translation="MKNLWMLLALSLFSGHALADGTMGNGSGWCQPTSGTHDFPFSFNQ
FT                   TITDTDGNQTGTIVEEHWSAGGEYSAKCDCDNSDYRGYNYFTATTGDLTQKGTHSETRY
FT                   YGHMDYYVLVAGKLEIGTEAYIAGKLGEYIPVPFSSISNNDASAGGCGDAEMKSMTAGN
FT                   KGTVRIYITHPLVGEISIPQTTIMNLYLSKTPGSSGDNIPPSVPPIAHVTMSGTITVPQ
FT                   SCSINAGQVIEVRLPDIEGKDIRHLGDSPQNSHVTTQVNFTCSNVADGTNLSMSLNGET
FT                   DPHNPEYLKTDNENLGIRISDKYDKTIVPGGSAELPIEDYADGRGSTEFTAAPVNTTGH
FT                   VPHTGEYQATATLEIQIR"
FT   gene            complement(198189..200741)
FT                   /locus_tag="SPAB_00214"
FT   CDS_pept        complement(198189..200741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00214"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3188 P pilus assembly protein, porin PapC;
FT                   Psort location: OuterMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65656"
FT                   /inference="protein motif:HMMPfam:IPR000015"
FT                   /protein_id="ABX65656.1"
FT                   /translation="MPMRKGQHRGFYLSRCAVCIALGSTFAHVAWARDYFNPAFIEHHG
FT                   QANRTSVDLSTFDNDKSQHPGTYYVTIIINKTEIGARNVDFQLTTLSDGQQALQGCLRL
FT                   QELKDNGVKTDLFPTLESEKSCVDLSAIPGTSQQFDFQQQALSISIPQLYIANNARGYV
FT                   PPEKWQEGITALMLNYSFSGYKEYGSSEDSDDAESKYLALQPGFNLGPWRFRNYSNWSA
FT                   NNGESGSWNSVYNYLQRDIIALKSQFTAGDSNTPSDVFDSVPFRGLQLTSDDQMQPNSQ
FT                   RGYAPTIRGIARSNAQVIVRQNGYIAYQTAVSPGEFEINDMFPTGSNGDYDVTVKEADG
FT                   SEQHFIVPYSSLPILQRTGRAKYSVTVGKYRDYDNHMLDDFGQATLLYGLPWGITLYGG
FT                   SQIAGDKYQSVAFGVGQNMQMLGAISLDGIWSHAKFDDGRKEAGQSWRVRYSKGVVSTG
FT                   TTFSLAGYRYASENYNSLSEVINPDDDFYDNYGKRHNRFEASVNQQISDTLGSLTLSWV
FT                   KEDYWHSAQQMESLSANYNNSWGPVSYTLSYSYNKNTYQYRSDNDDDDNDDDRYNQNDR
FT                   LFTLSLHVPFTVFDSRLYASYMLNTRKHDATVNSTTLSGTALRDRNLNWSLQQSHSTQD
FT                   GDSGGVNASYKGTYANLNAGYNQSPDSQQVSYGISGGILAHENGITLSQPITGAAILIK
FT                   APGASGVSVENQTGVATDFRGYTVIPNVTPYYRYDISLDSSTFADNVDIPLNNQTVYPT
FT                   RNAVVRAAYDTHKGYRALLTLTRSNGEPVPFGATASVDGQDANLASIVGDKGQVFLSGL
FT                   PEEGLLLVNWGSASCRADYRLDISKNMNGIVMANAVCQ"
FT   gene            complement(200762..201445)
FT                   /locus_tag="SPAB_00215"
FT   CDS_pept        complement(200762..201445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00215"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3121 P pilus assembly protein, chaperone
FT                   PapD; Psort location: Periplasmic, score:9.76"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65657"
FT                   /inference="protein motif:BlastProDom:IPR001829"
FT                   /inference="protein motif:Gene3D:IPR001829"
FT                   /inference="protein motif:HMMPfam:IPR001829"
FT                   /inference="protein motif:superfamily:IPR008962"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215163.1"
FT                   /protein_id="ABX65657.1"
FT                   /translation="MNSLAKAGLLCCLLCGSLAHAAGINIGATRVIFHGDAKDASISIS
FT                   NSDNVPYLIQSWAQSISETGASGDAPFMVTPPLFRLNGGQKNVLRIIRTGGNLPEDRES
FT                   LYWLDIKSIPSSNPDNKHNTLMLAVKAEFKLIYRPKALTQKPEEVADRLTWSRQGRTLT
FT                   VKNPTPYYMNFATLSVGSQKVKAPRYVAPFGNAQYTLPAAASGPIAWSIINDFGGTGPE
FT                   HKQTP"
FT   gene            complement(201493..202044)
FT                   /locus_tag="SPAB_00216"
FT   CDS_pept        complement(201493..202044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00216"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3539 P pilus assembly protein, pilin FimA;
FT                   Psort location: Extracellular, score:9.72"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00216"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65658"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:HMMPfam:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215164.1"
FT                   /protein_id="ABX65658.1"
FT                   /translation="MKLTLKTLAVALAAITLSPAALADTAKDGTVHITGLIQQNACTVK
FT                   TDSVLIEVTLQNEFASLFTAAGQTARDKGFTIDLENCDANIYSNVQARFEGTLDGTDAT
FT                   ILKNEADAQNIGVQILDKTGDSTPVTFNDLQAWSSAVALPTEEGVTTLSMPFTARYIAT
FT                   AVPVGSGNVDASATFYLQYN"
FT   gene            complement(202058..202186)
FT                   /locus_tag="SPAB_00218"
FT   CDS_pept        complement(202058..202186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65660"
FT                   /protein_id="ABX65660.1"
FT                   /translation="MYSEFFFAPQKSSNIIFTHSGIKRTITFHTINIATMSIFIIS"
FT   gene            202157..202285
FT                   /locus_tag="SPAB_00217"
FT   CDS_pept        202157..202285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00217"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65659"
FT                   /protein_id="ABX65659.1"
FT                   /translation="MRREEKFRIHKYKIFIIYILLIVLVGVGLIIAVIILSMGQIL"
FT   gene            complement(202257..202379)
FT                   /locus_tag="SPAB_00219"
FT   CDS_pept        complement(202257..202379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65661"
FT                   /protein_id="ABX65661.1"
FT                   /translation="MSACFFGRQHSMTTIIFYSKKFALFLKMFAAFIESGPLKV"
FT   gene            202410..202850
FT                   /locus_tag="SPAB_00220"
FT   CDS_pept        202410..202850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00220"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY0196 3.9e-75 yadI; putative PTS system
FT                   IIA component K02821; COG: COG2893 Phosphotransferase
FT                   system, mannose/fructose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65662"
FT                   /inference="protein motif:Gene3D:IPR004701"
FT                   /inference="protein motif:HMMPfam:IPR004701"
FT                   /inference="protein motif:superfamily:IPR004701"
FT                   /inference="similar to AA sequence:INSD:AAO67911.1"
FT                   /protein_id="ABX65662.1"
FT                   /translation="MLGWVITCHDDRAQDMLDRLERKNGPLAQCRAVNFWRGVSSNMLS
FT                   RMMCDALHATDSGEGVIFLTDISGAAPYRVASLMSHKHSQCEVISGVSYSLIEEMLPLR
FT                   ESMSSSAFRDQIVALGAPDVTSLWHQQQKNPPFVLLHDLYEF"
FT   gene            202918..204141
FT                   /locus_tag="SPAB_00221"
FT   CDS_pept        202918..204141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo2324 5.5e-21 putative polysaccharide
FT                   deacetylase; COG: COG0726 Predicted xylanase/chitin
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65663"
FT                   /inference="protein motif:HMMPfam:IPR002509"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459184.1"
FT                   /protein_id="ABX65663.1"
FT                   /translation="MRVVLILLFFFSGNVLAALPARYMQTTKDAAIWSQIGDKMVTVGN
FT                   IRAGQILSVTPVAADYYAFKFGFGEGFIDKGHLEPVQGKQKVEDGLGDLNKPLSNQNLV
FT                   TWKDTPVYNAPDISSAPFGVLVDNLRYPIISKLKGRLHQTWYQIRIGDRLAYVSAMDAQ
FT                   EDNGIPILTYHHILRDEENTRFRHTSTTTSVRAFSNQMTWLRDRGYATLTMYQLEDYIH
FT                   NRANFPARAVAITFDDGLKSVSRYAYPVLKQYGMKATAFIISSRIKRHPQKWNPRSLQF
FT                   MSVSELRKISDVFDFQSHTHFLHRVDGHRRPILYSRSYHNILFDFERSRRALAQFTPHV
FT                   FYLSYPFGGYNATAIKAAKDAGFHLAVTTVRGKVKPGDNPMLLKRLYILRTDSLETMSR
FT                   LISNQPQG"
FT   gene            complement(204148..204528)
FT                   /locus_tag="SPAB_00222"
FT   CDS_pept        complement(204148..204528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0180 4.7e-63 panD; aspartate
FT                   1-decarboxylase K01579; COG: COG0853 Aspartate
FT                   1-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65664"
FT                   /db_xref="GOA:A9MZS9"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZS9"
FT                   /inference="protein motif:BlastProDom:IPR003190"
FT                   /inference="protein motif:HMMPfam:IPR003190"
FT                   /inference="protein motif:HMMTigr:IPR003190"
FT                   /inference="protein motif:superfamily:IPR009010"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804064.1"
FT                   /protein_id="ABX65664.1"
FT                   /translation="MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAID
FT                   IWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPK
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   gene            complement(204623..205477)
FT                   /locus_tag="SPAB_00223"
FT   CDS_pept        complement(204623..205477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00223"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0187 6.5e-144 panC;
FT                   pantoate:beta-alanine ligase K01918; COG: COG0414
FT                   Panthothenate synthetase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65665"
FT                   /db_xref="GOA:A9MZT0"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZT0"
FT                   /inference="protein motif:HMMPfam:IPR003721"
FT                   /inference="protein motif:HMMTigr:IPR003721"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149532.1"
FT                   /protein_id="ABX65665.1"
FT                   /translation="MLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEAK
FT                   ARADVVFVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPQGLE
FT                   GQTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMV
FT                   ADMSYDIEIVGVPIIRAKDGLALSSRNSYLTAEQRKIAPGLHNVMNSIAEKLIAGNREL
FT                   QEIIAIAEQELNEKGFRADDIQIRDADTLLELTETSKRAVILAAAWLGQARLIDNQSVT
FT                   LAQ"
FT   gene            complement(205471..205584)
FT                   /locus_tag="SPAB_00224"
FT   CDS_pept        complement(205471..205584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65666"
FT                   /protein_id="ABX65666.1"
FT                   /translation="MATRRVLSGLQILNGCRPDKRSAIGQDHQATQGVLLC"
FT   gene            complement(205603..206397)
FT                   /locus_tag="SPAB_00225"
FT   CDS_pept        complement(205603..206397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0183 5.8e-136 panB;
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase K00606;
FT                   COG: COG0413 Ketopantoate hydroxymethyltransferase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65667"
FT                   /inference="protein motif:HMMPfam:IPR003700"
FT                   /inference="protein motif:HMMTigr:IPR003700"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454791.1"
FT                   /protein_id="ABX65667.1"
FT                   /translation="MSKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVG
FT                   DSLGMTIQGHDSTLPVTVEDIAYHTRAVRRGAPNCLLLSDLPFMAYATPEQAFENAAIV
FT                   MRAGANMVKIEGGTWLVDTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGDAGQVL
FT                   LDDALALEAAGAQLLVLECVPVELAKRVTEALSIPVIGIGAGNVTDGQILVMHDAFGIT
FT                   GGHIPKFAKNFLAETGDMRAAVRQYIAEVESGVYPGEEHSFH"
FT   gene            complement(206519..207787)
FT                   /locus_tag="SPAB_00226"
FT   CDS_pept        complement(206519..207787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00226"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3539 P pilus assembly protein, pilin FimA"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65668"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:HMMPfam:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:INSD:AAO49827.1"
FT                   /protein_id="ABX65668.1"
FT                   /translation="MITKCDHRLMLLNTQRLKSAIKIISLLLFSFVSFVTPSYGWSLYV
FT                   GQYTKNKRANEWGAVQDFTKSYAPKNMLNPIAIHNGSGLREISVSNNATELDPGTGLSC
FT                   NKDHDNHVLTMYHGYKSAGKTYNGNMLWETNIPGMYIGIEVTNINFGGQYWSEKFWINW
FT                   SNGETSGSKKFDLTNITPKDGRFEACNRLTNWTYYGLGGIVLWVKYHLYIDDSFNPAGA
FT                   TSLSVSLRKEQSYDFQFASSPAFSGSHNVYYDVAPNQLTINYPTCQANAVTGDGVTNST
FT                   VPFGEQNAEDISANTINRKFSIKLSNCAYVKELNVTLSSATVGGQDNTLLGNTLTGSEA
FT                   AGGIGVMIEGEKNPNSPADWTLLKPNISSSIYSFTNSPDYGNSEIGNAEQVMNFQATLK
FT                   QDGNKAITPGKFKATGKFTITYP"
FT   gene            complement(207809..208393)
FT                   /locus_tag="SPAB_00227"
FT   CDS_pept        complement(207809..208393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00227"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG18510 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65669"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:HMMPfam:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:INSD:CAD01338.1"
FT                   /protein_id="ABX65669.1"
FT                   /translation="MRRLRRLMLATLFSGLATALFIAPLYADTNVDFTATVQKDTCQIE
FT                   IDGNGTVSLATVGPSYFADGITAETDYGGGKEFLIKLISCPVSDGAITNVTFNFLPQSG
FT                   QFVTGNKQVFANDLATSTDGASNVGVVIFTTESPRHNVLNTDGSSRATFAATTYSDTSW
FT                   TFYARMQKVLSNDVVVPGKLSSRVLVNVEYE"
FT   gene            complement(208405..209013)
FT                   /locus_tag="SPAB_00228"
FT   CDS_pept        complement(208405..209013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00228"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG14108 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65670"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:INSD:CAD01339.1"
FT                   /protein_id="ABX65670.1"
FT                   /translation="MKKQVLRGVILGALATMTAGVSTMAQADGTASLDLTVNANITAGT
FT                   CSASVLDGETATDTIAFGNVYISEVFAKTKVKSFKLRFSDCAGLKDKKASLVIAPRDAG
FT                   CAGSDSTNAEFANASTATSKAQRTAVELWTTDTPEGSNSVQFHCRNKNAQEIDLSSASS
FT                   TTPVDYPLSARMVPVTGYAITALTAGDFYSPTTFTITYQ"
FT   gene            complement(209028..209594)
FT                   /locus_tag="SPAB_00229"
FT   CDS_pept        complement(209028..209594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00229"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3539 P pilus assembly protein, pilin FimA"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65671"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:INSD:CAD01340.1"
FT                   /protein_id="ABX65671.1"
FT                   /translation="MRRNKHLLAASVLAMIFPLTSQAEDINVDFTATVLATTCSMSIAA
FT                   LDGSNVSGDATSGYTLNVGDVGLDKIIKKSAESQKNFKFVAKDCSAALTKITTALGSSA
FT                   DASGNFIKNQSAASDAASNIGMGFKRKSTTDETYFTPGSGSITWTDDERTANEVEMTVA
FT                   LRELTDGAGTMGAFSSTATFNFTYQ"
FT   gene            complement(209581..212247)
FT                   /locus_tag="SPAB_00230"
FT   CDS_pept        complement(209581..212247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00230"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB0230105 0.0039 putative CLK family
FT                   kinase K08287; COG: COG3188 P pilus assembly protein, porin
FT                   PapC; Psort location: OuterMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65672"
FT                   /inference="protein motif:HMMPfam:IPR000015"
FT                   /inference="protein motif:ScanRegExp:IPR000015"
FT                   /protein_id="ABX65672.1"
FT                   /translation="MTLSQSRMKKTVQNVSTTRTMPKKTLLAMCCALFYSQPGLAADIV
FT                   EYDSTFLMGDGATSIDVSRYSNGNPTPAGTYTVRVFVNEKAVASQTIPFIDIGKKSAEA
FT                   CLTMKNLAQLHIKSPQNVGEKAILKKGDDESSDCLNLPALIEQSSVTFDMGDQRLDIVV
FT                   PQAWVNKSYDGYVEPSLWENGIPAALLSYNINGYHNTNHGVDNDNMYAAFNTGINLGAW
FT                   RFRANGNYNWNNNSGSNFDFQNRYIQRDLTALRSQLMLGEAYTTGETFDSVSIRGVRLY
FT                   SDSRMLPSQLANYAPVIRGVANTNAKVTITQGGYKIYESTVPPGPFEINDLSPSGYGSD
FT                   LIVTIEEADGSKRTFSQPFSSVMQMQKPGVGRWDVSAGEVNDDDLHDNPYVAQGTYYYG
FT                   LNNYLTAYTGVQATDNHYLAGLLGMGLNTPFGAIALDVTHSRTEIPDNKTYQGQSYRLT
FT                   WNKLIEATDTSFNVAAYRYSTQNYLGLNDALQLIDEAKYGDDDQRNTMNNFARLKNQIT
FT                   LSISQPLQYGETDYGSFYLSGSWTDYWATGDSRSDYTLGYGKGFSWGSMSVNLQRTWDE
FT                   DGKKDDSLYINLSIPLANLLGGESRRSGFNTLSTQMRTDFNGGHNLSMNSSGSSKDNML
FT                   NYSVNTGYTMQKEGKSISDIGGYASYQSPWGDISASASANNDSSRQYSLATNGGFVLHG
FT                   GGLTFTNDNFGNSDAIVLVKAPGAKGARINGGNSTIDRWGYGATNSLSAYRENLVNVDI
FT                   DTLENDVELKSTSATLVPRDGAVVLASFETDQGRSVILNMSRNDGKALPFGAEIYENDV
FT                   QIGNMGQGGQAFVRGISDAGELSVRWFEENQPVTCSATFALPATQQTVGSSQTLLLDHV
FT                   TCRVNNLKSNGIDNEKE"
FT   gene            complement(212247..212984)
FT                   /locus_tag="SPAB_00231"
FT   CDS_pept        complement(212247..212984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00231"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3121 P pilus assembly protein, chaperone
FT                   PapD; Psort location: Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65673"
FT                   /inference="protein motif:BlastProDom:IPR001829"
FT                   /inference="protein motif:FPrintScan:IPR001829"
FT                   /inference="protein motif:Gene3D:IPR001829"
FT                   /inference="protein motif:HMMPfam:IPR001829"
FT                   /inference="protein motif:ScanRegExp:IPR001829"
FT                   /inference="protein motif:superfamily:IPR008962"
FT                   /inference="similar to AA sequence:INSD:CAD01342.1"
FT                   /protein_id="ABX65673.1"
FT                   /translation="MSHSLKFTLSAIALTGALFSSASQADIIISGTRIIYDANKKDVSV
FT                   RLENKGKSPLLVQNWIDLGNDNAEPGSIKAPFAATPPVSRIEPKRGQSIKIMYTATESL
FT                   PKDRESVFWFNVLEVPPKANTNQEENKNLLQLAFRTRIKLFYRPTGLPGAPAEAAKQLK
FT                   WQVASEQGHAVLRADNPTPYYVSFNSATYTSGGKRYDVDATMVAPFGKAAFTVKGLQNA
FT                   SAGKLEFQSINDYGGIIAGSASL"
FT   gene            complement(213250..213843)
FT                   /locus_tag="SPAB_00232"
FT   CDS_pept        complement(213250..213843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00232"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3539 P pilus assembly protein, pilin FimA"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00232"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65674"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:HMMPfam:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:INSD:CAD01343.1"
FT                   /protein_id="ABX65674.1"
FT                   /translation="MKKVLLATAVFMALGSSSVMAVEGGRINFEGLVSAETCKKVVSSA
FT                   VGNSNIDGTVTLKTAHVSDVTAEVQNSTAGVNAEDFSIIIDCSDAGAGLVKSHLTMSSS
FT                   FSNTKGTLDNDETLTRSGIEAAKAVDIAVHHVDDANALSLVKINDPSNTMEESFTNGIA
FT                   TYNFKASYVKSSDAGASVTTGLVSTNAIYTFTYE"
FT   gene            complement(213854..213988)
FT                   /locus_tag="SPAB_00233"
FT   CDS_pept        complement(213854..213988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65675"
FT                   /protein_id="ABX65675.1"
FT                   /translation="MKKNSPQISFKQTYNISLFYIMKYTHKMCRPSLILLKWYIYLIL"
FT   gene            complement(214246..214725)
FT                   /locus_tag="SPAB_00234"
FT   CDS_pept        complement(214246..214725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0191 1.9e-73 folK; 2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine pyrophosphokinase K00950;
FT                   COG: COG0801
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65676"
FT                   /inference="protein motif:HMMPfam:IPR000550"
FT                   /inference="protein motif:HMMTigr:IPR000550"
FT                   /inference="protein motif:ScanRegExp:IPR000550"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX65676.1"
FT                   /translation="MTIAYIALGSNLASPLEQVNAALKAIANIPDSRIVAVSSFYRTPP
FT                   LGPQDQPDYLNAAVALDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGD
FT                   EVINTDRLTVPHYDMKNRGFMLWPLFEIAPKLRFPDDGVALTQLVHQHTPAPAYW"
FT   gene            complement(214722..216140)
FT                   /locus_tag="SPAB_00235"
FT   CDS_pept        complement(214722..216140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0184 2.6e-252 pcnB; poly(A) polymerase I
FT                   K00970; COG: COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65677"
FT                   /inference="protein motif:HMMPfam:IPR002646"
FT                   /inference="protein motif:HMMPIR:IPR012222"
FT                   /inference="protein motif:HMMTigr:IPR010206"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215171.1"
FT                   /protein_id="ABX65677.1"
FT                   /translation="MTLPRCAIFTRVANFCRKVLSREESEAEQAVARPHMTIIPREQHA
FT                   ISRKDISENALKVLYRLNKAGYEAYLVGGGVRDLLLGKKPKDFDVTTNATPDQVRKLFR
FT                   NCRLVGRRFRLAHVMFGPEIIEVATFRGHHEGSESDRTTSQRGQNGMLLRDNIFGSIEE
FT                   DAQRRDFTINSLYYSVADFTVRDYVGGMQDLQEGVIRLIGNPETRYREDPVRMLRAVRF
FT                   AAKLNMRISPETAEPIPRLATLLNDIPPARLFEESLKLLQAGNGFETYQQLREYHLFQP
FT                   LFPTITRYFTENGDSAMERIIALVLKNTDNRIRNEMRVNPAFLFAAMFWYPLLEMAQKI
FT                   AQESGLAYYDAFALAMNDVLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLM
FT                   EHPKFRAAFDLLELRAQVENNTELQRLAQWWAEFQASAPPEQKGMLNELDDDPAPRRRR
FT                   SRPRKRAPRREGTV"
FT   gene            complement(216281..217222)
FT                   /locus_tag="SPAB_00236"
FT   CDS_pept        complement(216281..217222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0185 3.2e-167 yadB; glutamyl-tRNA
FT                   synthetase; COG: COG0008 Glutamyl- and glutaminyl-tRNA
FT                   synthetases; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00236"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65678"
FT                   /inference="protein motif:FPrintScan:IPR000924"
FT                   /inference="protein motif:HMMPanther:IPR000924"
FT                   /inference="protein motif:HMMPfam:IPR000924"
FT                   /inference="similar to AA sequence:INSD:AAL19149.1"
FT                   /protein_id="ABX65678.1"
FT                   /translation="MTGGSFPALFFIARSMTDSHYIGRFAPSPSGELHFGSLIAALGSY
FT                   LQARAQRGIWRVRIEDIDPPREVPGAAATILRQLEHYGLHWDGEVLWQSQRHEAYREAL
FT                   AWLHEQGLSYYCTCPRSRIQRLGGIYDGHCRTLYHGPENAAVRIKQQHPVMRFHDALRG
FT                   DIQADPQLASEDFIIHRRDGLFAYNLAVVVDDHFQGVTEIVRGADLIEPTVRQLSLYKQ
FT                   FGWRVPGYVHLPLALNEQGAKLSKQNHAPALATGDPRPVLVQALRFLGQRAVVAWQEMS
FT                   VEELLRFAVEHWRLAAVPTSANVNPAFSNASR"
FT   gene            complement(217246..217701)
FT                   /locus_tag="SPAB_00237"
FT   CDS_pept        complement(217246..217701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00237"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1734 DnaK suppressor protein; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65679"
FT                   /inference="protein motif:FPrintScan:IPR000962"
FT                   /inference="protein motif:HMMPfam:IPR000962"
FT                   /inference="protein motif:HMMTigr:IPR012784"
FT                   /inference="protein motif:ScanRegExp:IPR000962"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:INSD:AAV76225.1"
FT                   /protein_id="ABX65679.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   gene            complement(217878..218582)
FT                   /locus_tag="SPAB_00238"
FT   CDS_pept        complement(217878..218582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00238"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1489 DNA-binding protein, stimulates sugar
FT                   fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65680"
FT                   /db_xref="GOA:A9MZU5"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MZU5"
FT                   /inference="protein motif:BlastProDom:IPR005224"
FT                   /inference="protein motif:HMMPfam:IPR005224"
FT                   /inference="protein motif:HMMTigr:IPR005224"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459192.1"
FT                   /protein_id="ABX65680.1"
FT                   /translation="MLFSPPLQRATLIQRYKRFLADVITPDGTTLTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSENTKRKYPHTWELTETQSGAFICVNTLRANQLTKEAIQENRLPALAGY
FT                   NILKSEVKYGAERSRIDFMLQADFRPDCYIEVKSVTLAEKENGYFPDAITERGQKHLRE
FT                   LMGVAAAGHRAVVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQ
FT                   KMELNEPVPITL"
FT   gene            complement(218599..219129)
FT                   /locus_tag="SPAB_00239"
FT   CDS_pept        complement(218599..219129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0188 8.7e-94 ligT; 2'-5' RNA ligase
FT                   K01975; COG: COG1514 2-5 RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65681"
FT                   /inference="protein motif:HMMPfam:IPR004175"
FT                   /inference="protein motif:HMMTigr:IPR004175"
FT                   /inference="protein motif:superfamily:IPR009097"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459193.1"
FT                   /protein_id="ABX65681.1"
FT                   /translation="MSEPKRLFFAIDLPDDARAQIIAWRAAHFASEDGRPVAAANLHLT
FT                   LAFLGDVSSDKQRALAQLAGRIRQPGFTLHLDDAGQWLRSRVVWLGMRQPPRGLLQLAN
FT                   MLRAQAARSGCYQSPQPFHPHITLLRDASHTVAIPPPGFCWSFPVTSFALYASSYGQGR
FT                   TRYAELQRWTLGE"
FT   gene            219157..221631
FT                   /locus_tag="SPAB_00240"
FT   CDS_pept        219157..221631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0189 0. hrpB; helicase, ATP-dependent
FT                   K03579; COG: COG1643 HrpA-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65682"
FT                   /inference="protein motif:HMMPfam:IPR001650"
FT                   /inference="protein motif:HMMPfam:IPR007502"
FT                   /inference="protein motif:HMMPfam:IPR011545"
FT                   /inference="protein motif:HMMPfam:IPR013689"
FT                   /inference="protein motif:HMMPIR:IPR010225"
FT                   /inference="protein motif:HMMSmart:IPR001650"
FT                   /inference="protein motif:HMMSmart:IPR014001"
FT                   /inference="protein motif:HMMTigr:IPR010225"
FT                   /inference="protein motif:ScanRegExp:IPR001241"
FT                   /protein_id="ABX65682.1"
FT                   /translation="MLQCGAKKVNPVEPFVTSLPVAAVLPELLTALKTAPQVLLSAPTG
FT                   AGKSTWLPLQLLQQGPVAGKILLLEPRRLAARNVAQRLAEALNEKPGETVGYRMRAQSC
FT                   VGPRTRLEVVTEGVLTRMIQRDPELRGVGLVILDEFHERSLQADLALALLLDIQQGLRD
FT                   DLRLLIMSATLDNDRLCQRLPDAPTIVSEGRAFPVERRYQPLAAHLRFDEAVAMATAEL
FT                   LRNENGSLLLFLPGVGEIQRVHEHLASRVGSDVLLCPLYGALSLEAQRKAIVPAPAGMR
FT                   KVVLATNIAETSLTIEGIRLVVDSAQERVARFDARTGLTRLVTQRISQASMTQRAGRAG
FT                   RLAPGICLHLLAKEQAERAAAQSDPEILHSDLSGLLMEVLQWGCHDPASLFWLDRPPEV
FT                   NLQAARRLLLMLGALEGERLSARGRKMAATGNDPRLAAMLVNAGEGDSAATAAMLAAIL
FT                   EDPPRGGGTDLSVVFSRRQPGWQQRSQQLLKRLQVRNGEPDSALIMPLLARAFSDRIAR
FT                   RRGQEGRYQLANGMGAMLDVDDALGRHEWLIAPLLLQGSASPDARILLAQPLDIASLIQ
FT                   ACPDLLRQSDTVEWDEAQGTLKAWRRMRIGQLTVSVQPLAKPSEEELHQAMLNGIRDKG
FT                   LSVLNWTPEAEQFRLRLHCAAKWLPEYDWPAVDEASLLATLENWLLPHMTGVQSLRSLK
FT                   SLNVTQALRGLLDYAMLQRLDSELPGHYTVPTGSRITIRYHEDNPPALAVRMQEMFGEA
FT                   KTPTIAQGRVPLVLELLSPAQRPLQITRDLSAFWQGAYREVQKEMKGRYPKHVWPDDPA
FT                   NTAPTRRTKKYS"
FT   gene            complement(221666..221773)
FT                   /locus_tag="SPAB_00242"
FT   CDS_pept        complement(221666..221773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00242"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65684"
FT                   /protein_id="ABX65684.1"
FT                   /translation="MLFLRNIQAQRPDSLFFRQTTEEEISQFTLLPDGD"
FT   gene            221772..224294
FT                   /locus_tag="SPAB_00241"
FT   CDS_pept        221772..224294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0190 0. mrcB; transpeptidase of
FT                   penicillin-binding protein 1b (peptidoglycan synthetase)
FT                   K05365; COG: COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein); Psort location:
FT                   CytoplasmicMembrane, score:9.59"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65683"
FT                   /inference="protein motif:BlastProDom:IPR001264"
FT                   /inference="protein motif:HMMPfam:IPR001264"
FT                   /inference="protein motif:HMMPfam:IPR001460"
FT                   /inference="protein motif:HMMTigr:IPR011813"
FT                   /inference="protein motif:superfamily:IPR012338"
FT                   /protein_id="ABX65683.1"
FT                   /translation="MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMPR
FT                   KGKGKGRKPRGKRGWLWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVYGR
FT                   MVNLEPDMPVSKNEMVKLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQ
FT                   VRARLTFSDGRLETIVNLDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPDLLVD
FT                   TLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWR
FT                   KANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLD
FT                   QQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPR
FT                   GGVISPQPAFMQMVRQELQAKLGDKIKDLSGVKIFTTFDSVAQDAAEKAVVEGIPALKK
FT                   QRKLSDLETAMVVVDRFSGEVRAMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALS
FT                   QPNLYRLNTWIADAPISLRQPNGQVWSPQNDDRRYSESGKVMLVDALTRSMNVPTVNLG
FT                   MALGLPAVTDTWTKLGVPKDQLNPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSAL
FT                   RSVIAEDGKVLYQSYPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPGLHLAGKT
FT                   GTTNNNVDTWFAGIDGSQVTITWVGRDNNQPTKLYGASGAMAIYQRYLANQTPTPLVLT
FT                   PPEDVVDMGVDYDGNFVCSGGMRTLPAWTDDPNTLCQQGEMMQQQQQPSGNPFDQSSQP
FT                   QQPAQQQPPKEEKSDGVAGWIKEMFGGN"
FT   gene            224321..224428
FT                   /locus_tag="SPAB_00243"
FT   CDS_pept        224321..224428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65685"
FT                   /protein_id="ABX65685.1"
FT                   /translation="MLTRSTPLRPHYVRRRPNKTLTSPSGKSSINNISV"
FT   gene            complement(224433..224573)
FT                   /locus_tag="SPAB_00244"
FT   CDS_pept        complement(224433..224573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65686"
FT                   /protein_id="ABX65686.1"
FT                   /translation="MKVNDNVNDNYYYNRSMIGEISSQWQAIRGPTKTKGLRNNQMKRK
FT                   G"
FT   gene            224587..226830
FT                   /locus_tag="SPAB_00245"
FT   CDS_pept        224587..226830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgl:SG1838 8.5e-06 putative mannonate
FT                   dehydratase K01686; COG: COG1629 Outer membrane receptor
FT                   proteins, mostly Fe transport; Psort location:
FT                   OuterMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65687"
FT                   /inference="protein motif:HMMPfam:IPR000531"
FT                   /inference="protein motif:HMMPfam:IPR012910"
FT                   /inference="protein motif:HMMTigr:IPR010105"
FT                   /inference="protein motif:ScanRegExp:IPR010916"
FT                   /protein_id="ABX65687.1"
FT                   /translation="MARLKTAQPNSSLRKIAVVVATAVSGMSVYAQAAVQPKEETITVT
FT                   AAPAAQESAWGPAATIAARQSATATKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALS
FT                   YTPGVAVGTRGASNTYDYLIIRGFAADGQSQNNYLNGLKMQGNFYNDAVIDPYMLERAE
FT                   VMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEIQFKMGTDSLFQTGFDFSDALDEEGV
FT                   YSYRLTGLARSANAQQDRAEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDIFTVRQNLRYAENKV
FT                   SQNSVYGYGVCSDPANGYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFA
FT                   TGEVDHTLLTGVDFMRMRNDINAWFGYDDSVPLLDLYNPVYTDFDFASRDPATSGPYQI
FT                   LNKQKQTGLYVQDQAQWDKVLVTLGGRYDWADQESLNRTTGITSKRDDKQFTWRGGVNY
FT                   LFDNGITPYFSYSESFEPASQTGENGKIFAPSKGKQYEAGVKYVPNDRPIVITGAVYQL
FT                   TKTNNLMADPAGSFFSVEGGEIRARGVELEAKAALSASINVVGSYTYTDAEYTTDTTYK
FT                   GNTPAQVPKHMASLWGDYTFFDGPLSGLTLGTGGRFTGSSYGDPANSFKVGSYTVVDAL
FT                   VRYDLARVGMAGSNVALHVNNLFDREYVASCFQTYGCFWGAERQVVATATFRF"
FT   gene            226879..227676
FT                   /locus_tag="SPAB_00246"
FT   CDS_pept        226879..227676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0192 3.0e-139 fhuC; ABC superfamily
FT                   (atp_bind), hydroxymate-dependent iron transport K02013;
FT                   COG: COG1120 ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65688"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459197.1"
FT                   /protein_id="ABX65688.1"
FT                   /translation="MQENHIHSDTTFALRSVAFRVPGRTLLHPLSLTFPAGRVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSEGDILLDNQPLASWSSKAFARKVAYLPQQLPQAEGMTVRE
FT                   LVAIGRYPWHGALGRFGVADREKVDEAITLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQQRGLTVVAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAELMRSDTLEQIYGIPMGILPHPAGAAPVSFVY"
FT   gene            227676..228566
FT                   /locus_tag="SPAB_00247"
FT   CDS_pept        227676..228566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00247"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system, periplasmic component; Psort location: Periplasmic,
FT                   score:9.76"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65689"
FT                   /inference="protein motif:HMMPfam:IPR002491"
FT                   /inference="protein motif:ScanRegExp:IPR013838"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459198.1"
FT                   /protein_id="ABX65689.1"
FT                   /translation="MRDLYPLTRRRLLTAMALSPLLWQMNTAQAAAIDPRRIVALEWLP
FT                   VELLLALGITPYGVADVPNYKLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEKLARIAPGRGFDFSDGKKPLAVARRSLVELAQTLNLEAAAEKHLAQYDRFIA
FT                   SQKPHFIRRGGRPLLMTTLIDPRHMLVLGPNCLFQEVLDEYGIVNAWQGETNFWGSTAV
FT                   SIDRLAMYKEADVICFDHGNNTDMNALMATPLWQAMPFVRAGRFHRVPAVWFYGATLST
FT                   MHFVRILNNVLGGKA"
FT   gene            228563..230620
FT                   /locus_tag="SPAB_00248"
FT   CDS_pept        228563..230620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A3311 0.0022 enoyl-CoA hydratase
FT                   K01692; COG: COG0609 ABC-type Fe3+-siderophore transport
FT                   system, permease component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65690"
FT                   /inference="protein motif:HMMPfam:IPR000522"
FT                   /protein_id="ABX65690.1"
FT                   /translation="MSRKREMPDGGAKSVLSDLRFGRFVGRIRRSRHPALLLLALFVAA
FT                   CWLTWVNFSVALPRSQWQQAIWSPDIDIIEQMIFHYSLLPRLAISLLVGAGLGLVGVLF
FT                   QQVLRNPLAEPTTLGVATGAQLGITVTTLWAIPGALATQFAALTGACIVGALVFGVAWG
FT                   KRLSPVTLILAGLVVSLYCGAINQLLVIFHHDQLQSMFLWSTGTLTQTDWSGVQRLWPQ
FT                   LLGGVMLTLLLLRPMTLMGLDDGVARNLGLALSLARLAALSLAIVLSALLVNAVGIIGF
FT                   IGLFAPLLAKMLGARRLLARLMLAPLIGALILWLSDQIILWLTRVWMEVSTGSVTALIG
FT                   APLLLWLLPRLKSMSAPDMNASDRVAAERRHVLAFAVAGGALLLLATWGALSFGRDAHG
FT                   WTWASGTLLEELMPWRWPRILAALMAGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAF
FT                   GVVLMLFLVPGNAFGWLLPAGSLGAAATLLIIMLAAGRGGFSPQRMLLAGMALSTAFTM
FT                   LLMTLQASGDPRMAEVLTWIAGSTYNATGGQVTRTAIVMVILLAIVPLCRRWLTILPLG
FT                   GDAARAVGMALTPSRIALLALAACLTATATMTIGPLSFVGLMAPHIARMLGFRRTMPHM
FT                   VISALAGGVLLVFADWCGRMALFPYQIPAGLLSSFIGAPYFIYLLRKQSR"
FT   gene            complement(230808..230921)
FT                   /locus_tag="SPAB_00249"
FT   CDS_pept        complement(230808..230921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65691"
FT                   /protein_id="ABX65691.1"
FT                   /translation="MPQFIINVSGLDMLKLVTLFRRQRRATEIAHDLSIQK"
FT   gene            complement(231024..231149)
FT                   /locus_tag="SPAB_00250"
FT   CDS_pept        complement(231024..231149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65692"
FT                   /protein_id="ABX65692.1"
FT                   /translation="MLNYIFFVYSWQLIYFNRVVFYYFDKKIIFYYRSFIMKIYY"
FT   gene            231200..231343
FT                   /locus_tag="SPAB_00251"
FT   CDS_pept        231200..231343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65693"
FT                   /protein_id="ABX65693.1"
FT                   /translation="MLYIQYCNSDLFLFILTCLLFFWLSRLACFVCFLNGKNIYYLILI
FT                   IL"
FT   gene            231560..232120
FT                   /locus_tag="SPAB_00252"
FT   CDS_pept        231560..232120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00252"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3539 P pilus assembly protein, pilin FimA;
FT                   Psort location: Extracellular, score:9.72"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00252"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65694"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:HMMPfam:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:INSD:AAL19159.1"
FT                   /protein_id="ABX65694.1"
FT                   /translation="MNTAVKAAVAAALVMGVSSFANAAGSNTGTVTFTGTIEDSPCSIV
FT                   VGDEHQTVNLGHIGTGSLMGGKESSKVDFHIGLENCAFTTEKEASTVFSAIGNESSANP
FT                   GSVALMRIGGGEMAGSSIVIGNHLGSAIKLGDAYSENLTMNGSVAAAKQTLNFKAWVKG
FT                   DSAATTIDTGEFSSTVNFTISYL"
FT   gene            232206..234863
FT                   /locus_tag="SPAB_00253"
FT   CDS_pept        232206..234863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00253"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3188 P pilus assembly protein, porin PapC;
FT                   Psort location: OuterMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65695"
FT                   /inference="protein motif:HMMPfam:IPR000015"
FT                   /inference="protein motif:ScanRegExp:IPR000015"
FT                   /inference="protein motif:ScanRegExp:IPR002092"
FT                   /protein_id="ABX65695.1"
FT                   /translation="MAHYKKFRLSTLAAVVGIVLAVGPENSYAEAPIQFNTRFLDVKDD
FT                   ASLDLSRFSRKGYIMPGSYHLQVLVNQSQIAQDNVITYSVDNNDPDNTYPCLSPELVSL
FT                   LGLKPEIADKMIWINAGQCLQPDQLEGMETQTDLSQSTLTVIIPQAYLEYSDEEWDPPS
FT                   RWDEGIPGVLFDYNVNSQWRHAEHDDGDEYDISGNGTVGANLGAWRLRADWQANYRHEN
FT                   DSEDKDNFGSSSEQNWDWNRYYAWRAIPQLRAQLTLGEGSLESDIFDGFNYVGGSLITD
FT                   DQMLPPNLRGYAPDISGVARTNAKVTVTQRGRVIYESQVPAGPFRIQDINETVSGDLHV
FT                   KIEEQSGQVQEYDVSTASIPFLTRPGQVRYKLAAGRPQDWDHNMEGGFFTSAEASWGIA
FT                   NGWSLYGGAIGEQDYQALALGLGRDLALLGAFSVDVTHSRATLPEGSAYGDGTIQGNSF
FT                   RASYAKDFDDIDSRLTFAGYRFSEENYMTMDEFIDTHNDDNDRQRTGHDKEMYTLTYSQ
FT                   NFSAINVNAYINYTHRTYWNQPNQDSYNLTLSHYFDVGEVRGISLSVNGFRNEYDNERD
FT                   DGVYVSLSIPWGNNRTLSYNGSFSDDNNSNQVGYYERIDDRNNYQINAGRADNGATLDG
FT                   YYRHQASYADIDVSANYQEGDYTSDGLNIQGGATLTAKGGALHRTSVNGGSRLLVDVGD
FT                   EANVPISGYSTPVYTNAFGKAVIVDVNDYYRNLVKIDITQLPEDAEATLSIAQATLTEG
FT                   AIGYRRMEVLSGKKAMASIRLRDGGTPPFGAEVYNSRQQQLGIVGEDGSVYLIGINPGE
FT                   RLQVTWEGKTQCEAALPDPLPGDLFSGLLLPCIGDASSPEATQPEEKPLLQLHTQRRTS
FT                   STQPEALSSRYPTH"
FT   gene            234881..235633
FT                   /locus_tag="SPAB_00254"
FT   CDS_pept        234881..235633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00254"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3121 P pilus assembly protein, chaperone
FT                   PapD; Psort location: Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65696"
FT                   /inference="protein motif:BlastProDom:IPR001829"
FT                   /inference="protein motif:Gene3D:IPR001829"
FT                   /inference="protein motif:HMMPfam:IPR001829"
FT                   /inference="protein motif:ScanRegExp:IPR001829"
FT                   /inference="protein motif:superfamily:IPR008962"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215184.1"
FT                   /protein_id="ABX65696.1"
FT                   /translation="MMPLKRYNLAAVLLLLLGGYGSAQAAIAPDRTRLVFRGEDKSISV
FT                   DLKNANSKLPYLAQSWVEDEKGVKITSPLIVVPPVQRIEPSAIGQVKIQGMPALASLPQ
FT                   DRETLFYYNVREIPPQSDKPNTLQIALQTRIKVFYRPQALSKIDMQHPWQYKITLQRQG
FT                   NGYQVSNPTGYYVVLSNASSRMDGTPARGFSPLVIAPKSNVTLGGDASELGHSPVLTYV
FT                   NDYGARLPLIFSCTDNSCAVDEAKSRKS"
FT   gene            235652..236164
FT                   /locus_tag="SPAB_00255"
FT   CDS_pept        235652..236164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00255"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13897 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65697"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:INSD:AAC64155.1"
FT                   /protein_id="ABX65697.1"
FT                   /translation="MRQWRLRLGTVTCAAMLSTVSMPLAAGSKTVNMTLTIVVNAAPPC
FT                   TVTGGEVEFGNVLTTKVDGVNYRQAVGYRLSCNGRVSDYLKLQIQGNAVTINGESVLQT
FT                   DVDGLGIRLQTATDGALISPGNTQWLSFQYSGGSGPAIEAIPVKNNGVTLTGGAFNAGA
FT                   TLVVDYQ"
FT   gene            236161..236637
FT                   /locus_tag="SPAB_00256"
FT   CDS_pept        236161..236637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00256"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09769 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65698"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:HMMPfam:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:INSD:AAC64156.1"
FT                   /protein_id="ABX65698.1"
FT                   /translation="MKKIVLTMLMGGSLAAQAADNLKFHGTLISPPNCTINNDQTIDVE
FT                   FGNLLINKIDGTRYAQNVPYEITCDSTVRDETMAMTLTLSGSVSDFNPAAVNTSVAGLG
FT                   IELRQNDQPFTLGSTITVNEQSIPVLKAIPVKKSGASLKEGGFDATATLQVDYQ"
FT   gene            236637..237167
FT                   /locus_tag="SPAB_00257"
FT   CDS_pept        236637..237167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00257"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG23107 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65699"
FT                   /inference="protein motif:Gene3D:IPR000259"
FT                   /inference="protein motif:HMMPfam:IPR000259"
FT                   /inference="protein motif:superfamily:IPR008966"
FT                   /inference="similar to AA sequence:INSD:AAL19164.1"
FT                   /protein_id="ABX65699.1"
FT                   /translation="MAKRQALLHGAACILCGALILPVSAADNLHFSGSLVASPCTLTMQ
FT                   GTGIAEVDFSSLDSSDFTPDGQSARKPLVFELTDCDSALSNGVQVTFTGTEATGMRGIL
FT                   AIDSHSGASGIGIGIETLSGVPVGMNDEEGAIFTLVTGNNALNLNAWVQRLPGEDLIPG
FT                   TFFASALVTFEYL"
FT   gene            237164..238006
FT                   /locus_tag="SPAB_00258"
FT   CDS_pept        237164..238006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00258"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06206 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65700"
FT                   /inference="similar to AA sequence:INSD:AAL19165.1"
FT                   /protein_id="ABX65700.1"
FT                   /translation="MMKIIRTLFLLLIAVYGSSVVAKPMLKATFSSTTMYYGIGPNSDK
FT                   SIVAEVTIATPEGVYYGSWNLSGHRKGETLTADSWSGPEPAPKVVLKDFDNTVSRSACK
FT                   NLPSNWRGCGSFTLEITVQSDDYGCPWLASSHIVATAFITNETYSPPDTRSSVCPKVPV
FT                   DTFDISWDANVSKQKTTLMLDATGGTVNRTLHTYLMEGGKLCDGSKFDNRGAYCRFVSS
FT                   GITLNVLGCDQSSVTTSAVDHPITDVELHDINVAVNTRNIGSGQFTSTCSFQYIIGEL"
FT   gene            complement(238114..239394)
FT                   /locus_tag="SPAB_00259"
FT   CDS_pept        complement(238114..239394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0203 2.0e-227 hemL;
FT                   glutamate-1-semialdehyde 2,1-aminomutase K01845; COG:
FT                   COG0001 Glutamate-1-semialdehyde aminotransferase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00259"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65701"
FT                   /db_xref="GOA:A9N0P9"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0P9"
FT                   /inference="protein motif:HMMPanther:IPR005814"
FT                   /inference="protein motif:HMMPfam:IPR005814"
FT                   /inference="protein motif:HMMTigr:IPR004639"
FT                   /inference="protein motif:ScanRegExp:IPR005814"
FT                   /inference="similar to AA sequence:INSD:CAD01356.1"
FT                   /protein_id="ABX65701.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGIHETLDELTTRLAEGLLEAAE
FT                   EANIPLVVNHVGGMFGIFFTDAESVTYYQDVMACDVERFKRFFHLMLEEGVYLAPSAFE
FT                   AGFMSVAHSEEDINNTIDAARRVFAKL"
FT   gene            239421..239564
FT                   /locus_tag="SPAB_00260"
FT   CDS_pept        239421..239564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65702"
FT                   /protein_id="ABX65702.1"
FT                   /translation="MNTRYSKLFREGYESFTHLKQYDLQGIFTALASRMPTLDLYYQLM
FT                   IF"
FT   gene            239564..240985
FT                   /locus_tag="SPAB_00261"
FT   CDS_pept        239564..240985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpr:CPR_1400 2.7e-58 chloride channel protein
FT                   K01529; COG: COG0038 Chloride channel protein EriC; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65703"
FT                   /db_xref="GOA:A9N0Q1"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0Q1"
FT                   /inference="protein motif:FPrintScan:IPR001807"
FT                   /inference="protein motif:HMMPanther:IPR001807"
FT                   /inference="protein motif:HMMPfam:IPR001807"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215190.1"
FT                   /protein_id="ABX65703.1"
FT                   /translation="MKTDTSTFLAQQIVRLRRRDQIRRLMQRDKTPLAILLMAAVVGTL
FT                   TGLVGVAFEKAVSWVQNMRIGALVQVADHAFLLWPLAFILSALLAMVGYFLVRKFAPEA
FT                   GGSGIPEIEGALEELRPVRWWRVLPVKFIGGMGTLGAGMVLGREGPTVQIGGNLGRMVL
FT                   DVFRMRSAEARHTLLATGAAAGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAVFTGV
FT                   IMSSIVFRIFNGEAPIIEVGKLSDAPVNTLWLYLILGIIFGCVGPVFNSLVLRTQDMFQ
FT                   RFHGGEIKKWVLMGGAIGGLCGILGLIEPEAAGGGFNLIPIAAAGNFSVGLLLFIFITR
FT                   VVTTLLCFSSGAPGGIFAPMLALGTLLGTAFGMAAAVLFPQYHLEAGTFAIAGMGALMA
FT                   ASVRAPLTGIVLVLEMTDNYQLILPMIITCLGATLLAQFLGGKPLYSTILARTLAKQDA
FT                   EQAAKNQNAPAGENT"
FT   gene            241067..241411
FT                   /locus_tag="SPAB_00262"
FT   CDS_pept        241067..241411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00262"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0316 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65704"
FT                   /db_xref="GOA:A9N0Q2"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0Q2"
FT                   /inference="protein motif:BlastProDom:IPR000361"
FT                   /inference="protein motif:HMMPanther:IPR000361"
FT                   /inference="protein motif:HMMPfam:IPR000361"
FT                   /inference="protein motif:HMMTigr:IPR000361"
FT                   /inference="protein motif:ScanRegExp:IPR000361"
FT                   /inference="similar to AA sequence:INSD:AAL19168.1"
FT                   /protein_id="ABX65704.1"
FT                   /translation="MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
FT   gene            complement(241512..242135)
FT                   /locus_tag="SPAB_00263"
FT   CDS_pept        complement(241512..242135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00263"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2860 Predicted membrane protein; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65705"
FT                   /inference="protein motif:HMMPfam:IPR005115"
FT                   /inference="similar to AA sequence:INSD:AAO67937.1"
FT                   /protein_id="ABX65705.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDNGPVFWVKDPTDLVVAMVTSMLTILLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFLAETGPLVAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AFYTFSVPLESASMMGMVVTLFIRLAAIRWHLKLPTFALDENGR"
FT   gene            complement(242172..242972)
FT                   /locus_tag="SPAB_00264"
FT   CDS_pept        complement(242172..242972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00264"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system, periplasmic component; Psort location: Periplasmic,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65706"
FT                   /inference="protein motif:HMMPfam:IPR002491"
FT                   /inference="similar to AA sequence:INSD:AAX64112.1"
FT                   /protein_id="ABX65706.1"
FT                   /translation="MAKQMFRALVALLLTLPVWLYAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPEAQKIEQVSTWQGMNLERIVAMKPDLVVAWRGGNAERQVNQLTSLGIKV
FT                   MWVDAVSIEQIADTLRQLAAWSPQPEKAQQAAQTLLNEYAALNAEYAGKAKKRVFLQFG
FT                   MNPLFTSGKGSIQHQVLTTCGGENVFADSRVPWPQVSREQVLARHPQAIIVAGKAGEIL
FT                   KIEQYWGNLLKIPVIPLNSDWFERASPRIILAAKQLCNALSQVN"
FT   gene            complement(242965..243663)
FT                   /locus_tag="SPAB_00265"
FT   CDS_pept        complement(242965..243663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY0229 8.5e-119 pfs, mtn;
FT                   5'-methylthioadenosine nucleosidase /
FT                   S-adenosylhomocysteine nucleosidase K01244:K01243; COG:
FT                   COG0775 Nucleoside phosphorylase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65707"
FT                   /db_xref="GOA:A9N0Q5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0Q5"
FT                   /inference="protein motif:HMMPfam:IPR000845"
FT                   /inference="protein motif:HMMTigr:IPR010049"
FT                   /inference="similar to AA sequence:SwissProt:P60216"
FT                   /protein_id="ABX65707.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMV
FT                   ETLVQKLAHG"
FT   gene            243706..245265
FT                   /locus_tag="SPAB_00266"
FT   CDS_pept        243706..245265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0209 3.7e-276 dgt;
FT                   deoxyguanosinetriphosphate triphosphohydrolase K01129; COG:
FT                   COG0232 dGTP triphosphohydrolase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65708"
FT                   /inference="protein motif:HMMPfam:IPR006674"
FT                   /inference="protein motif:HMMSmart:IPR003607"
FT                   /inference="protein motif:HMMTigr:IPR006261"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454816.1"
FT                   /protein_id="ABX65708.1"
FT                   /translation="MRLWGSAFLRRGEDMASIDFRNKINWHRRYRSPQGVKTEHEILRI
FT                   FESDRGRIINSPAIRRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEVLSRLKE
FT                   QNRLEEYGLDALTGPFESIVEMACLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQP
FT                   LTHDRCVVSSLRLQEGEENLNDIRRKVRQDICHFEGNAQGIRLVHTLMRMNLTWAQVGG
FT                   ILKYTRPAWWRGPVPDSHRYLMKKPGYYLSEEKYIARLRKELQLAPYSRFPLTWIMEAA
FT                   DDISYCVADLEDAVEKRIFSVEQLYHHLYHAWGHHEKDSLFELVVGNAWEKSRANTLSR
FT                   STEDQFFMYLRVNTLNKLVPYAAQRFIDNLPQIFAGTFNQALLEDASGFSRLLELYKNV
FT                   AVEHVFSHPDVEQLELQGYRVISGLLDIYQPLLSLSLNDFRELVEKERLKRFPIESRLF
FT                   QKLSTRHRLAYVEVVSKLPTDSAEYPVLEYYYRCRLIQDYISGMTDLYAWDEYRRLMAV
FT                   EQ"
FT   gene            245395..246822
FT                   /locus_tag="SPAB_00267"
FT   CDS_pept        245395..246822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0215 6.0e-244 htrA; protease DO
FT                   precursor; heat shock protein HtrA K04771; COG: COG0265
FT                   Trypsin-like serine proteases, typically periplasmic,
FT                   contain C-terminal PDZ domain; Psort location: Periplasmic,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00267"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65709"
FT                   /inference="protein motif:FPrintScan:IPR001940"
FT                   /inference="protein motif:HMMPfam:IPR001254"
FT                   /inference="protein motif:HMMPfam:IPR001478"
FT                   /inference="protein motif:HMMSmart:IPR001478"
FT                   /inference="protein motif:HMMTigr:IPR011782"
FT                   /inference="protein motif:superfamily:IPR001478"
FT                   /inference="protein motif:superfamily:IPR009003"
FT                   /inference="similar to AA sequence:INSD:AAL19173.1"
FT                   /protein_id="ABX65709.1"
FT                   /translation="MKKTTLAMSALALSLGLALSPLSATAAETSSSAMTAQQMPSLAPM
FT                   LEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQDGSPFQNSPFCQGGGNGGN
FT                   GGQQQKFMALGSGVIIDAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPRSDI
FT                   ALIQIQNPKNLTAIKLADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNVENY
FT                   ENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQM
FT                   VEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSL
FT                   NGKPISSFAALRAQVGTMPVGSKISLGLLREGKAITVNLELQQSSQSQVDSSTIFSGIE
FT                   GAEMSNKGQDKGVVVSSVKANSPAAQIGLKKGDVIIGANQQPVKNIAELRKILDSKPSV
FT                   LALNIQRGDSSIYLLMQ"
FT   gene            246975..248132
FT                   /locus_tag="SPAB_00268"
FT   CDS_pept        246975..248132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_2682 5.9e-79 transcriptional
FT                   regulator, CdaR K01694; COG: COG3835 Sugar diacid
FT                   utilization regulator; Psort location: CytoplasmicMembrane,
FT                   score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65710"
FT                   /inference="protein motif:HMMPfam:IPR008599"
FT                   /inference="similar to AA sequence:INSD:AAL19174.1"
FT                   /protein_id="ABX65710.1"
FT                   /translation="MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIG
FT                   ELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLRKY
FT                   GELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALVEWAQRLGIDLNQP
FT                   RVAAVVEVDSGQLGVDSAMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNSFGRW
FT                   DAEDHRKRVEQLISRMKENGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQRMPES
FT                   RSYFYQDLMLPVLLDSLRGGWQANELARPLVKLKAMDNNGLLRRTLTAWFRHNVQPLAT
FT                   SKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEPR"
FT   gene            complement(248221..248607)
FT                   /locus_tag="SPAB_00269"
FT   CDS_pept        complement(248221..248607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00269"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09673 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65711"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0Q9"
FT                   /inference="similar to AA sequence:INSD:CAD01365.1"
FT                   /protein_id="ABX65711.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRGEFFAKS
FT                   VKFKYPRQRKTVVADGIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKRKILDDL
FT                   RHLESVVANKISEIEADLDKLTRK"
FT   gene            complement(248622..248729)
FT                   /locus_tag="SPAB_00270"
FT   CDS_pept        complement(248622..248729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65712"
FT                   /protein_id="ABX65712.1"
FT                   /translation="MLMTLPRRLLRSTALFLYTLVAKNQFFVNYSKVIV"
FT   gene            248854..250155
FT                   /locus_tag="SPAB_00271"
FT   CDS_pept        248854..250155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00271"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65713"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215199.1"
FT                   /protein_id="ABX65713.1"
FT                   /translation="MSGTYNATIRRVVVSAWIGNSIEYYDFLLYGLASALVFGPLFFPG
FT                   ASPLTATLSSFASFGVGFISRPLGALFFGNRGDTLGRKNTLLITLGGMGAVTFLIGCLP
FT                   SYASIGALAPALLVILRFLQGFMVGGEWGGAMLMVVEYAAGKHRGRLSALSQTGGLTGQ
FT                   LLATGVFIVVTQLPKEALLSWGWRIPFLLSALLVLPGLYMRHRLDETPVFRAFKKQQAI
FT                   NHRQQREERPVVKVVREQWRSILLIIILRFAESVPFFLATVFAVSWATTQLGIASLTIL
FT                   YIVMFTCLLAYPMHVLFGIMSDRRGCRQVYIFGALFVAAMAFPFFWLLESRSLILMTMG
FT                   YVLLINIGHNSLNAVQPSFFAGLFYPPVRYSGSSIGAQLGAVVAGGFTPFIAKALSAVY
FT                   DNSWTLVAGYVVLTALASAFAAKIAPETVLPHSP"
FT   gene            complement(250192..251016)
FT                   /locus_tag="SPAB_00272"
FT   CDS_pept        complement(250192..251016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0219 3.6e-143 dapD;
FT                   2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase K00674; COG: COG2171
FT                   Tetrahydrodipicolinate N-succinyltransferase; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65714"
FT                   /db_xref="GOA:A9N0R2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0R2"
FT                   /inference="protein motif:HMMTigr:IPR005664"
FT                   /inference="protein motif:ScanRegExp:IPR001451"
FT                   /inference="protein motif:superfamily:IPR011004"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZRP4"
FT                   /protein_id="ABX65714.1"
FT                   /translation="MQQLQNVIETAFERRADITPANVDTVTREAVNQVISLLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIDGAESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEV
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   gene            complement(251046..253508)
FT                   /locus_tag="SPAB_00274"
FT   CDS_pept        complement(251046..253508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0220 0. glnD; [protein-PII]
FT                   uridylyltransferase K00990; COG: COG2844 UTP:GlnB (protein
FT                   PII) uridylyltransferase; Psort location:
FT                   CytoplasmicMembrane, score:9.27"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65716"
FT                   /inference="protein motif:HMMPfam:IPR002912"
FT                   /inference="protein motif:HMMPfam:IPR002934"
FT                   /inference="protein motif:HMMPfam:IPR006674"
FT                   /inference="protein motif:HMMPfam:IPR013546"
FT                   /inference="protein motif:HMMSmart:IPR003607"
FT                   /inference="protein motif:HMMTigr:IPR010043"
FT                   /protein_id="ABX65716.1"
FT                   /translation="MLQRLWIEAGFGQIADLALVAVGGYGRGELHPLSDIDLLILSRKK
FT                   LPDEQAQKVGELLTLLWDVKLDVGHSVRTLEECLLEGLSDLTVATNLIETRLLIGDVAL
FT                   FLALQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSSPGGLRDIHTLQ
FT                   WVARRHFGATSLDEMVGFGFLTPAERAELNECLHILWRIRFALHLVVSRYDNRLLFDRQ
FT                   LSVAQRLNYSGEGNDPVERMMKDYFRVTRRVSELNQMLLQLFDEAILALPADEKPRPVD
FT                   DEFQLRGTLIDLRDDTLFIREPQAILRMFYMMVRNSAITGIYSTTLRHLRHARRHLSQP
FT                   LCYIPEARTLFLSMLRHPGAVSRGLLPMHRHSVLWAYMPQWSHIVGQMQFDLFHAYTVD
FT                   EHTIRVMLKLESFAKEETRQRHPLCVDLWPRLPHPELILIAALFHDIAKGRGGDHSVLG
FT                   AQDVLTFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQFAEEVQTETRL
FT                   RFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDMRERVRHHQLQA
FT                   LALLRMDNIDEAALHKIWTRCRANYFVRHSPNQLAWHARHLLQHDLRQPLVLLSPQATR
FT                   GGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFIVLEPDGSPLAA
FT                   DRHEVIRTGLEQTITQRSWQPPQPRRQPAKLRHFTVETEVNFLPTHTDRKSFMELIALD
FT                   QPGLLARVGQIFADLGISLHGARITTIGERVEDLFIIATADRRALNNVLQLEVQQRLTA
FT                   ALNPNDKG"
FT   gene            253500..253754
FT                   /locus_tag="SPAB_00273"
FT   CDS_pept        253500..253754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00273"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65715"
FT                   /protein_id="ABX65715.1"
FT                   /translation="MQQLVDKFGTGFNKLFSTNAAVKCLSQPVLKDVDAGFDTGDGQFS
FT                   ARPDARVLRLVREGGECGIRVLFRKSIHMRHPLKSRMVA"
FT   gene            complement(253956..254750)
FT                   /locus_tag="SPAB_00275"
FT   CDS_pept        complement(253956..254750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0216 3.2e-142 map; methionine
FT                   aminopeptidase K01265; COG: COG0024 Methionine
FT                   aminopeptidase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65717"
FT                   /inference="protein motif:FPrintScan:IPR001714"
FT                   /inference="protein motif:Gene3D:IPR000994"
FT                   /inference="protein motif:HMMPanther:IPR000994"
FT                   /inference="protein motif:HMMPfam:IPR000994"
FT                   /inference="protein motif:HMMTigr:IPR002467"
FT                   /inference="protein motif:ScanRegExp:IPR002467"
FT                   /inference="similar to AA sequence:INSD:AAL19179.1"
FT                   /protein_id="ABX65717.1"
FT                   /translation="MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRIC
FT                   NDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIKDE
FT                   FHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE"
FT   gene            255034..255172
FT                   /locus_tag="SPAB_00276"
FT   misc_RNA        255034..255172
FT                   /locus_tag="SPAB_00276"
FT                   /product="t44 RNA"
FT                   /note="Rfam score 140.04"
FT                   /inference="nucleotide motif:Rfam:RF00127"
FT   gene            complement(255183..255317)
FT                   /locus_tag="SPAB_00277"
FT   CDS_pept        complement(255183..255317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65718"
FT                   /protein_id="ABX65718.1"
FT                   /translation="MNFVTRAEDERLHFRVPVTGLVTKVNTSLEHVAHGNSCHDLKPL"
FT   gene            255345..255926
FT                   /locus_tag="SPAB_00278"
FT   CDS_pept        255345..255926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00278"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0052 Ribosomal protein S2; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65719"
FT                   /db_xref="GOA:A9N0R7"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0R7"
FT                   /inference="protein motif:Gene3D:IPR001865"
FT                   /inference="protein motif:HMMPanther:IPR005706"
FT                   /inference="protein motif:HMMPfam:IPR001865"
FT                   /inference="protein motif:HMMTigr:IPR005706"
FT                   /inference="protein motif:ScanRegExp:IPR001865"
FT                   /inference="protein motif:superfamily:IPR001865"
FT                   /inference="similar to AA sequence:INSD:AAL19180.1"
FT                   /protein_id="ABX65719.1"
FT                   /translation="MFNEALAELNKISARKGKILFVGTKRAASEAVKEAANSCDQFFVN
FT                   HRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFEKLTKKEALMRTRELEKLENSLGGIK
FT                   DMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVS
FT                   LYLGAVAATVREGRSQDLASQAEESFVEAE"
FT   gene            256112..257035
FT                   /locus_tag="SPAB_00279"
FT   CDS_pept        256112..257035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fth:FTH_0220 9.8e-70 tsf; protein-synthesizing
FT                   GTPase; COG: COG0264 Translation elongation factor Ts;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65720"
FT                   /inference="protein motif:HMMPanther:IPR001816"
FT                   /inference="protein motif:HMMPfam:IPR000449"
FT                   /inference="protein motif:HMMPfam:IPR001816"
FT                   /inference="protein motif:HMMTigr:IPR001816"
FT                   /inference="protein motif:ScanRegExp:IPR001816"
FT                   /inference="protein motif:superfamily:IPR001816"
FT                   /inference="protein motif:superfamily:IPR009060"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215204.1"
FT                   /protein_id="ABX65720.1"
FT                   /translation="MAPFFTFISVRFDAGQIKSFEDFRMAEITASLVKELRERTGAGMM
FT                   DCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNVAFILEVNCQT
FT                   DFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVASLE
FT                   GDVLGSYQHGARIGVLVAAKGADEELVKQLAMHVAASKPEFVKPEDVSADVVEKEYQVQ
FT                   LDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKSVGQLLKEHNADVTGFI
FT                   RFEVGEGIEKVETDFAAEVAAMSKQS"
FT   gene            257180..257902
FT                   /locus_tag="SPAB_00280"
FT   CDS_pept        257180..257902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY0241 5.1e-121 pyrH; uridine
FT                   5'-monophosphate kinase K00947; COG: COG0528 Uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65721"
FT                   /inference="protein motif:Gene3D:IPR001048"
FT                   /inference="protein motif:HMMPfam:IPR001048"
FT                   /inference="protein motif:HMMPIR:IPR011817"
FT                   /inference="protein motif:HMMTigr:IPR011817"
FT                   /inference="protein motif:superfamily:IPR001048"
FT                   /inference="similar to AA sequence:INSD:CAD08676.1"
FT                   /protein_id="ABX65721.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPSATMYDQLTYSEVLDKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKRTLITE"
FT   gene            258049..258606
FT                   /locus_tag="SPAB_00281"
FT   CDS_pept        258049..258606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fth:FTH_0222 9.7e-47 prfH;
FT                   protein-synthesizing GTPase; COG: COG0233 Ribosome
FT                   recycling factor; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65722"
FT                   /db_xref="GOA:A9N0S0"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0S0"
FT                   /inference="protein motif:BlastProDom:IPR002661"
FT                   /inference="protein motif:HMMPanther:IPR002661"
FT                   /inference="protein motif:HMMPfam:IPR002661"
FT                   /inference="protein motif:HMMTigr:IPR002661"
FT                   /inference="similar to AA sequence:INSD:AAL19183.1"
FT                   /protein_id="ABX65722.1"
FT                   /translation="MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYY
FT                   GTPTPLRQLASVTVEDSRTLKINVFDRSMGPAVEKAIMASDLGLNPSSAGTDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKAISEDDDRRSQEEVQKM
FT                   TDAAIKKVDAALADKEAELMQF"
FT   gene            258660..259943
FT                   /locus_tag="SPAB_00282"
FT   CDS_pept        258660..259943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0220 6.5e-208 dxr; 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase K00099; COG: COG0743
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65723"
FT                   /inference="protein motif:HMMPfam:IPR013512"
FT                   /inference="protein motif:HMMPfam:IPR013644"
FT                   /inference="protein motif:HMMPIR:IPR003821"
FT                   /inference="protein motif:HMMTigr:IPR003821"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459225.1"
FT                   /protein_id="ABX65723.1"
FT                   /translation="MYKAPRRRHYQVSCAAFCFLFRFNTSGRFMKQLTILGSTGSIGCS
FT                   TLDVVRHNPDSFRVIALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQQHGSR
FT                   TEVLSGQQAACEMAALDEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRL
FT                   FMDEVKRSNARLLPVDSEHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRET
FT                   PMCDLAAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIHP
FT                   QSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPD
FT                   YQRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLQ
FT                   EPASVDDVLQVDAIAREVARKQVIRLSR"
FT   gene            260026..260229
FT                   /locus_tag="SPAB_00283"
FT   CDS_pept        260026..260229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65724"
FT                   /protein_id="ABX65724.1"
FT                   /translation="MAFFGQVSRGFTRLFCGYTKSFRTHRDGRRIRSRRAQTAHDRGDD
FT                   AQSSAKRTEENVYKGFSIPEYR"
FT   gene            260256..261014
FT                   /locus_tag="SPAB_00284"
FT   CDS_pept        260256..261014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0228 1.8e-134 uppS; undecaprenyl
FT                   pyrophosphate synthetase K00806; COG: COG0020 Undecaprenyl
FT                   pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00284"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65725"
FT                   /inference="protein motif:BlastProDom:IPR001441"
FT                   /inference="protein motif:Gene3D:IPR001441"
FT                   /inference="protein motif:HMMPanther:IPR001441"
FT                   /inference="protein motif:HMMPfam:IPR001441"
FT                   /inference="protein motif:HMMTigr:IPR001441"
FT                   /inference="protein motif:ScanRegExp:IPR001441"
FT                   /inference="protein motif:superfamily:IPR001441"
FT                   /inference="similar to AA sequence:INSD:AAX64127.1"
FT                   /protein_id="ABX65725.1"
FT                   /translation="MLSATQPVSENLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAG
FT                   AKSVRRAVSFAANNGIDALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNV
FT                   RLRIIGDISRFNSRLQERIRKSEALTAHNTGLTLNIAANYGGRWDIVQGVRQLAEQVQA
FT                   GVLRPDQIDEERLGQQICMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPD
FT                   FDEQDFEGALHAFANRERRFGGTEPGDDKA"
FT   gene            261027..261884
FT                   /locus_tag="SPAB_00285"
FT   CDS_pept        261027..261884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0223 8.2e-153 cdsA; phosphatidate
FT                   cytidylyltransferase K00981; COG: COG0575 CDP-diglyceride
FT                   synthetase; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65726"
FT                   /inference="protein motif:HMMPfam:IPR000374"
FT                   /inference="protein motif:ScanRegExp:IPR000374"
FT                   /inference="similar to AA sequence:INSD:CAD08680.1"
FT                   /protein_id="ABX65726.1"
FT                   /translation="MLKYRLISAFVLIPAVIAALFLLPPVGFAIITLVVCMLAAWEWGQ
FT                   LSGFAARSQRVWLAVLCGLLLALMLFLLPEYHHNIRQPLVEMSLWASLGWWIVALLLVL
FT                   FYPGSAAIWRNSKTLRLIFGLLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMILVWG
FT                   ADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLNVAPVILLI
FT                   CSVVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLV
FT                   FRTL"
FT   gene            261896..263248
FT                   /locus_tag="SPAB_00286"
FT   CDS_pept        261896..263248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0230 3.2e-238 yaeL; putative membrane
FT                   protein; COG: COG0750 Predicted membrane-associated
FT                   Zn-dependent proteases 1; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65727"
FT                   /inference="protein motif:HMMPfam:IPR001478"
FT                   /inference="protein motif:HMMPfam:IPR008915"
FT                   /inference="protein motif:HMMSmart:IPR001478"
FT                   /inference="protein motif:HMMTigr:IPR004387"
FT                   /inference="protein motif:ScanRegExp:IPR006025"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459228.1"
FT                   /protein_id="ABX65727.1"
FT                   /translation="MLSILWNLAAFIIALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELRRHAFNNKTVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVIGEITPNSIAAQAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVSKIGDQQTTVSVAPFGSDQRQDKTLDLRHWAFEPDKQDPVSSLGIRPRGPQI
FT                   EPVLSEVQANSAASKAGLQAGDRIVKVDGQPLTQWMKFVTFVRDNPGKPLALEIERQGS
FT                   ALSLTLTPDTKSVNGKAEGFAGVVPKIIPLPEEYKTIRQYGPFSAILEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAQGAGMSAEFGVIYYLMFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKLKGGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL"
FT   gene            263280..265694
FT                   /locus_tag="SPAB_00287"
FT   CDS_pept        263280..265694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00287"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4775 Outer membrane protein/protective
FT                   antigen OMA87; Psort location: OuterMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65728"
FT                   /db_xref="GOA:A9N0S6"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0S6"
FT                   /inference="protein motif:HMMPanther:IPR000184"
FT                   /inference="protein motif:HMMPfam:IPR000184"
FT                   /inference="protein motif:HMMPfam:IPR010827"
FT                   /protein_id="ABX65728.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAKIQQINIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHS
FT                   AEIEKLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGI
FT                   NGTKNDYQTYSELSVTNPYFTVDGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNTLRAGLGYVHNKLSNMQPQIAMDRYLESMGQSADTSSFAADDFTFNYGWTYNK
FT                   LDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGD
FT                   GLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYKNGAHTSWDDNDDYEDCTQESGCK
FT                   SDDAVGGNAMAVASLEFITPTPFISEKYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPD
FT                   YSDPGNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   gene            265817..266302
FT                   /locus_tag="SPAB_00288"
FT   CDS_pept        265817..266302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00288"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2825 Outer membrane protein; Psort location:
FT                   OuterMembrane, score:9.93"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65729"
FT                   /inference="protein motif:HMMPfam:IPR005632"
FT                   /inference="similar to AA sequence:INSD:AAX64131.1"
FT                   /protein_id="ABX65729.1"
FT                   /translation="MKKWLLAAGLGLAMVTSAQAADKIAIVNMGNLFQQVAQKTGVSNT
FT                   LENEFKGRAAELQKMETDLQSKMQRLQSMKAGSDRTKLEKDVMSQRQTFAQKAQAFEKD
FT                   RARRSNEERNKLVTRIQTAVKKVANDQSIDLVVDANTVAYNSSDVKDITADVLKQVK"
FT   gene            266306..267331
FT                   /locus_tag="SPAB_00289"
FT   CDS_pept        266306..267331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0227 2.9e-180 lpxD;
FT                   UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
FT                   K02536; COG: COG1044 UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase; Psort location: Cytoplasmic,
FT                   score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65730"
FT                   /inference="protein motif:HMMPfam:IPR007691"
FT                   /inference="protein motif:HMMTigr:IPR007691"
FT                   /inference="protein motif:ScanRegExp:IPR001451"
FT                   /inference="protein motif:superfamily:IPR011004"
FT                   /inference="similar to AA sequence:INSD:AAV76262.1"
FT                   /protein_id="ABX65730.1"
FT                   /translation="MPSIRLADLAEQLDAELHGDGDIVITGVASMQSATTGHITFMVNP
FT                   KYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSA
FT                   VIDATATLGSNVSVGANAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTIYHD
FT                   IQIGENCLIQSSTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDD
FT                   TVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIERKVNQQ
FT                   D"
FT   gene            267303..267440
FT                   /locus_tag="SPAB_00290"
FT   CDS_pept        267303..267440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65731"
FT                   /protein_id="ABX65731.1"
FT                   /translation="MSARLINKTNVPPCSCHSFPACHIHTIAAGRVIIAFLYIWTGRVF
FT                   "
FT   gene            267437..267892
FT                   /locus_tag="SPAB_00291"
FT   CDS_pept        267437..267892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0227 6.1e-77 fabZ; (3R)-hydroxymyristol
FT                   acyl carrier protein dehydratase K02372; COG: COG0764
FT                   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
FT                   dehydratases; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65732"
FT                   /db_xref="GOA:A9N0T0"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0T0"
FT                   /inference="protein motif:HMMPfam:IPR013114"
FT                   /inference="protein motif:HMMTigr:IPR010084"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215214.1"
FT                   /protein_id="ABX65732.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   gene            267896..268684
FT                   /locus_tag="SPAB_00292"
FT   CDS_pept        267896..268684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0228 2.1e-138 lpxA;
FT                   UDP-N-acetylglucosamine acetyltransferase K00677; COG:
FT                   COG1043 Acyl-[acyl carrier
FT                   protein]--UDP-N-acetylglucosamine O-acyltransferase; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65733"
FT                   /db_xref="GOA:A9N0T1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0T1"
FT                   /inference="protein motif:HMMPfam:IPR001451"
FT                   /inference="protein motif:HMMPIR:IPR010137"
FT                   /inference="protein motif:HMMTigr:IPR010137"
FT                   /inference="protein motif:ScanRegExp:IPR001451"
FT                   /inference="protein motif:superfamily:IPR011004"
FT                   /inference="similar to AA sequence:INSD:CAA80950.1"
FT                   /protein_id="ABX65733.1"
FT                   /translation="MIDKSAFIHPTAIVEDGAVIGANAHIGPFCIVGPQVEIGEGTVLK
FT                   SHVVVNGQTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHVAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREGLVAIRNAYKLL
FT                   YRSGKTLDEAKLEIAELAEKHPEVKAFTEFFERSTRGPIR"
FT   gene            268684..269832
FT                   /locus_tag="SPAB_00293"
FT   CDS_pept        268684..269832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0230 1.2e-201 lpxB; lipid-A-disaccharide
FT                   synthase K00748; COG: COG0763 Lipid A disaccharide
FT                   synthetase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65734"
FT                   /db_xref="GOA:A9N0T2"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0T2"
FT                   /inference="protein motif:HMMPfam:IPR003835"
FT                   /inference="protein motif:HMMTigr:IPR003835"
FT                   /inference="similar to AA sequence:INSD:AAX64135.1"
FT                   /protein_id="ABX65734.1"
FT                   /translation="MAAQRPLTIALVAGETSGDILGAGLIRALKARVPNARFVGVAGPR
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTRRFTELKPDVFVGIDAPDFNI
FT                   TLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRSTHMVLAFLPFEKAFYDKFNVPCRF
FT                   IGHTMADAMPLDPDKNAARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQR
FT                   YPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEA
FT                   LLPLLANGKTSHAMHDTFRELHQQIRCNADEQAANAVLELAQ"
FT   gene            269829..270425
FT                   /locus_tag="SPAB_00294"
FT   CDS_pept        269829..270425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0230 6.9e-101 rnhB; RNAse HII K03470;
FT                   COG: COG0164 Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65735"
FT                   /db_xref="GOA:A9N0T3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0T3"
FT                   /inference="protein motif:HMMPanther:IPR001352"
FT                   /inference="protein motif:HMMPfam:IPR001352"
FT                   /inference="protein motif:superfamily:IPR012337"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215217.1"
FT                   /protein_id="ABX65735.1"
FT                   /translation="MIEFVYPHTHLVAGVDEVGRGPLVGAVVTAAVILDPARPIVGLND
FT                   SKKLSEKRRLSLYDEIKEKALSWSLGRAEAHEIDELNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPALPVPSMAVVKGDSRVAEISAASILAKVTRDAEMAALDIVFPQYGFAQHK
FT                   GYPTAFHLEKLAQYGATAHHRRSFAPVKRALGLVS"
FT   gene            270497..273931
FT                   /locus_tag="SPAB_00295"
FT   CDS_pept        270497..273931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0232 0. dnaE; DNA polymerase III, alpha
FT                   chain K02337; COG: COG0587 DNA polymerase III, alpha
FT                   subunit; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65736"
FT                   /inference="protein motif:HMMPfam:IPR004013"
FT                   /inference="protein motif:HMMPfam:IPR004365"
FT                   /inference="protein motif:HMMPfam:IPR011708"
FT                   /inference="protein motif:HMMSmart:IPR003141"
FT                   /inference="protein motif:HMMTigr:IPR004805"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /protein_id="ABX65736.1"
FT                   /translation="MIDGLAKTGPLVKKAASLGMPALAITDFTNLCGLVKFYGAGHGAG
FT                   IKPIVGADFNVHNELLGDELTHLTVLAANNTGYQNLTLLISKAYQRGYGAAGPIIERDW
FT                   LVELKEGLILISGGRMGDVGRCLLRGNQALVEECVAFYETHFPDRYFLELIRTGRQDEE
FT                   TYLHAAVELAEARGLPVVATNDVRFLESDDFDAHEIRVAIHDGFTLDDPKRPRNYSPQQ
FT                   YMRSEEEMCELFSDIPEALENTVEIAKRCNVTVRLGEYFLPQFPTGDMTTEDYLVKKSK
FT                   EGLEERLAFLFPDEEERKKRRPEYDERLDIELQVINQMGFPGYFLIVMEFIQWSKDNGV
FT                   PVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMPDFDVDFCMEKRDQVI
FT                   EHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLVPPDPGMTLAKA
FT                   FEAEPQLPEIYEADEEVRALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEE
FT                   GKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRRAKNGEPPLDIAAIPLD
FT                   DKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALVALFRPGPLQSGMVDNF
FT                   IDRKHGREELSYPDVQWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYTLGGADMLRR
FT                   AMGKKKPEEMAKQRSVFEEGAKKNGIDGELAMKIFDLVEKFAGYGFNKSHSAAYALVSY
FT                   QTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKILPPDINSGLYHFHVNDE
FT                   GEIVYGIGAIKGVGEGPIEAIIDARNQGGYFRELFDLCARTDTKKLNRRVLEKLIMSGA
FT                   FDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEEPEQIEQSYASCQPWPE
FT                   QVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTERGKVTTAAGLVIAARV
FT                   MVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRILIVSGQVSFDDFSGGLK
FT                   MTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEPHRSGTIPVHLYYQRAD
FT                   ARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   gene            273944..274903
FT                   /locus_tag="SPAB_00296"
FT   CDS_pept        273944..274903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY0255 2.2e-166 accA; acetyl-coenzyme A
FT                   carboxylase carboxyl transferase subunit alpha K01962; COG:
FT                   COG0825 Acetyl-CoA carboxylase alpha subunit; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65737"
FT                   /db_xref="GOA:A9N0T5"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0T5"
FT                   /inference="protein motif:HMMPfam:IPR001095"
FT                   /inference="protein motif:HMMTigr:IPR001095"
FT                   /inference="protein motif:superfamily:IPR010982"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX65737.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLEGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA"
FT   gene            complement(274900..275007)
FT                   /locus_tag="SPAB_00297"
FT   CDS_pept        complement(274900..275007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65738"
FT                   /protein_id="ABX65738.1"
FT                   /translation="MPLRLITSTHRRLIFPRPKKRGRIIRPPGKNEVND"
FT   gene            275083..276846
FT                   /locus_tag="SPAB_00298"
FT   CDS_pept        275083..276846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_1428 8.2e-31 chitinase K01183; COG:
FT                   COG3979 Uncharacterized protein contain chitin-binding
FT                   domain type 3; Psort location: Periplasmic, score:9.84"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65739"
FT                   /inference="protein motif:BlastProDom:IPR000726"
FT                   /inference="protein motif:HMMPfam:IPR000601"
FT                   /inference="protein motif:HMMPfam:IPR000726"
FT                   /inference="protein motif:HMMSmart:IPR000601"
FT                   /inference="protein motif:superfamily:IPR000601"
FT                   /inference="protein motif:superfamily:IPR003610"
FT                   /protein_id="ABX65739.1"
FT                   /translation="MGLQKTLALSAVAAGIMLSLSGAQAAPLLSSSEPMTINASDLAAK
FT                   EKALTDFPLMEAVKSSIQTLDNSAVEQIEPGRAANPANVKRVESILKEADWDYLFPMRA
FT                   PEYTYSNFLKAIGKFPAVCGTYTDGRDSDAICRKTLATMFAHFAQETGGHESWRDIPEW
FT                   RQALVYLREVGWTEGQKGGYNGECNPDVWQGQTWPCGKDKDGDFLSYFGRGAKQLSYNY
FT                   NYGPFSDAMYGDVRPLLDKPELVADTWMNLASAVFFFVYPQPPKPSMLHVIDGTWQPND
FT                   RDKANGLVSGFGVTIQIINGGVECGGADENAQSLNRIAYYKEFANYLKVPVPADEVLGC
FT                   KKMKQFDEGGAGALPIYWEQDWGWSADTADGKTYSCQLVGYQTPYTAFKEGDYTKCVQH
FT                   YFNVNVVDDNGTTEPDVTPTPAPVTDENVAPVARIAGPVGAVEAGSQVSLSAEGSTDAN
FT                   GDKLTYTWMSQDGKTLSGQDKAVVIFNAPDVTQNTQYVVNLTVSDGTLSSTAVYTLNVK
FT                   AKAAAADDEDKTTSYPAWSSSQKWNPGDIVNSNGALYQCKPFPEGSWCNVAPAYYEPGV
FT                   GIAWADAWNAL"
FT   gene            276922..279063
FT                   /locus_tag="SPAB_00299"
FT   CDS_pept        276922..279063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0234 0. ldcC; lysine decarboxylase 2
FT                   K01582; COG: COG1982 Arginine/lysine/ornithine
FT                   decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65740"
FT                   /inference="protein motif:HMMPfam:IPR000310"
FT                   /inference="protein motif:HMMPfam:IPR005308"
FT                   /inference="protein motif:HMMPfam:IPR008286"
FT                   /inference="protein motif:HMMPIR:IPR011193"
FT                   /inference="protein motif:ScanRegExp:IPR000310"
FT                   /inference="protein motif:superfamily:IPR008286"
FT                   /protein_id="ABX65740.1"
FT                   /translation="MNIIAIMGPHGVYYKDEPIKELERALQSLGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSEINQLNEYLPLYAFINTNSTLDVSVHDMRMALWFFE
FT                   YALGLAEDIATRIHQYTNEYLDNITPPFTKALFTYAKEGKYTFCTPGHMAGTAYQKSPP
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYMVTNGTST
FT                   SNKIVGMYAAPAGSTLLIDRNCHKSLAHLLMMSDVVPLWLKPTRNALGILGGIPRREFT
FT                   RASIESKIEETPQAQWPVHAVITNSTYDGLLYNTNWIKQMLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGDRVPGKVIFETQSTHKMLAAFSQASLIHIKGEYDEETFNEAFMMHTST
FT                   SPSYPIVASIETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDSWFFDIWQPEE
FT                   VDEAECWPVTPGETWHGFADADDDHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKF
FT                   LDERGVVVEKTGPYNLLFLFSIGIDKTRAMGLLRGLTEFKRAYDLNLRVKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRQHDLPGLMLRAFEVLPEMIMTPHQAWQRQIKGEVETV
FT                   ALDQLPGRVSANMILPYPPGVPLLMPGERITQQSRAVLDFLLMLCSIGQHYPGFETDIH
FT                   GAKRNEDGVYQVRVLKHAC"
FT   gene            279119..279508
FT                   /locus_tag="SPAB_00300"
FT   CDS_pept        279119..279508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC0235 1.4e-68 yaeR; putative
FT                   lactoylglutathione lyase K01759; COG: COG0346
FT                   Lactoylglutathione lyase and related lyases; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65741"
FT                   /inference="protein motif:BlastProDom:IPR011588"
FT                   /inference="protein motif:HMMPfam:IPR004360"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454843.1"
FT                   /protein_id="ABX65741.1"
FT                   /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFDLLSEAWREERDSWK
FT                   GDLALNGQYVIELFSFPFPPARPSRPEACGLRHLAFSVENVENAVAHLEKHQVKCEPIR
FT                   IDPYTGKRFTFFNDPDGLPLELYEQ"
FT   gene            279572..280864
FT                   /locus_tag="SPAB_00301"
FT   CDS_pept        279572..280864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM0236 1.1e-233 mesJ; cell cycle protein
FT                   K04075; COG: COG0037 Predicted ATPase of the PP-loop
FT                   superfamily implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65742"
FT                   /db_xref="GOA:A9N0U0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0U0"
FT                   /inference="protein motif:HMMPfam:IPR011063"
FT                   /inference="protein motif:HMMPIR:IPR012094"
FT                   /inference="protein motif:HMMTigr:IPR012795"
FT                   /inference="protein motif:HMMTigr:IPR012796"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZRN5"
FT                   /protein_id="ABX65742.1"
FT                   /translation="MTTLTLNTSLLSSRRILAAFSGGLDSTVLLHQLVLWRERHPDVTL
FT                   RAIHIHHGLSPHADSWVRHCETVCERWQVPLVVERVTLADNGLGIEAHAREARYRAFAQ
FT                   TLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGERSPFAGTLLLRPLLRETRKT
FT                   LEQWAVRHGLCWIEDESNQDDAYDRNFLRLRALPLLQQRWPHFPAAVARSATLCAEQER
FT                   LLDELLASDLTDCITAEGTLRLSPLMSMSDVRRAAILRRWLAMRNAPMPSRDALERIWQ
FT                   EVALARDDASPCLRFGDREIRRYQSQLWWIKSVAGQHETTVAWPVWQTPLALPAGLGTV
FT                   QLVPGGELRRPREEESVSIRFKAPGVLHIVGRNGGRKLKKIWQEQGIPPWRRDTTPLLF
FT                   YGETLIAAAGVFVTREGAAEDKEGVSLVWHA"
FT   gene            280857..280961
FT                   /locus_tag="SPAB_00302"
FT   CDS_pept        280857..280961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00302"
FT                   /product="hypothetical protein"
FT                   /note="KEGG stm:STM4281 0.00029 nrfE; putative methylase
FT                   K04016"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65743"
FT                   /protein_id="ABX65743.1"
FT                   /translation="MPDGAALIRPTYRMERRPDKVLAPPSGNKILRIR"
FT   gene            complement(280948..281142)
FT                   /locus_tag="SPAB_00303"
FT   CDS_pept        complement(280948..281142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00303"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4568 Transcriptional antiterminator; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65744"
FT                   /inference="protein motif:HMMPfam:IPR009778"
FT                   /inference="similar to AA sequence:REFSEQ:NP_454845.1"
FT                   /protein_id="ABX65744.1"
FT                   /translation="MHHLILTLTLKDGEVLQAKANDLILRKNVEYLLAEVSGESCELRL
FT                   DKIASFSHPEIGTVVVSES"
FT   gene            complement(281195..281395)
FT                   /locus_tag="SPAB_00304"
FT   CDS_pept        complement(281195..281395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00304"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13866 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00304"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65745"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0U3"
FT                   /inference="protein motif:HMMPfam:IPR009624"
FT                   /inference="similar to AA sequence:INSD:AAL19202.1"
FT                   /protein_id="ABX65745.1"
FT                   /translation="MEKYCELVRKRYAEIASGDLGYVPDALGCVLKVLNEVAADSALSE
FT                   SVREKAAYAAANLLVSDYVNE"
FT   gene            281593..282138
FT                   /locus_tag="SPAB_00305"
FT   CDS_pept        281593..282138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_0319 2.5e-41 YaeQ protein
FT                   K00356; COG: COG4681 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65746"
FT                   /inference="protein motif:HMMPfam:IPR009822"
FT                   /inference="similar to AA sequence:INSD:AAL19203.1"
FT                   /protein_id="ABX65746.1"
FT                   /translation="MALKATIYKAVVNVADLDRNRFLDAALTLARHPSETQERMMLRLL
FT                   AWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQASDVAL
FT                   FAYNSRAAQIWWQQHQSKCAQFANLSVWYLDDGQLAQLSEFADRTMTLQATIQDGAIWL
FT                   SDARNNLEIQLTAWQQPS"
FT   gene            282135..282557
FT                   /locus_tag="SPAB_00306"
FT   CDS_pept        282135..282557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00306"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A3611 1.8e-31 pth2; peptidyl-tRNA
FT                   hydrolase; COG: COG1186 Protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65747"
FT                   /inference="protein motif:HMMPfam:IPR000352"
FT                   /inference="protein motif:ScanRegExp:IPR000352"
FT                   /inference="similar to AA sequence:INSD:AAX64146.1"
FT                   /protein_id="ABX65747.1"
FT                   /translation="MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRA
FT                   SGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKS
FT                   RRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLD"
FT   gene            282592..283290
FT                   /locus_tag="SPAB_00307"
FT   CDS_pept        282592..283290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00307"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3015 Uncharacterized lipoprotein NlpE
FT                   involved in copper resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00307"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65748"
FT                   /inference="protein motif:HMMPfam:IPR007298"
FT                   /inference="protein motif:superfamily:IPR011065"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149589.1"
FT                   /protein_id="ABX65748.1"
FT                   /translation="MRTAILSVAAACTLFALIGCNNRAEVDALQPAQAAELKPMQQSWR
FT                   GVLPCADCEGIETSLFLEKDGTWVMNERYQGVREEPSSFASYGTWARTADKLVLTDSNG
FT                   EKSYYRAKGNALEMLDREGNPVASQLNYTLVPVTASLPVTPMPLRGMYVYRADAATFTD
FT                   CATGKRLPVASNAQLERGYLAAKGEAEKPVLLTVEGHFVFAANPDTGEPVKTLIADKNA
FT                   KFAPGKDCTH"
FT   gene            complement(283364..285082)
FT                   /locus_tag="SPAB_00308"
FT   CDS_pept        complement(283364..285082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0245 0. proS; prolyl-tRNA synthetase
FT                   K01881; COG: COG0442 Prolyl-tRNA synthetase; Psort
FT                   location: Cytoplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65749"
FT                   /db_xref="GOA:A9N0U7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0U7"
FT                   /inference="protein motif:Gene3D:IPR004154"
FT                   /inference="protein motif:HMMPfam:IPR002314"
FT                   /inference="protein motif:HMMPfam:IPR004154"
FT                   /inference="protein motif:HMMPfam:IPR007214"
FT                   /inference="protein motif:HMMTigr:IPR004500"
FT                   /inference="protein motif:superfamily:IPR004154"
FT                   /protein_id="ABX65749.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GLRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSRIFSRMGLDFRAVQADTGSIGGNASHEFQVLAQSGEDDIV
FT                   FSDVSDYAANIELAEAIAPQTPRAAATQEMTLVDTPNAKTIAELVEQFNLPIEKTVKTL
FT                   LVKAVKDSKSPLVALLVRGDHELNEVKAEKLPHVASPLTFATEEEIRAVINAGPGSLGP
FT                   VNMPIPVIIDRTVAAMSDFAAGANIDGKHYFGINWDRDVATPVVADIRNVVAGDPSPDG
FT                   QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NFDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVLMDDRKERPG
FT                   VMFADMELIGIPHTIVIGDRNLDNDDIEYKYRRSGEKSLIKTGDIVDYLVKAIKG"
FT   gene            complement(285193..285900)
FT                   /locus_tag="SPAB_00309"
FT   CDS_pept        complement(285193..285900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0211 1.7e-111 yaeB; hypothetical
FT                   protein YaeB; COG: COG1720 Uncharacterized conserved
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65750"
FT                   /inference="protein motif:BlastProDom:IPR001378"
FT                   /inference="protein motif:HMMPfam:IPR001378"
FT                   /inference="protein motif:HMMTigr:IPR001378"
FT                   /inference="protein motif:ScanRegExp:IPR001378"
FT                   /inference="protein motif:superfamily:IPR000652"
FT                   /inference="similar to AA sequence:INSD:AAL19206.1"
FT                   /protein_id="ABX65750.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSACGELHLIAPYNQA
FT                   DAVRGLEAFSHLWVLFVFHQTMDGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VALKGIECRKESVILKLGSLDLVDGTPVVDIKPYLPFAEALPDAAASYAQQAPIAEMPV
FT                   SFTAEVAQQLTTLERRYPQLRTFICDVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   VNSGFEVFALEPR"
FT   gene            complement(285897..286301)
FT                   /locus_tag="SPAB_00310"
FT   CDS_pept        complement(285897..286301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00310"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09836 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65751"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149592.1"
FT                   /protein_id="ABX65751.1"
FT                   /translation="MRALPICLLALMLGGCSMLSRSPVEPVQSTATPPKAEPEKPKAPR
FT                   AAPVRIYTNAEDLVGKPFRDLGEVSGESCQATNQDSPPNIPTARKRMQINASKMKANAV
FT                   LLHSCEITSGTPGCYRQAVCIGSALNISAK"
FT   gene            complement(286420..287235)
FT                   /locus_tag="SPAB_00311"
FT   CDS_pept        complement(286420..287235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00311"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1464 ABC-type metal ion transport system,
FT                   periplasmic component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65752"
FT                   /inference="protein motif:HMMPfam:IPR004872"
FT                   /inference="protein motif:HMMTigr:IPR004478"
FT                   /inference="similar to AA sequence:REFSEQ:NP_459249.1"
FT                   /protein_id="ABX65752.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALAGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKEKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQIKDRGYKLV
FT                   SVGKTFVYPIAGYSKKIKSLDELKDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTSLDIVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   gene            complement(287274..287912)
FT                   /locus_tag="SPAB_00312"
FT   CDS_pept        complement(287274..287912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: baa:BA_0884 1.7e-42 binding-protein-dependent
FT                   transport systems inner membrane component K00294; COG:
FT                   COG2011 ABC-type metal ion transport system, permease
FT                   component; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65753"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="similar to AA sequence:INSD:AAX64151.1"
FT                   /protein_id="ABX65753.1"
FT                   /translation="MWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIMENA
FT                   RLYRSLSAVVNIFRSIPFIILLVWMIPFTRIIVGTSIGLQAAIVPLTVGAAPFIARMVE
FT                   NALLEIPAGLIEASRAMGATPLQIVRKILLPEALPGLVNAATITLITLVGYSAMGGAVG
FT                   AGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQLSGDRIVRAVTHK"
FT   gene            complement(287920..288951)
FT                   /locus_tag="SPAB_00313"
FT   CDS_pept        complement(287920..288951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00313"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A0788 5.5e-92 ABC transporter
FT                   component K06020; COG: COG1135 ABC-type metal ion transport
FT                   system, ATPase component; Psort location:
FT                   CytoplasmicMembrane, score:7.88"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00313"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65754"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR012692"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="similar to AA sequence:REFSEQ:YP_215233.1"
FT                   /protein_id="ABX65754.1"
FT                   /translation="MIKLSNITKVFQQGARTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVQVGGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKEEIKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQARLKASPETDSVPMLRMEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQEETQAAIAWLQDHHVKVEVL
FT                   GYV"
FT   gene            289141..289707
FT                   /locus_tag="SPAB_00314"
FT   CDS_pept        289141..289707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY0275 7.1e-99 yaeD;
FT                   D-glycero-D-manno-heptose 1 phosphatase K03273; COG:
FT                   COG0241 Histidinol phosphatase and related phosphatases;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65755"
FT                   /inference="protein motif:HMMPfam:IPR005834"
FT                   /inference="protein motif:HMMTigr:IPR004446"
FT                   /inference="protein motif:HMMTigr:IPR006543"
FT                   /inference="protein motif:HMMTigr:IPR006549"
FT                   /inference="similar to AA sequence:INSD:CAD08708.1"
FT                   /protein_id="ABX65755.1"
FT                   /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDAFEFIDGVIDAMRELKKM
FT                   GYALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSIEEFR
FT                   QVCDCRKPHPGMLISARDFLHIDMAASYMVGDKLEDMQAAAAANVGTKVLVRTGKPVTA
FT                   EAENAADWVLNSLADLPSAIKKQQK"
FT   gene            complement(289778..289900)
FT                   /locus_tag="SPAB_00315"
FT   CDS_pept        complement(289778..289900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65756"
FT                   /inference="similar to AA sequence:REFSEQ:YP_218321.1"
FT                   /protein_id="ABX65756.1"
FT                   /translation="MAYITLSSFRVNPEFQDFSLQPTGCLCEVIHIRRVDGGAL"
FT   unsure          289894..291664
FT                   /note="Unresolved duplication."
FT   gene            290103..290634
FT                   /locus_tag="SPAB_00316"
FT   rRNA            290103..290634
FT                   /locus_tag="SPAB_00316"
FT                   /product="small subunit ribosomal RNA"
FT                   /note="Rfam score 352.96; 5' domain"
FT                   /inference="nucleotide motif:Rfam:RF00177"
FT   gene            291705..291777
FT                   /locus_tag="SPAB_00317"
FT   tRNA            291705..291777
FT                   /locus_tag="SPAB_00317"
FT                   /product="tRNA-Glu"
FT   unsure          291852..295203
FT                   /note="Unresolved duplication."
FT   gene            291974..294883
FT                   /locus_tag="SPAB_00318"
FT   rRNA            291974..294883
FT                   /locus_tag="SPAB_00318"
FT                   /product="23S ribosomal RNA"
FT                   /note="'Gene model created based on homology with SPA4016'"
FT   gene            295078..295193
FT                   /locus_tag="SPAB_00319"
FT   rRNA            295078..295193
FT                   /locus_tag="SPAB_00319"
FT                   /product="5S ribosomal RNA"
FT                   /note="Rfam score 83.22"
FT                   /inference="nucleotide motif:Rfam:RF00001"
FT   gene            295402..295857
FT                   /locus_tag="SPAB_00320"
FT   CDS_pept        295402..295857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00320"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09993 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65757"
FT                   /inference="protein motif:superfamily:IPR008979"
FT                   /inference="similar to AA sequence:INSD:CAD05839.1"
FT                   /protein_id="ABX65757.1"
FT                   /translation="MAIKPFNYQQDFSSIDFRQQPELYQVGRGEQGGLLVEPYKSEILP
FT                   FWRNKDEASAMKSAEQIYQLFEAYRQQDDFVGMDMARKFIQMGYTRARRYANYKGGKKY
FT                   AEDGSLNTRGNDPIKAAAATVFKGWWDKIRQDEDYLKRKRQHQARWG"
FT   gene            295961..297262
FT                   /locus_tag="SPAB_00321"
FT   CDS_pept        295961..297262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00321"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65758"
FT                   /inference="protein motif:HMMPfam:IPR005828"
FT                   /inference="protein motif:HMMTigr:IPR004736"
FT                   /inference="protein motif:ScanRegExp:IPR005829"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149598.1"
FT                   /protein_id="ABX65758.1"
FT                   /translation="MAEIIQRIDKNNVEAPEMRRRIWAIVGASSGNLVEWFDFYVYSFC
FT                   SLYFAHIFFPSGNTTTQLLQTAGVFAAGFLMRPIGGWLFGRIADRRGRKASMLISVCMM
FT                   CMGSLVIACLPGYDTIGTWAPALLLIARLFQGLSVGGEYGTSATYMSEVALEGRKGFFA
FT                   SFQYVTLIGGQLLALLVVVILQQVLEDAELRAWGWRIPFALGAVLAVVALWLRRQLDET
FT                   SKHETRALKEAGSLKGLWRNRKAFLMVLVFTAAGSLCFYTFTTYMQKYLVNTAGMHANV
FT                   ASGIMTVALCVFMLVQPLFGALSDKIGRRTSMLCFGALATLFTVPILSALQNVTSPYAA
FT                   FALVMCALLIVSFYTSISGILKAEMFPAQVRALGVGLSYAVANALFGGSAEYVALSLKS
FT                   VGMESSFFWYVTAMAVLAFLVSLMLHRKGKGLRL"
FT   gene            complement(297259..297576)
FT                   /locus_tag="SPAB_00322"
FT   CDS_pept        complement(297259..297576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00322"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG5544 Predicted periplasmic lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65759"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457128.1"
FT                   /protein_id="ABX65759.1"
FT                   /translation="MLIPFTVLFLSGCSHLANDRWSGQDKAQHFMASAMLSAAGNEYAR
FT                   HQGVSPDRSAAIGLMFSLSLGASKELWDSRPEGSGWSWKDFVWDVAGATTGYAIWQMAR
FT                   Y"
FT   gene            complement(297627..298985)
FT                   /locus_tag="SPAB_00323"
FT   CDS_pept        complement(297627..298985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2657 7.5e-246 pssA; phosphatidylserine
FT                   synthase (CDP-diacylglycerol-serine
FT                   O-phosphatidyltransferase) K00998; COG: COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65760"
FT                   /inference="protein motif:HMMPfam:IPR001736"
FT                   /inference="protein motif:HMMSmart:IPR001736"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217644.1"
FT                   /protein_id="ABX65760.1"
FT                   /translation="MMLSKFKRNKHQQHLAQLPKISQSVDDVDFFYTPATFRETLLEKI
FT                   ASATQRICIVALYLEQDDGGKGILDALYAAKRQRPELDVRVLVDWHRAQRGRIGAAASN
FT                   TNADWYCRLAQENPGIDVPVYGVPINTREALGVLHFKGFIIDDSVLYSGASLNDVYLHQ
FT                   HDKYRYDRYQLIRNRQMADIMFDWVTQNLMNGRGVNRLDNTQRPKSPEIKNDIRLYRQE
FT                   LRDASYHFQGDANDEQLSVTPLVGLGKSSLLNKTIFHLMPCAEHKLTICTPYFNLPAVL
FT                   VRNIIQLLRDGKKVEIIVGDKTANDFYIPEDEPFKIIGALPYLYEINLRRFLSRLQYYV
FT                   NTDQLVVRLWKDDDNTYHLKGMWVDDKWMLLTGNNLNPRAWRLDLENAILIHDPKQELA
FT                   PQREKELELIRTHTTIVKHYRDLQSIADYPIKVRKLIRRLRRIRIDRLISRIL"
FT   gene            complement(299097..301757)
FT                   /locus_tag="SPAB_00324"
FT   CDS_pept        complement(299097..301757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00324"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2907 0. yfiQ; hypothetical protein
FT                   YfiQ K09181; COG: COG1042 Acyl-CoA synthetase (NDP
FT                   forming); Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65761"
FT                   /inference="protein motif:Gene3D:IPR013816"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="protein motif:HMMPfam:IPR003781"
FT                   /protein_id="ABX65761.1"
FT                   /translation="MSQQGLEALLRPKSIAVIGASMKPHRAGYLMMRNLLAGGFNGPVL
FT                   PVTPAWKAVLGVMAWPDIASLPFTPDLAILCTNASRNLALLDALGAKGCKTCIILSAPT
FT                   SQHEELLACARHYKMRLLGPNSLGLLAPWQGLNASFSPVPIKQGKLAFISQSAAVSNTI
FT                   LDWAQQREMGFSYFIALGDSLDIDVDELLDYLARDSKTSAILLYLEQLSDARRFVSAAR
FT                   SASRNKPILVIKSGRSPAAQRLLNTSAGMDPAWDAAIQRAGLLRVQDTHELFSAVETLS
FT                   HMRPLRGDRLMIISNGAAPAALALDELWSRNGKLATLSEETCLQLRQALPAHIDIANPL
FT                   DLCDDASSEHYVKTLDILLASQDFDALMVIHSPSAAAPGTESAHALIETIKRHPRGKFV
FT                   TLLTNWCGEFSSQEARRLFSEAGLPTYRTPEGTITAFMHMVEYRRNQKQLRETPALPSN
FT                   LTSNTAEAHNLLQRAIAEGAASLDTHEVQPILHAYGLHTLPTWIASDSAEAVHIAEQIG
FT                   YPVALKLRSPDIPHKSEVQGVMLYLRTASEVQQAANAIFDRVKMAWPQARIHGLLVQSM
FT                   ANRAGAQELRVVVEHDPVFGPLIMLGEGGVEWRPEEQAVVALPPLNMNLARYLVIQGIK
FT                   QRKIRARSALRPLDIVGLSQLLVQVSNLIVDCPEIQRLDIHPLLASASEFTALDVTLDI
FT                   APFDGDNESRLAVRPYPHQLEEWVEMKNGDRCLFRPILPEDEPQLRQFIAQVTKEDLYY
FT                   RYFSEINEFTHEDLANMTQIDYDREMAFVAVRRMDNAEEILGVTRAISDPDNVDAEFAV
FT                   LVRSDLKGLGLGRRLMEKLIAYTRDHGLKRLNGITMPNNRGMVALARKLGFQVDIQLEE
FT                   GIVGLTLNLAKCDES"
FT   gene            complement(301811..302491)
FT                   /locus_tag="SPAB_00325"
FT   CDS_pept        complement(301811..302491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00325"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3148 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65762"
FT                   /inference="protein motif:HMMPfam:IPR005636"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149602.1"
FT                   /protein_id="ABX65762.1"
FT                   /translation="MTNNAVLQLRAERLARATRPFLARGNRVRRCQRCLLPLKSCLCDT
FT                   LTPSQAKSRFCLVMFDTEPMKPSNTGRLIADILPDTTAFQWSRTEPPQALLELVRHPDY
FT                   QPIVVFPASYAGEAREVISTPPAGKPPLFIMLDGTWPEARKMFRKSPYLDHLPVISVDL
FT                   SRLSAYRLREIHAEGQYCTAEVAIALLDLAGDTEAATSLGEHFTRFKTRYLAGKTQHPG
FT                   NVTA"
FT   gene            complement(302564..302983)
FT                   /locus_tag="SPAB_00326"
FT   CDS_pept        complement(302564..302983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2649 1.7e-74 trxC; thioredoxin 2, redox
FT                   factor K03672; COG: COG0526 Thiol-disulfide isomerase and
FT                   thioredoxins; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65763"
FT                   /inference="protein motif:FPrintScan:IPR006662"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR013766"
FT                   /inference="protein motif:HMMTigr:IPR005746"
FT                   /inference="protein motif:ScanRegExp:IPR006662"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461584.1"
FT                   /protein_id="ABX65763.1"
FT                   /translation="MNTVCTHCQAINRIPDDRLQDAAKCGRCGHELFDGEVINATGETL
FT                   DKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEERSGKVRFVKVNTEAERELSARFGI
FT                   RSIPTIMIFKHGQVVDMLNGAVPKAPFDSWLNEAL"
FT   gene            303187..304224
FT                   /locus_tag="SPAB_00327"
FT   CDS_pept        303187..304224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0262 1.3e-186 yfiF; putative RNA
FT                   methyltransferase K03214; COG: COG0566 rRNA methylases;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65764"
FT                   /inference="protein motif:BlastProDom:IPR001537"
FT                   /inference="protein motif:HMMPfam:IPR001537"
FT                   /inference="protein motif:HMMPfam:IPR013123"
FT                   /inference="similar to AA sequence:INSD:CAD05832.1"
FT                   /protein_id="ABX65764.1"
FT                   /translation="MNDELKNKSGKVKVMYVRSDDDSDKRTHNPRTGKGGGRPAKSRTD
FT                   GGRRPARDERNNQSRDRKHETSPWRTVSRAPGDETPEKVDHGGISGKSFIDPEVLRRQR
FT                   AEETRVYGENACQALFQSRPDAIVRAWFIQSVTPRFKEALRWMAANRKAYHVVDEAELA
FT                   KASGTEHHGGVCFLIKKRNGTTVKQWVKQAADQDCVLALEDVANPHNLGGMMRSCAHFG
FT                   VKGVVVQDAALLESGAAIRTAEGGAEHVQPITGESIVDVLDDFRQAGYTVVTTSSDRGQ
FT                   ALFSTTLPEKMVLVLGREYDYLPEAAREPDDLCVKINGTGNVESLNVSVATGVLLAEWW
FT                   RQNKA"
FT   gene            complement(304340..305029)
FT                   /locus_tag="SPAB_00328"
FT   CDS_pept        complement(304340..305029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00328"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2652 4.1e-126 ung;
FT                   uracil-DNA-glycosylase K03648; COG: COG0692 Uracil DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00328"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65765"
FT                   /db_xref="GOA:A9N0W3"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0W3"
FT                   /inference="protein motif:BlastProDom:IPR003249"
FT                   /inference="protein motif:HMMPfam:IPR005122"
FT                   /inference="protein motif:HMMTigr:IPR002043"
FT                   /inference="protein motif:ScanRegExp:IPR002043"
FT                   /inference="similar to AA sequence:INSD:AAV76293.1"
FT                   /protein_id="ABX65765.1"
FT                   /translation="MATELTWHDVLADEKQQPYFINTLHTVAGERQSGITVYPPQKDVF
FT                   NAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGIAPPPSLVNMYKELEASIPGFV
FT                   RPAHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLL
FT                   WGSHAQKKGAIIDPQRHHILKAPHPSPLSAHRGFFGCNHFALTNQWLEQHGEKTIDWTP
FT                   VLPAESE"
FT   gene            305348..305731
FT                   /locus_tag="SPAB_00329"
FT   CDS_pept        305348..305731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF2115 1.2e-48 formate acetyltransferase
FT                   K00656; COG: COG3445 Acid-induced glycyl radical enzyme;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65766"
FT                   /db_xref="GOA:A9N0W4"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR011140"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0W4"
FT                   /inference="protein motif:HMMPfam:IPR001150"
FT                   /inference="protein motif:HMMPIR:IPR011140"
FT                   /inference="protein motif:ScanRegExp:IPR001150"
FT                   /inference="similar to AA sequence:INSD:AAL21540.1"
FT                   /protein_id="ABX65766.1"
FT                   /translation="MITGIQITKAANDDLLNSFWLLDSEKGEARCIVAKSGFAEDEVVA
FT                   VSKLGEIEYREIPMEVKPEVRVEGGQHLNVNVLRRETLEDAVKHPEKYPQLTIRVSGYA
FT                   VRFNSLTPEQQRDVIARTFTESL"
FT   gene            complement(305793..306245)
FT                   /locus_tag="SPAB_00330"
FT   CDS_pept        complement(305793..306245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00330"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1280 Putative threonine efflux protein;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65767"
FT                   /inference="similar to AA sequence:INSD:AAL21539.1"
FT                   /protein_id="ABX65767.1"
FT                   /translation="MSLGFLVVMLLCAGIAFSLAVIDPAIIHLLSWVGAAYILWLAWKI
FT                   ATSPAADENVRPKPVGFWVSFGLQFVNVKIILYGITALSTFVLPQTQALNWVIGVSILL
FT                   ALIGTFGNVCWALAGHLFQRAFRHYGRQLNIILALLLVYCAVRIFY"
FT   gene            306341..306448
FT                   /locus_tag="SPAB_00331"
FT   CDS_pept        306341..306448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65768"
FT                   /protein_id="ABX65768.1"
FT                   /translation="MYKSRKRLKASVSLVISSVLADSTRYEIFKKMNVF"
FT   gene            306483..307382
FT                   /locus_tag="SPAB_00332"
FT   CDS_pept        306483..307382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 6.1e-06 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65769"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461579.1"
FT                   /protein_id="ABX65769.1"
FT                   /translation="MDLRRFITLKTVVEEGSFLRASQKLCCTQSTVTFHIQQLEREFSL
FT                   QLFEKIGRRMCLTTEGKKLMPHIHELTRVMESIREAARQDAEPGGELRVATGETLLAYK
FT                   MPQVLQRFKLRAPNVRLSLQSLNCYVIRDALLNDEVDLGVFYRVGNDDALTMQQLGEQS
FT                   LALVASPLLQDADFTQPDQHIPCSFIINEPQCVFRQLFESTLRQRRITLENTIELWSIE
FT                   SIKQCVAANLGISFLPRFTVERELSTGQLKELPFGAPSLSIMALCAHHAGKAVSPAMQI
FT                   FIQCMEACFTVEDKKMPG"
FT   gene            complement(307400..308734)
FT                   /locus_tag="SPAB_00333"
FT   CDS_pept        complement(307400..308734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2643 1.6e-234 srmB; ATP-dependent RNA
FT                   helicase K05590; COG: COG0513 Superfamily II DNA and RNA
FT                   helicases; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00333"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65770"
FT                   /inference="protein motif:HMMPfam:IPR001650"
FT                   /inference="protein motif:HMMPfam:IPR011545"
FT                   /inference="protein motif:HMMSmart:IPR001650"
FT                   /inference="protein motif:HMMSmart:IPR014001"
FT                   /inference="protein motif:ScanRegExp:IPR000629"
FT                   /inference="similar to AA sequence:INSD:AAX66554.1"
FT                   /protein_id="ABX65770.1"
FT                   /translation="MTVTTFSELELDESLLDALQDKGFTRPTAIQAAAIPPALDGRDVL
FT                   GSAPTGTGKTAAYLLPALQHLLDFPRKKSGPPRILILTPTRELAMQVADHARELAKHTH
FT                   LDIATITGGVAYMNHAEVFSENQDIVVATTGRLLQYIKEENFDCRAVETLILDEADRML
FT                   DMGFAQDIEHIAGETRWRKQTMLFSATLEGDAIKDFAERLLEDPVEVSANPSTRERKKI
FT                   HQWYYRADNFEHKVALLKHLLKQDDATRSIVFVRKRERVHELAETLRLAGINNCYLEGE
FT                   MAQIKRNEGIKRLTDGRVNVLVATDVAARGIDIPDVSHVINFDMPRSGDTYLHRIGRTG
FT                   RAGRKGTAISLVEAHDHLLLLKIGRYIEEPLKARVIDELRPTTRAPSEKLTGKPSKKVL
FT                   AKRAEKKKEKEKEKPRVKKRHRDTKNIGKRRKPSGTKMQEQSSEE"
FT   gene            308796..309602
FT                   /locus_tag="SPAB_00334"
FT   CDS_pept        308796..309602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2897 4.6e-111 yfiC; hypothetical
FT                   protein YfiC K00599; COG: COG4123 Predicted
FT                   O-methyltransferase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65771"
FT                   /db_xref="GOA:A9N0W9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N0W9"
FT                   /inference="protein motif:HMMPfam:IPR007848"
FT                   /inference="protein motif:ScanRegExp:IPR002052"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217634.1"
FT                   /protein_id="ABX65771.1"
FT                   /translation="MDIPSQVLFSPGAVAVFLQGCFYMSQSGSALRRNGFTFKQFFVAH
FT                   DRCAMKVGTDGILLGAWAPVADVKRILDIGTGSGLLALMLAQRTDDNVPIDAVELDAGA
FT                   AMQAQENVAHSPWPHRITVHTDDIQRWAPRQTVRFDLIISNPPYYEPGVECATPQREQA
FT                   RYTATLDHQTLLAIAADCITEDGFFCVVLPEQIGNAFTQQALNMGWHLRLRTDVAENEA
FT                   RLPHRVLLAFSPQAGECFSDRLVIRGSDQHYSESYTALTQAFYLFM"
FT   gene            complement(309587..311206)
FT                   /locus_tag="SPAB_00335"
FT   CDS_pept        complement(309587..311206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00335"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2641 3.6e-294 nadB; quinolinate
FT                   synthetase, B protein K00278; COG: COG0029 Aspartate
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65772"
FT                   /inference="protein motif:HMMPfam:IPR003953"
FT                   /inference="protein motif:HMMPfam:IPR004112"
FT                   /inference="protein motif:HMMTigr:IPR005288"
FT                   /inference="protein motif:superfamily:IPR004112"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZMX9"
FT                   /protein_id="ABX65772.1"
FT                   /translation="MTTPELSCDVLIIGSGAAGLSLALRLAEKHKVIVLSKGPVSEGST
FT                   FYAQGGIAAVFDETDSIASHVEDTLIAGAGICDRHAVEFVASNARTCVQWLIDQGVLFD
FT                   THVQPNGKESYHLTREGGHSHRRILHAADATGKEVETTLVSRAQNHPNIQVLERSNAVD
FT                   LIISDKMGLPGPRRVVGAWIWNRNKEWVETCHAKSVVLATGGASKVYQYTTNPDISSGD
FT                   GIAMAWRAGCRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGSRFMPDVD
FT                   ERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPDDFVRQHFPMIYAKLLDLGMDLTK
FT                   EPIPIVPAAHYTCGGVVVDDYGRTDVDGLYAIGEVSYTGLHGANRMASNSLLECLVYGW
FT                   SAAMDIDRRMPSVHSVDALPAWDESRVENADERVVIQHNWHELRLLMWDYVGIVRTTKR
FT                   LERALRRITMLQQEIDEYYANFRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTLD
FT                   YPQQLAESGPSILSPLTPHINR"
FT   gene            311294..311473
FT                   /locus_tag="SPAB_00336"
FT   CDS_pept        311294..311473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65773"
FT                   /protein_id="ABX65773.1"
FT                   /translation="MLIKHKIKIRREINGKKYFIGQGVSVGFCSEIKMLLGYSAHDEMG
FT                   ISVQIVRCSASVDL"
FT   gene            311634..312209
FT                   /locus_tag="SPAB_00337"
FT   CDS_pept        311634..312209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A2563 8.1e-59 rpoE1; DNA-directed RNA
FT                   polymerase sigma subunit (RpoE,sigma24) K00960; COG:
FT                   COG1595 DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65774"
FT                   /inference="protein motif:HMMPfam:IPR007627"
FT                   /inference="protein motif:HMMPfam:IPR013249"
FT                   /inference="protein motif:ScanRegExp:IPR000838"
FT                   /inference="protein motif:superfamily:IPR013324"
FT                   /inference="protein motif:superfamily:IPR013325"
FT                   /inference="similar to AA sequence:INSD:CAD02789.1"
FT                   /protein_id="ABX65774.1"
FT                   /translation="MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGD
FT                   VPDVVQESFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAE
FT                   NFESGGALKEISNPENLMLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIM
FT                   DCPVGTVRSRIFRAREAIDNKVQPLIRR"
FT   gene            312241..312891
FT                   /locus_tag="SPAB_00338"
FT   CDS_pept        312241..312891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00338"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3073 Negative regulator of sigma E activity"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65775"
FT                   /inference="protein motif:HMMPfam:IPR005572"
FT                   /inference="protein motif:HMMPfam:IPR005573"
FT                   /inference="similar to AA sequence:INSD:AAL21533.1"
FT                   /protein_id="ABX65775.1"
FT                   /translation="MQKEKLSALMDGETLDSELLKALTHDPEMQKTWESYHLIRDSMRG
FT                   DTPDVLHFDISARVMAAIENEPVRQVSPLIPEAQPAPQQWQKMPFWKKVRPWAAQLTQM
FT                   GVAACVSLAVIVGVQHYNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEAAPVGSQQ
FT                   QQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ"
FT   gene            312981..313847
FT                   /locus_tag="SPAB_00339"
FT   CDS_pept        312981..313847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00339"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3026 Negative regulator of sigma E activity;
FT                   Psort location: Periplasmic, score:9.44"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65776"
FT                   /inference="protein motif:HMMPfam:IPR005588"
FT                   /inference="similar to AA sequence:INSD:AAX66549.1"
FT                   /protein_id="ABX65776.1"
FT                   /translation="MQQMNIASQSLNYELSFVSITKQGVESLRYRHARLDGRPLAQLLQ
FT                   LDGPRREVVQRGNEISYFEPGLEPFTLNGDYIVDSLPSLIYTDFKRLAPYYDFISVGRT
FT                   RIADRLCEVIRVVARDGTRYSYIVWMDMDTKLPMRVDLLDRDGETLEQFRVIAFTVSQD
FT                   IGSNMQALAKANLPPLLSVPGGEKTKFNWSPSWVPQGFSEVSSSRRPLPTMDNLPIESR
FT                   LYSDGLFSFSVNVNRATQNSSDQMLRTGRRTVYSSVRDNAEITIVGELPPQTAKRIADS
FT                   IKFRAVQ"
FT   gene            313844..314323
FT                   /locus_tag="SPAB_00340"
FT   CDS_pept        313844..314323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00340"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3086 Positive regulator of sigma E activity"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65777"
FT                   /inference="protein motif:HMMPfam:IPR007359"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149615.1"
FT                   /protein_id="ABX65777.1"
FT                   /translation="MIKEWATVISWQNGQAVVSCDVKASCSSCASRAGCGSRVLNKLGP
FT                   QTTHTIVVPSAEPLAPGQKVELGIAEKSLLGSALLVYMSPLAGLFLCAALFQMLFGSDF
FT                   AALSGAVLGGVGGFLVARGYSRKLAERDAWQPVILNVALPPNLVRVETTSIETRQ"
FT   gene            314353..314469
FT                   /locus_tag="SPAB_00341"
FT   CDS_pept        314353..314469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65778"
FT                   /protein_id="ABX65778.1"
FT                   /translation="MGCCPDKHALFLRCGVLQEKSEAFSSSRSPYTMNISSP"
FT   gene            complement(314466..314603)
FT                   /locus_tag="SPAB_00342"
FT   CDS_pept        complement(314466..314603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65779"
FT                   /protein_id="ABX65779.1"
FT                   /translation="MIEKLRMFFIEINYYALRLVDQTLEVAVLSLTSVLTETPHSTLQR
FT                   "
FT   gene            314704..316374
FT                   /locus_tag="SPAB_00343"
FT   CDS_pept        314704..316374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2891 3.9e-288 lepA; GTP-binding
FT                   elongation factor LepA K03596; COG: COG0481 Membrane GTPase
FT                   LepA; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65780"
FT                   /inference="protein motif:Gene3D:IPR000640"
FT                   /inference="protein motif:HMMPfam:IPR000640"
FT                   /inference="protein motif:HMMPfam:IPR000795"
FT                   /inference="protein motif:HMMPfam:IPR004161"
FT                   /inference="protein motif:HMMPfam:IPR013842"
FT                   /inference="protein motif:HMMTigr:IPR006297"
FT                   /inference="protein motif:superfamily:IPR009022"
FT                   /inference="protein motif:superfamily:IPR011051"
FT                   /inference="similar to AA sequence:SwissProt:Q57LC8"
FT                   /protein_id="ABX65780.1"
FT                   /translation="MDLERERGITIKAQSVTLDFKASDGETYQLNFIDTPGHVDFSYEV
FT                   SRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADPERVAEEI
FT                   EDIVGIDATDAVRCSAKTGVGVTDVLERLVRDIPPPQGDPDGPLQALIIDSWFDNYLGV
FT                   VSLVRIKNGTMRKGDKIKVMSTGQTYNADRLGIFTPKQVDRTELKCGEVGWLVCAIKDI
FT                   LGAPVGDTLTSARNPAEKALPGFKKVKPQVYAGLFPVSSDDYESFRDALGKLSLNDASL
FT                   FYEPESSSALGFGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVETTAKETIY
FT                   VDSPSKLPPLNNIYELREPIAECHMLLPQAYLGNVITLCIEKRGVQTNMVYHGNQVALT
FT                   YEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQASDMVRVDVLINNERVDALALITHR
FT                   DNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISR
FT                   KKKLLQKQKEGKKRMKQIGNVELPQEAFLAILHVGKDNK"
FT   gene            316391..317365
FT                   /locus_tag="SPAB_00344"
FT   CDS_pept        316391..317365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0275 1.3e-175 lepB; signal peptidase I
FT                   K03100; COG: COG0681 Signal peptidase I; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65781"
FT                   /inference="protein motif:HMMPanther:IPR000223"
FT                   /inference="protein motif:HMMPfam:IPR006198"
FT                   /inference="protein motif:HMMTigr:IPR000223"
FT                   /inference="protein motif:ScanRegExp:IPR000223"
FT                   /inference="protein motif:superfamily:IPR011056"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217564.1"
FT                   /protein_id="ABX65781.1"
FT                   /translation="MANMFALILVIATLVTGILWCVDKFVFAPKRRARQAAAQTASGDA
FT                   LDNATLNKVAPKPGWLETGASVFPVLAIVLIVRSFLYEPFQIPSGSMMPTLLIGDFILV
FT                   EKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKITYDPVAK
FT                   EVTIQPGCSSGQACENALPVTYSNVEPSDFVQTFARRNGGEATSGFFEVPLNETKENGI
FT                   RLTERKETLGDVTHRILMVPIAQDQLGMYYQQPGQPLATWVVPPGQYFMMGDNRDNSAD
FT                   SRYWGFVPEANLVGKAVAIWMSFDKQEGEWPTGVRLSRIGGIH"
FT   misc_feature    317482..317693
FT                   /note="rncO; Rfam score 225.63; SPAB_00345"
FT                   /inference="nucleotide motif:Rfam:RF00552"
FT   gene            318316..319221
FT                   /locus_tag="SPAB_00346"
FT   CDS_pept        318316..319221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00346"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A2554 6.5e-73 GTPase; COG: COG1159
FT                   GTPase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65782"
FT                   /db_xref="GOA:A9N1T2"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1T2"
FT                   /inference="protein motif:HMMPfam:IPR002917"
FT                   /inference="protein motif:HMMPfam:IPR004044"
FT                   /inference="protein motif:HMMTigr:IPR005225"
FT                   /inference="protein motif:HMMTigr:IPR005289"
FT                   /inference="protein motif:HMMTigr:IPR005662"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149619.1"
FT                   /protein_id="ABX65782.1"
FT                   /translation="MSTDKTYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRH
FT                   RIVGIHTEGPYQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPD
FT                   DEMVLNKLRDGKAPVILAVNKVDNVQEKADLLPHLQFLANQMNFLDIVPISAETGMNVD
FT                   TIAGIVRKHLPEAIHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFV
FT                   TNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLELWVKV
FT                   KSGWADDERALRSLGYVDDL"
FT   gene            319233..319961
FT                   /locus_tag="SPAB_00347"
FT   CDS_pept        319233..319961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00347"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1381 Recombinational DNA repair protein
FT                   (RecF pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65783"
FT                   /db_xref="GOA:A9N1T3"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1T3"
FT                   /inference="protein motif:HMMPfam:IPR003717"
FT                   /inference="protein motif:HMMTigr:IPR003717"
FT                   /inference="similar to AA sequence:INSD:AAO68003.1"
FT                   /protein_id="ABX65783.1"
FT                   /translation="MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSN
FT                   LKGALQPFTPLLLRYSGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYET
FT                   RFSELFFDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVDDTMT
FT                   YRYREEKGFFASVVIDNNTFTGRHLKALEAREFPDVDTLRAAKRFTRMALKPYLGGKPL
FT                   KSRELFRQFMPKRTVKTKKD"
FT   gene            319973..320704
FT                   /locus_tag="SPAB_00348"
FT   CDS_pept        319973..320704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2573 2.1e-124 pdxJ; carries out
FT                   condensation and ring closure step after PdxA in pyridoxine
FT                   biosynthesis K03474; COG: COG0854 Pyridoxal phosphate
FT                   biosynthesis protein; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65784"
FT                   /inference="protein motif:BlastProDom:IPR004569"
FT                   /inference="protein motif:HMMPfam:IPR004569"
FT                   /inference="protein motif:HMMTigr:IPR004569"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217560.1"
FT                   /protein_id="ABX65784.1"
FT                   /translation="MAELLLGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVH
FT                   LREDRRHITDRDVRILRQTLHTRMNLEMAVTEEMLAIAVETRPHFCCLVPEKRQEVTTE
FT                   GGLDVAGQRDKMRDACARLAAAGIQVSLFIDADEAQINAAAEVGAPFIEIHTGCYANAE
FT                   TDAEQAKELARIASAATLAARLGLKVNAGHGLTYHNVKAIAALPEMHELNIGHAIIGRA
FT                   VMTGLKEAVAEMKRLMLEARG"
FT   gene            320704..321084
FT                   /locus_tag="SPAB_00349"
FT   CDS_pept        320704..321084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2823 1.8e-61 acpS; holo-[acyl-carrier
FT                   protein] synthase K00997; COG: COG0736 Phosphopantetheinyl
FT                   transferase (holo-ACP synthase); Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65785"
FT                   /db_xref="GOA:A9N1T5"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1T5"
FT                   /inference="protein motif:BlastProDom:IPR004568"
FT                   /inference="protein motif:HMMPfam:IPR008278"
FT                   /inference="protein motif:HMMTigr:IPR002582"
FT                   /inference="protein motif:HMMTigr:IPR004568"
FT                   /inference="protein motif:superfamily:IPR008278"
FT                   /inference="similar to AA sequence:INSD:AAV76310.1"
FT                   /protein_id="ABX65785.1"
FT                   /translation="MAILGLGTDIVEIARIEAVISRSGERLARRVLSDNEWDIWETHQQ
FT                   PVRFLAKRFAVKEAAAKAFGTGIRNGLAFNQFEVFNDELGKPRLRLWGEALILAEKLGV
FT                   AHMHVTLADERHYACATVILES"
FT   gene            complement(321196..321381)
FT                   /locus_tag="SPAB_00350"
FT   CDS_pept        complement(321196..321381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0708 0.0043 fdxH; formate
FT                   dehydrogenase, beta subunit K00124; COG: COG1145
FT                   Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65786"
FT                   /inference="similar to AA sequence:INSD:CAD02778.1"
FT                   /protein_id="ABX65786.1"
FT                   /translation="MGDSIYEINSDKCTECVGHYETPTCQKVCPIPNTILQDPAHVETE
FT                   EQLWDKFVLMHHADKL"
FT   gene            complement(321494..322420)
FT                   /locus_tag="SPAB_00351"
FT   CDS_pept        complement(321494..322420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 1.0e-19 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65787"
FT                   /inference="protein motif:FPrintScan:IPR000847"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461510.1"
FT                   /protein_id="ABX65787.1"
FT                   /translation="MNIKQLHSFLILCDELHYGRAASRLFITQPSLSQQIKQLESSLKT
FT                   ILFKRKGRGIKLTKAGIILQRHANKIMLDLKNAENELLPYQDQQRDTISIGVSGSYLVL
FT                   PAFRNFMAHHPEISLNVKEFSTEQTIKKLTDSAVDIGIVYRTALPAQLSSTMLFEDEII
FT                   AAIPLSHPLATRERLHLKDLNDQPIIVLNDSLLLRGIITTEFNNRKVVPNVICELDNHY
FT                   SCLEYAEAQIGIAFITRSLTHLSTPKNVRLVSLGIPAFFIPVMLVHSNDLSLDNATICL
FT                   LKQIKNFYTVDNKSAPEKSWPEQKIGV"
FT   gene            322536..323732
FT                   /locus_tag="SPAB_00352"
FT   CDS_pept        322536..323732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:30298 2.6e-07 jak2b; Janus kinase 2b
FT                   K04447; COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65788"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217556.1"
FT                   /protein_id="ABX65788.1"
FT                   /translation="MSASINRWGMLAAHVCINFVLGGVYAFSYFKTPLMAQYHWDPATL
FT                   ALAFSINMGIIPLPMIWGGRMIDNGKGKQAIVIGGILFSLGFILSGFVDNLPMLFLTYG
FT                   VIAGLGSGLAFTGNLNNILKFFPDRRGLASGIVLAGVGVGTLLCTRLAEYFMAQTHDVS
FT                   RALLYLGIVYLVVIFIVQFFIRSAPAKDSGGIKGSPLDKDYRHMLKDLRFWLLFMILAL
FT                   GVFSGMVISSSSAQIGMTQYGLLSGALVVSLVSIFNSIGRLFWGGLTDKLGGYNTLVIV
FT                   YLFTCLCMLLLFFFNGNTSVFYFSALGVGFAYAGILVIFPGLTSQNFGMRNQGLNYGFM
FT                   YFGFAVGAVIAPYVTSAIAKYTGSYNTVFILTTVLLLIGVVLTLITKKYVATVLAKIH"
FT   gene            323754..324671
FT                   /locus_tag="SPAB_00353"
FT   CDS_pept        323754..324671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00353"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0284 1.2e-158 putative oxidoreductase
FT                   K00077; COG: COG1893 Ketopantoate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65789"
FT                   /inference="protein motif:HMMPfam:IPR013332"
FT                   /inference="protein motif:HMMPfam:IPR013752"
FT                   /inference="protein motif:HMMTigr:IPR003710"
FT                   /inference="protein motif:superfamily:IPR008927"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457102.1"
FT                   /protein_id="ABX65789.1"
FT                   /translation="MKIAIAGAGAMGCRFGYMLLEAGHDVTLIDSWQEHVDAIRSKGLF
FT                   VETETTQKYYPIPAMLADESQGEFELVILFTKAMQLDSMLQRIKPLLPAAKVVMILSNG
FT                   LGNIETLEKYVDRQKIYAGVTLWSSELEGAGHIMATGTGTIELQPIASQDSAQEAKVIA
FT                   TLNSAGLNAEISPDVLLSIWKKAAFNSVMNTYCALLDCNVGGFGQRPGALDLAQAVVDE
FT                   FVLVAASQNIPLTEQMVMNTVKKVFDPRESGHHYPSMHQDLHKGRLTEIDYLNGAIARI
FT                   GAQNNIAVPVNTLLTQLIHAKEAQ"
FT   gene            complement(324710..325558)
FT                   /locus_tag="SPAB_00354"
FT   CDS_pept        complement(324710..325558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I1550 3.9e-24
FT                   glucokinase/transcriptional regulator, RpiR family, fusion
FT                   K00845; COG: COG1737 Transcriptional regulators; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00354"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65790"
FT                   /inference="protein motif:HMMPfam:IPR000281"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149627.1"
FT                   /protein_id="ABX65790.1"
FT                   /translation="MNCLIRIRQRYPDLAQSDRKLADYLLAQPDTARHLSSQQLAAEAG
FT                   VSQSSVVKFAQKLGFKGFPALKLALSEALASNPNPHSVPVHNQIRGDDPMRLVGEKLIK
FT                   ENVAAMHATLDVNSEEKLLESVTMLRHARRIVITGIGASGLVAQNFAWKLLKIGINAVV
FT                   ERDMHALLATVQALAPEDLLLAISYSGERRELNLAADETLRAGAKILAITGFSPNALQQ
FT                   RATHCLYTIAEEQATRSAAISSTHAQMMLTDLLFMALVQQDLERAPERIRHSEALVKKL
FT                   V"
FT   gene            325674..326567
FT                   /locus_tag="SPAB_00355"
FT   CDS_pept        325674..326567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_2606 1.0e-05
FT                   glucosamine--fructose-6-phosphate aminotransferase,
FT                   isomerizing K00820; COG: COG2103 Predicted sugar phosphate
FT                   isomerase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65791"
FT                   /db_xref="GOA:A9N1U1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1U1"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="protein motif:HMMTigr:IPR005488"
FT                   /inference="protein motif:ScanRegExp:IPR005486"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZN25"
FT                   /protein_id="ABX65791.1"
FT                   /translation="MNLGTLVSETRNPQTMDLDALPTPELVKRFNEQDTLVAEAVKATL
FT                   PDVARAVDAAAAALKSGGRIIYMGAGTSGRLGVLDASECPPTFGVPHGLVVGLIAGGPG
FT                   ALLKAVEGAEDCQQAGEDDLVALNLQEQDLVVGLAASGRTPYVIGGLRYARQSGCTTVA
FT                   VSCNPDSPIAREANIAISPVVGPEALTGSTRLKSGTAQKMVLNMISTGAMVKFGKVYQN
FT                   LMVDMKATNVKLVDRACRMVVEATGIGREEAEALLKQTDFEVKPAILMALTGLDAAAAR
FT                   EKLAAHQGFLRAALEH"
FT   gene            326578..327939
FT                   /locus_tag="SPAB_00356"
FT   CDS_pept        326578..327939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2570 7.8e-235 PTS system,
FT                   sucrose-specific IIBC component, putative K02809:K02810;
FT                   COG: COG1264 Phosphotransferase system IIB components;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65792"
FT                   /inference="protein motif:HMMPfam:IPR001996"
FT                   /inference="protein motif:HMMPfam:IPR003352"
FT                   /inference="protein motif:ScanRegExp:IPR001996"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461505.1"
FT                   /protein_id="ABX65792.1"
FT                   /translation="MDKTAALASDILRGIGGEQNILRLENCMTRVRVEVQDDSQLDIPR
FT                   LKALPGVSGYVKQGEQHQLIVGPGKAAQVVDAMRVQIAAGGVKPDDAMARTKSEAKAKY
FT                   KAPMSDALRKLANVFIPLIPAFIASGLITGIINILKRPDIVGDVAVHYPNLLGLMGIFG
FT                   SAVFAIMNILVGVNTAKVFGGSQALGGVMAGILSSPQLAQITLFGEALQPGRGGVIAVL
FT                   LVVALMCWIERQFRKLLPGSLELILNPLLTTVITGAVAIVALQPLGGWISDAIAHGASW
FT                   AIDRGGFLVGAVLAGTFLPLVLTGLHQGLVPIHVELVQAHGYNALFPILAMAGVGQIGA
FT                   AIAVLMKTRNARLKKVIKGALPVGLLGIGEPLIFGVTLPLGKPFIGACLGGAVGGALIS
FT                   YWKVATVITFGISGLPLALTIVAGKVLFYLLGYLIAVIAGFIFTWLLGFNDPEE"
FT   gene            327943..328578
FT                   /locus_tag="SPAB_00357"
FT   CDS_pept        327943..328578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00357"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0560 Phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65793"
FT                   /inference="protein motif:HMMTigr:IPR006435"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461504.1"
FT                   /protein_id="ABX65793.1"
FT                   /translation="MVSHERRVVFFDLDGTLHQQDMFGSFLRYLLRRQPLNALLVLPLL
FT                   PIIGIGLLVKGRAARWPMSLLLWGCTFGHSETRLQAHQADFVRWFRANVTAFPVVQERL
FT                   TTYLLGSDADIWLITGSPQSLVEQVYFDTPWLPRVNLIASQMARRYGGWVLTVRCLGHE
FT                   KVAQLERKIGTPLRLYSGYSDSKQDNPLLYFCQHRWRVTPHGELQQLE"
FT   gene            328636..329154
FT                   /locus_tag="SPAB_00358"
FT   CDS_pept        328636..329154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0289 1.2e-89 yfhC; hypothetical protein
FT                   K01500; COG: COG0590 Cytosine/adenosine deaminases; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65794"
FT                   /inference="protein motif:HMMPfam:IPR002125"
FT                   /inference="protein motif:ScanRegExp:IPR002125"
FT                   /inference="similar to AA sequence:INSD:CAD02770.1"
FT                   /protein_id="ABX65794.1"
FT                   /translation="MFDVELDHEYWMRHALTLAKRAWDEREVPVGAVLVHNHRVIGEGW
FT                   NRPIGRHDPTAHAEIMALRQGGLVLQNYRLLDTTLYVTLEPCVMCAGAMVHSRIGRVVF
FT                   GARDAKTGAAGSLIDVLHHPGMNHRVEIIEGVLRDECATLLSDFFRMRRQEIKALNKAD
FT                   RAEGAGPAV"
FT   gene            complement(329205..330749)
FT                   /locus_tag="SPAB_00359"
FT   CDS_pept        complement(329205..330749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2878 6.6e-238 yfhD; putative
FT                   periplasmic binding transport protein K01238; COG: COG4623
FT                   Predicted soluble lytic transglycosylase fused to an
FT                   ABC-type amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00359"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65795"
FT                   /db_xref="GOA:A9N1U5"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023703"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1U5"
FT                   /inference="protein motif:HMMPfam:IPR008258"
FT                   /inference="protein motif:HMMSmart:IPR001638"
FT                   /inference="protein motif:ScanRegExp:IPR000189"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461502.1"
FT                   /protein_id="ABX65795.1"
FT                   /translation="MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHIAAIQARGVL
FT                   RVSTIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLKVTVRQNISQLFDDLDSGNADL
FT                   LAAGLVYDSARVKNYQPGPMYYSVSQQLVYRVGQYRPRSLATVNENQLTIAPGHVVVND
FT                   LQRLKETKFPDLSWKVDDKKGSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALD
FT                   VTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFL
FT                   RAVDNVLPELEPLFKKYAKEIDWRLLAAISYQESHWDPLATSPTGVRGLMMLTKNTAQS
FT                   LGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARSLTV
FT                   KTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEK
FT                   EKQEAEAMKLAQDYPAVSPEELNKAPFPFLSFLSQSSGYLTHSPSLLFTPQKKEEK"
FT   gene            complement(330750..330869)
FT                   /locus_tag="SPAB_00360"
FT   CDS_pept        complement(330750..330869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65796"
FT                   /inference="similar to AA sequence:INSD:AAL21460.1"
FT                   /protein_id="ABX65796.1"
FT                   /translation="MRISCQLAHCYAKCRSLMTYLLQQNIFFSPRQRTIQRIN"
FT   gene            331005..334892
FT                   /locus_tag="SPAB_00361"
FT   CDS_pept        331005..334892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2565 0. purG;
FT                   phosphoribosylformylglycinamidine synthetase K01952; COG:
FT                   COG0046 Phosphoribosylformylglycinamidine (FGAM) synthase,
FT                   synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65797"
FT                   /inference="protein motif:HMMPfam:IPR000728"
FT                   /inference="protein motif:HMMPfam:IPR010918"
FT                   /inference="protein motif:HMMTigr:IPR010073"
FT                   /protein_id="ABX65797.1"
FT                   /translation="MMEILRGSPALSAFRINKLLARFQAANLQVHNIYAEYVHFADLNA
FT                   PLNDSEQAQLTRLLQYGPALSSHTPAGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVD
FT                   RLERGVAYYIEASTLTAEQWRQVAAELHDRMMETVFSSLTDAEKLFIHHQPAPVSSVDL
FT                   LGEGRQALIDANLRLGLALAEDEIDYLQEAFTKLGRNPNDIELYMFAQANSEHCRHKIF
FT                   NADWIIDGKPQPKSLFKMIKNTFETTPDYVLSAYKDNAAVMEGSAVGRYFADHNTGRYD
FT                   FHQEPAHILMKVETHNHPTAISPWPGAATGSGGEIRDEGATGRGAKPKAGLVGFSVSNL
FT                   RIPGFEQPWEEDFGKPERIVTALDIMTEGPLGGAAFNNEFGRPALTGYFRTYEEKVNSH
FT                   NGEELRGYHKPIMLAGGIGNIRADHVQKGEIVVGAKLIVLGGPAMNIGLGGGAASSMAS
FT                   GQSDADLDFASVQRDNPEMERRCQEVIDRCWQLGDANPILFIHDVGAGGLSNAMPELVS
FT                   DGGRGGKFELRDILSDEPGMSPLEIWCNESQERYVLAVAADQLPLFDELCKRERAPYAV
FT                   IGDATEEQHLSLHDNHFDNQPIDLPLDVLLGKTPKMTRDVQTLKAKGDALSRADITIAD
FT                   AVNRVLHLPTVAEKTFLVTIGDRTVTGMVARDQMVGPWQVPVADCAVTTASLDSYYGEA
FT                   MSIGERAPVALLDFAASARLAVGEALTNIAATQIGDIKRIKLSANWMAAAGHPGEDAGL
FT                   YDAVKAVGEELCPQLGLTIPVGKDSMSMKTRWQEGNEQREMTSPLSLVISAFARVEDVR
FT                   HTLTPQLSTEDNALLLIDLGKGHNALGATALAQVYRQLGDKPADVRDVAQLKGFYDAMQ
FT                   TLVAARKLLAWHDRSDGGLLVTLAEMAFAGHCGVQVDIAALGDDHLAALFNEELGGVIQ
FT                   VRAEDRDAVEALLAQYGLADCVHYLGQALAGDRFVITANDQTVFSESRTTLRVWWAETT
FT                   WQMQRLRDNPQCADQEHEAKANDADPGLNVKLSFDINEDIAAPYIATGARPKVAVLREQ
FT                   GVNSHVEMAAAFHRAGFDAIDVHMSDLLGGRIGLGNFHALVACGGFSYGDVLGAGEGWA
FT                   KSILFNHRVRDEFETFFHRPQTLALGVCNGCQMMSNLRELIPGSELWPRFVRNHSDRFE
FT                   ARFSLVEVTQSPSLLLQGMVGSQMPIAVSHGEGRVEVRDDAHLAALESKGLVALRYVDN
FT                   FGKVTETYPANPNGSPNGITAVTTENGRVTIMMPHPERVFRTVANSWHPENWGEDSPWM
FT                   RIFRNARKQLG"
FT   gene            complement(335151..335279)
FT                   /locus_tag="SPAB_00362"
FT   CDS_pept        complement(335151..335279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65798"
FT                   /protein_id="ABX65798.1"
FT                   /translation="MCQHSKDFVNTMIDMKNIVIHAKNGSVCFLPFLSPISNTFNT"
FT   gene            complement(335299..335447)
FT                   /locus_tag="SPAB_00363"
FT   misc_RNA        complement(335299..335447)
FT                   /locus_tag="SPAB_00363"
FT                   /product="tke1 RNA"
FT                   /note="Rfam score 180.05"
FT                   /inference="nucleotide motif:Rfam:RF00128"
FT   gene            335530..336972
FT                   /locus_tag="SPAB_00364"
FT   CDS_pept        335530..336972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2559 2.6e-250 yfhK; putative sensory
FT                   kinase in regulatory system K07711; COG: COG0642 Signal
FT                   transduction histidine kinase; Psort location:
FT                   CytoplasmicMembrane, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65799"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMPfam:IPR003661"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR003661"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="protein motif:superfamily:IPR009082"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217546.1"
FT                   /protein_id="ABX65799.1"
FT                   /translation="MSDTLKRWSVFPRSLRQLVMLAFLLILLPLLVLAWQAWQSLNALS
FT                   DQAAVTNRSTLIDARRSEAMTNVALEMERSYRQYCVLDDPTLAKVYQSQRKRYSDMLDA
FT                   HAGVLPDDKLYQALRQDLNALAQLQCKDSGPEAAAAARLEAFANANTEMVQATRTVVYS
FT                   RGQQLQQEIAERGQFFGWQALVLFLVSLAMVLLFTRMIIGPVKGIERMINRLGEGRSLG
FT                   NTVTFTGPRELRSVGQRIIWLSERLAWLESQRHQFLRHLSHELKTPLASMREGTELLAD
FT                   QVVGPLTPEQKEVVDILDGSSRNLQKLIEQLLDYNRKLVDSATELEAVDIAPLVDMVVS
FT                   AHSLPARAKMMHTDVDLEAERCIAEPMLLMSVLDNLYSNAVHYGAESGNICIRSRSQGS
FT                   TVYIDVVNSGEPIPQTEREMIFEPFFQGSHQRKGAVKGSGLGLSIARDCIRRMQGEIQL
FT                   VDDNAQEVCFRISLPLPASDKH"
FT   gene            337052..337738
FT                   /locus_tag="SPAB_00365"
FT   CDS_pept        337052..337738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00365"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06210 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65800"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804169.1"
FT                   /protein_id="ABX65800.1"
FT                   /translation="MGISCLALTACVPHASQQLPGSAAQDTLPHYQLADYLPTACADIW
FT                   SLRGQAVETNPLYWLRTIDCADRLMPVQSRAEARALTDDNWQNAFRRGILLADAKITPP
FT                   ERRAIVTRLEALSAQIPAQVRPVYQIWHDGQALQLALSAERQRYSKLQQTSDSELDALR
FT                   QQQQALQTQLDLTTRKLESLTDIERQLSTRKPAGNYNADTPHTNDKPATSEDGAAPSPS
FT                   QDEVTP"
FT   gene            337735..339072
FT                   /locus_tag="SPAB_00366"
FT   CDS_pept        337735..339072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2502 9.1e-83 atoC; acetoacetate
FT                   metabolism regulatory protein AtoC K07714; COG: COG2204
FT                   Response regulator containing CheY-like receiver, AAA-type
FT                   ATPase, and DNA-binding domains; Psort location:
FT                   Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00366"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65801"
FT                   /inference="protein motif:BlastProDom:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR002078"
FT                   /inference="protein motif:HMMSmart:IPR001789"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR002078"
FT                   /inference="protein motif:superfamily:IPR011006"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461497.1"
FT                   /protein_id="ABX65801.1"
FT                   /translation="MISRKPAHLLLVDDDPGLLKLLGMRLTSEGYSVVTAESGQEGLRV
FT                   LHREKVDLVISDLRMDEMDGMQLFTEIQKVQPGMPVIILTAHGSIPDAVAATQKGVFSF
FT                   LTKPIDRDALYKAIDEALEQSAPATDDSWRNAIVTRSPLMLRLLEQARMVAQSDVSVLI
FT                   NGQSGTGKEIFAQAIHNASPRSNKPFVAINCGALPEQLLESELFGHARGAFTGAVSNRE
FT                   GLFQAAEGGTLFLDEIGDMPAPLQVKLLRVLQERKVRPLGSNRDIDIDVRIISATHRDL
FT                   PKAMARGEFREDLYYRLNVVSLKIPALAERTEDIPLLANHLLRQSAQRHKPFVRAFSTD
FT                   AMKRLMTASWPGNVRQLVNVIEQCVALTSSPVISDALVEQALEGENTALPTFAEARNQF
FT                   ELNYLRKLLQITKGNVTHAARMAGRNRTEFYKLLSRHELDANDFKE"
FT   gene            339149..339487
FT                   /locus_tag="SPAB_00367"
FT   CDS_pept        339149..339487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00367"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0347 Nitrogen regulatory protein PII; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65802"
FT                   /inference="protein motif:BlastProDom:IPR002187"
FT                   /inference="protein motif:Gene3D:IPR002187"
FT                   /inference="protein motif:HMMPfam:IPR002187"
FT                   /inference="protein motif:ScanRegExp:IPR002187"
FT                   /inference="protein motif:ScanRegExp:IPR002332"
FT                   /inference="similar to AA sequence:INSD:ABB67124.1"
FT                   /protein_id="ABX65802.1"
FT                   /translation="MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTEL
FT                   YRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRT
FT                   GEEDDAAI"
FT   gene            complement(339536..340996)
FT                   /locus_tag="SPAB_00368"
FT   CDS_pept        complement(339536..340996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00368"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3104 Dipeptide/tripeptide permease; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00368"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65803"
FT                   /inference="protein motif:HMMPanther:IPR000109"
FT                   /inference="protein motif:HMMPanther:IPR005279"
FT                   /inference="protein motif:HMMPfam:IPR000109"
FT                   /inference="protein motif:HMMTigr:IPR005279"
FT                   /inference="protein motif:ScanRegExp:IPR000109"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461495.1"
FT                   /protein_id="ABX65803.1"
FT                   /translation="MKTPSQPRAIFYIVAIQIWEYFSFYGMRALLILYLTHQLGFNDSH
FT                   AINLFSAYASLVYVTPILGGWLADRLLGNRVAVITGALLMTLGHVVLGLESDSTLSLYA
FT                   ALAIIICGYGLFKSNISCLLGELYAPDDNRRDGGFSLLYAAGNIGSIAAPIACGLAAQW
FT                   YGWHVGFALAGVGMFIGLLIFLSGHRHFQQTRGVNRPALRAVKFALPTWGWLVLMLCIA
FT                   PVFFTLLLENNWSGYVLAIVCVFAAQLIARIMVKFPEHRRALWQIVLLMITGTLFWVLA
FT                   QQGGSSISLFIDRFVNRHWLNMTVPTALFQSVNAIAVMAAGVVLAWLSSPKESARSVLR
FT                   VWLKFAVGLVLMGGGFMLLALNAHQAQLDGQASMGMMIAGLALMGFAELFIDPVAMAQI
FT                   TRLNLPGVTGVLTGIYMLATGAVANWLAGVVAQQTTESQISDTAVAAYGHFFSQMGEWT
FT                   LSCVALIVAIVGLRWVCTRTTSALPQGD"
FT   gene            complement(341052..343196)
FT                   /locus_tag="SPAB_00369"
FT   CDS_pept        complement(341052..343196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2559 0. cadA; lysine decarboxylase 1
FT                   K01582; COG: COG1982 Arginine/lysine/ornithine
FT                   decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65804"
FT                   /inference="protein motif:HMMPfam:IPR000310"
FT                   /inference="protein motif:HMMPfam:IPR005308"
FT                   /inference="protein motif:HMMPfam:IPR008286"
FT                   /inference="protein motif:HMMPIR:IPR011193"
FT                   /inference="protein motif:ScanRegExp:IPR000310"
FT                   /inference="protein motif:superfamily:IPR008286"
FT                   /protein_id="ABX65804.1"
FT                   /translation="MNVIAIMNHMGVYFKEEPIRELHRALEGLNFRIVYPNDREDLLKL
FT                   IENNSRLCGVIFDWDKYNLELCEEISKLNEYMPLYAFANSYSTLDVSLNDLRMQVRFFE
FT                   YALGAAADIAAKIRQNTDEYIDNILPPLTKALFKYVREGKYTFCTPGHMGGTAFQKSPV
FT                   GSIFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEAEEYIARVFNAERSYMVTNGTST
FT                   ANKIVGMYSAPAGSTVLIDRNCHKSLTHLMMMSDITPIYFRPTRNAYGILGGIPQSEFQ
FT                   HATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDYIKKTLDVKSIHFDSAWVPYTNFS
FT                   PIYQGKCGMSGDRVEGKIIYETQSTHKLLAAFSQASMIHVKGDINEETFNEAYMMHTTT
FT                   SPHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIKRLKSESDGWFFDVWQPEH
FT                   IDGAECWPLRSDSAWHGFKNIDNEHMYLDPIKVTILTPGMKKDGTMDEFGIPASLVAKY
FT                   LDERGIIVEKTGPYNLLFLFSIGIDKTKALSLLRALTEFKRAFDLNLRVKNILPALYRE
FT                   APEFYENMRIQELAQNIHKLVEHHNLPDLMYRAFEVLPKMVMTPYTAFQKELHGETEEV
FT                   YLEEMVGRVNANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLCEIGAHYPGFETDIH
FT                   GAYRQADGRYTVKVLKENTK"
FT   gene            complement(343279..344610)
FT                   /locus_tag="SPAB_00370"
FT   CDS_pept        complement(343279..344610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0120 6.9e-10 aroP; aromatic amino
FT                   acid transport protein AroP K03293; COG: COG0531 Amino acid
FT                   transporters; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65805"
FT                   /inference="protein motif:HMMPanther:IPR002293"
FT                   /inference="protein motif:HMMPfam:IPR004841"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461493.1"
FT                   /protein_id="ABX65805.1"
FT                   /translation="MSSVKKIGLFACTGVVAGNMMGSGIALLPANLASIGGIAIWGWVI
FT                   SIIGAMSLAYVYARLATKNPQQGGPIAYAGEISPAFGFQTGVLYYHANWIGNLAIGITA
FT                   VSYLSTFFPALNNPIPAGIACIAIVWLFTFINMLGGAWVSRLTTIGLFLVLIPVVLTAV
FT                   AGWHWFDIATYHANWNTSTTTDSHAIVKSILLCLWAFVGVESAAVSTGMVKNPKRTVPL
FT                   ATMLGTALAGIIYIAATQVIAGMFPASVMASSGAPFAISTSTILGGWAAPLVSAFTAFA
FT                   CLTSLGSWMMLVGQAGVRAANDGNFPKIYGEMDKNGIPKKGLLLAAVKMTALMILITIM
FT                   NSSGGKASDLFGELTGIAVLLTMLPYFYSCVDLIRFEGFNIRNSVSLICSVLGCAFCFI
FT                   ALMGASSFELSGTFIVSLIILMFYGRKMHQRQNNDSDNNTAEAL"
FT   gene            complement(344971..346512)
FT                   /locus_tag="SPAB_00372"
FT   CDS_pept        complement(344971..346512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:RL2429 1.0e-08 cya; putative adenylate
FT                   cyclase K01768; COG: COG3710 DNA-binding winged-HTH
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65807"
FT                   /inference="protein motif:BlastProDom:IPR001867"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR001867"
FT                   /inference="similar to AA sequence:INSD:AAL21451.1"
FT                   /protein_id="ABX65807.1"
FT                   /translation="MQQPVVRIGEWLVTPSVNQISRQGRQITLEPRLIDLLMYFAHHPD
FT                   EVLSRDNIIDHVWMRTIVTNHVVTQSISELRKSLRDGGDSNAEYIVTVPKRGYKLTAPV
FT                   IWCEENSDEIDNSSTSPPPIAATNAEPTEGVPAAAPVPPASLQTPTKKAKKPRIAAFWT
FT                   WVMFLLSLATLVVFIVMSVVDHNAAVTKTRLLLNPRDIDVRFEGGNSCNNWVSQESYAI
FT                   GLGGLITDLLNTYSTFMVHDKTNYRVNEPSSSGKTLTIQFVNQRHYRAQQCFMSVVLID
FT                   NADGSTMLDKRYFVTNTNQLSIQDDLFNSLSFVLTQPWPNRMREQLALFRTPQNTALMR
FT                   FYEARQLILSGDAQALGKASDILNGIIKETPDFNYAYEYKVLVDVLRQSQQPFDKEQVT
FT                   ALNEEFKKIDQIPGVEKTSVYYKIKTVDLLGKGDIDAAYEEINKSIELEMSWFNYVLLG
FT                   KVYEMKGENRLAADAYLTAFNLRPGENTLYWIENGVFQTSVQKIVPYLNSFLAED"
FT   gene            346490..346606
FT                   /locus_tag="SPAB_00371"
FT   CDS_pept        346490..346606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65806"
FT                   /protein_id="ABX65806.1"
FT                   /translation="MRTTGCCIKRCPNELSQTLIITRFAQTFFIPLFCKRKA"
FT   gene            complement(346694..347884)
FT                   /locus_tag="SPAB_00373"
FT   CDS_pept        complement(346694..347884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0300 2.5e-215 hmpA; flavohemoprotein
FT                   K05916; COG: COG1018 Flavodoxin reductases
FT                   (ferredoxin-NADPH reductases) family 1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65808"
FT                   /inference="protein motif:Gene3D:IPR012292"
FT                   /inference="protein motif:HMMPfam:IPR000971"
FT                   /inference="protein motif:HMMPfam:IPR001433"
FT                   /inference="protein motif:HMMPfam:IPR008333"
FT                   /inference="protein motif:superfamily:IPR009050"
FT                   /inference="similar to AA sequence:INSD:AAO68025.1"
FT                   /protein_id="ABX65808.1"
FT                   /translation="MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNM
FT                   SNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGTHLLA
FT                   TLDEMFNPGQEVLDAWGKAYGVLANVFIHREAEIYHENASKDGGWEGTRPFRIVAKTPR
FT                   SALITSFEFEPVDGGTVAEYRPGQYLGVWLKPEGFAHQEIRQYSLTRKPDGKGYRIAVK
FT                   REDGGQVSNWLHNHASVGDVVHLAAPAGDFFMNVAADTPVSLISAGVGQTPMLAMLDTL
FT                   AKEQHTAQVNWFHAAENGDVHAFADEVSELGRTLPRFTAHTWYREPTEADRAQRVFDSE
FT                   GLMDLSKLEAAISDPAMQFYLCGPVGFMQFAAKQLVSLGVNNENIHYECFGPHKVL"
FT   gene            347925..348071
FT                   /locus_tag="SPAB_00374"
FT   CDS_pept        347925..348071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65809"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217537.1"
FT                   /protein_id="ABX65809.1"
FT                   /translation="MHLIKIPLHCKWFFSALRYGGNNVKNLHHKAEKKSVEIRQALVQE
FT                   TLI"
FT   gene            348209..349462
FT                   /locus_tag="SPAB_00375"
FT   CDS_pept        348209..349462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2555 6.4e-224 glyA; serine
FT                   hydroxymethyltransferase K00600; COG: COG0112
FT                   Glycine/serine hydroxymethyltransferase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65810"
FT                   /db_xref="GOA:A9N1W0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1W0"
FT                   /inference="protein motif:HMMPanther:IPR001085"
FT                   /inference="protein motif:HMMPfam:IPR001085"
FT                   /inference="protein motif:HMMPIR:IPR001085"
FT                   /inference="protein motif:ScanRegExp:IPR001085"
FT                   /inference="similar to AA sequence:INSD:AAX66455.1"
FT                   /protein_id="ABX65810.1"
FT                   /translation="MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQ
FT                   AQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHSGSQANFA
FT                   VYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIVPYGIDESGKIDYDEMAKLAK
FT                   EHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVPHAHV
FT                   VTTTTHKTLAGPRGGLILAKGGDEELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAME
FT                   PEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEADAALGRA
FT                   NITVNKNSVPNDPKSPFVTSGIRIGSPAVTRRGFKEAEVKELAGWMCDVLDNINDEATI
FT                   ERVKAKVLDICARFPVYA"
FT   gene            complement(349547..349669)
FT                   /locus_tag="SPAB_00377"
FT   CDS_pept        complement(349547..349669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65812"
FT                   /protein_id="ABX65812.1"
FT                   /translation="MQCHDSLPFGGDSLAVNGCAGKGNIRLTGGGRSSNGNAAG"
FT   gene            349658..350797
FT                   /locus_tag="SPAB_00376"
FT   CDS_pept        349658..350797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3355 0.00100 nupG; transport of
FT                   nucleosides, permease protein K03289; COG: COG0477
FT                   Permeases of the major facilitator superfamily; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65811"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:INSD:AAX66454.1"
FT                   /protein_id="ABX65811.1"
FT                   /translation="MALHSTRWLALSYFTYFFSYGIFLPFWSVWLKGLGLTPETIGLLL
FT                   GVGLVARFLGSLLIAPRVSDPSRLISALRVLALLTLVFALAFWAGTHVAWLMVVMVGFN
FT                   LFFSPLVPLTDALANTWQKQITLDYGRVRLWGSIAFVIGSALTGKLVSLYDYQAILALL
FT                   TLGVASMLLGMLLRPSVPPQGESRQQESAGWPAWRTLVAQSWRFLACVCLLQGAHAAYY
FT                   GFSAIYWQGAGYSASAVGYLWSLGVVAEVIIFALSKKLFRRFSARDLLLLSAVCGVVRW
FT                   GLMGWSTALPWLIVIQILHCGTFTVCHLAAMRYIAARQGSEVIRLQAVYSAVAMGGSIA
FT                   IMTVFAGFLYQHLGGGVFWIMALVALPAIFLRPKVVAAS"
FT   gene            complement(350792..352069)
FT                   /locus_tag="SPAB_00378"
FT   CDS_pept        complement(350792..352069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spz:M5005_Spy_1664 0.0023 PTS system, mannitol
FT                   (cryptic)-specific IIA component K00890; COG: COG3711
FT                   Transcriptional antiterminator; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65813"
FT                   /inference="protein motif:HMMPfam:IPR011608"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461488.1"
FT                   /protein_id="ABX65813.1"
FT                   /translation="MMPTIAPPSVLSAPQRRCQVLLTLFQPEPIATVEIFSALNGVDDD
FT                   TAREDITETSLEIQRYHRLAITTCQNGCYRIEGTALDQRLCLLHWLRRGLRLCPTFVTQ
FT                   QFTPALKNALKQRGIARPLYDDINLHALINLCARRLQKPFEHRDVQFLRLFLQYCLLQH
FT                   HAGITPEFNPVQQIWAQSCAEYPLAQEIGRHWQRHVMQAAPLNEALFMALLFSMIRLPD
FT                   PIRDTHQRAQQLRLEVARLVLRFREKGNVRFSDEQGLNDQLYVHLAQALNRSLFTIGID
FT                   NTLPEEFNRLYPRLVRTTREALAGFEAEYGIHFSEEETGLVAVIFGAWLMQDNDLHERQ
FT                   IVLLADKNDALETHIEQQLRELTLLPLNIRRISLQAFQKEGCPRGVALIVTPYATPLPL
FT                   FSPPLIHADRTLTAHQQQQIRKILES"
FT   gene            352165..352833
FT                   /locus_tag="SPAB_00379"
FT   CDS_pept        352165..352833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00379"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3683 ABC-type uncharacterized transport
FT                   system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65814"
FT                   /inference="protein motif:HMMPfam:IPR010412"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149645.1"
FT                   /protein_id="ABX65814.1"
FT                   /translation="MSQNFYREEQMKPVKRSALTLFLAVLSFVAAAHPHSFIRLQTQVV
FT                   SENEQFVALKMRWTMDALTSADLLYDAGNAAPGSEIWKKLAAEVMANVLGQHYFTEVWR
FT                   NGAKVKFKNRPTEYGMTRDAHQAVLTFTLPLAEPQPLSGQTYTFSTFDPSYYVDMHYDQ
FT                   DSDITMPEPLREKCRIQVYTPAPGEETLRFAQSLDKEDAPPEDMDLGKQFAQTVTLQCQ
FT                   "
FT   gene            352824..353810
FT                   /locus_tag="SPAB_00380"
FT   CDS_pept        352824..353810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll9630 0.0013 cytochrome c oxidase
FT                   subunit I K02274; COG: COG2215 ABC-type uncharacterized
FT                   transport system, permease component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65815"
FT                   /inference="protein motif:HMMPfam:IPR011541"
FT                   /inference="similar to AA sequence:INSD:AAL21445.1"
FT                   /protein_id="ABX65815.1"
FT                   /translation="MSVIFSQRAPGRRWLSLWPLALFLLLMLVGGLWIWQAWPQVMLKS
FT                   ALWQRDVNQQLSALLNAVATHPERAGGSLLLLSFMYGVLHALGPGHGKVVIATWLATHP
FT                   SKLKSSIVLTLAAALLQGLVAIGLVVGVLTVLQLPARQLHLSGFWLEKGSYALVGGLGI
FT                   LLCWRAIKRLRALLRKPVFIAFTPRHVHHEKCGCGHQHLPTQEQLHSGDDWRARFMIVL
FT                   SMGMRPCSGAIMVLLFSKVIGVFSWGMASVLAMAAGTSLTITSLALLVHTFRALAVKLS
FT                   GNKAPALWRQVGWSTLALAGGVILLVAALVMWFSVPQPVGGLRPWRG"
FT   gene            complement(353811..354824)
FT                   /locus_tag="SPAB_00381"
FT   CDS_pept        complement(353811..354824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0306 4.0e-183 asrC; anaerobic sulfite
FT                   reductase subunit C K00385; COG: COG2221 Dissimilatory
FT                   sulfite reductase (desulfoviridin), alpha and beta
FT                   subunits; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65816"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:HMMPfam:IPR005117"
FT                   /inference="protein motif:HMMPfam:IPR006067"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR006066"
FT                   /inference="protein motif:superfamily:IPR011255"
FT                   /inference="similar to AA sequence:INSD:AAX66450.1"
FT                   /protein_id="ABX65816.1"
FT                   /translation="MSIDIDIIKARAKNEYRLSKVRGEAMISVRIPGGILPAHLLTVAR
FT                   DIAETWGNGQIHLTTRQKLAMPGIRYEDIDNVNAALEPFLREIEIELCDVQVEDTKAGY
FT                   LAIGGRNIVACQGNRICQKANTDTTGLSRRLEKLVYPSPYHLKTVIVGCPNDCAKASMA
FT                   DLGIIGVAKMRFTANRCIGCGACVKACSHHAVGCLALKNGKAVKEESACIGCGECVLAC
FT                   PTLAWQRKPDQLWQVRLGGRTSKKTPRVGKLFLNWVTEDVIKQVIVNLYEFEKEMLGGK
FT                   PIYLHMGHLIDKGGYLRFKERVLRGVQLNPEAMVAERIYWAEDESVARMHLKPAGH"
FT   gene            complement(354835..355653)
FT                   /locus_tag="SPAB_00382"
FT   CDS_pept        complement(354835..355653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0256 9.7e-63 anaerobic sulfite
FT                   reductase subunit B; COG: COG0543 2-polyprenylphenol
FT                   hydroxylase and related flavodoxin oxidoreductases; Psort
FT                   location: Cytoplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65817"
FT                   /inference="protein motif:HMMPfam:IPR001433"
FT                   /inference="protein motif:HMMPfam:IPR008333"
FT                   /inference="protein motif:HMMPIR:IPR012165"
FT                   /inference="similar to AA sequence:INSD:AAL21443.1"
FT                   /protein_id="ABX65817.1"
FT                   /translation="MSHCSCHDKPQHSLLPAAYRILSITRHTPLEWNFRVAVDFPAHWG
FT                   QFVEVSLPRVGEAPISVSDYGDGWIDLLIRNVGKVTSALFTLKEGDNVWLRGCYGNGYP
FT                   VDTLRHKPLLVVAGGTGVAPVKGLMRYFVENPQEIGQLDMILGYKNRDCVLYKEEMATW
FT                   RGKHNLVLTLDEGEADDRYQIGRVTDRLADMTLSDIDTMQAIVVGPPIMITFTVKMLLQ
FT                   KGLKPEQIWVDYERRMACSVGKCGHCRMGEVYVCTDGPIFNYAVAQRFAD"
FT   gene            complement(355657..356700)
FT                   /locus_tag="SPAB_00383"
FT   CDS_pept        complement(355657..356700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0257 1.6e-78 anaerobic sulfite
FT                   reductase subunit A K00437; COG: COG1145 Ferredoxin; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65818"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="protein motif:superfamily:IPR009051"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149649.1"
FT                   /protein_id="ABX65818.1"
FT                   /translation="MAIKITPDEFSLLIQRLNKKWRVFAPSAEFRGGRFSDTDNIIYQR
FT                   ISGWRDLIWHEKSHMSPNTIIAPITETLFYFDKDTIQIAETDTSPIIIFARACDINAMS
FT                   RLDYMYLSNGNNSDYSYQLLREHIRFVLIECEESFENCFCVSMGTNKTDCYSAAMRFSD
FT                   EGALVSIRDPFIEAAIQGLGQEADYTPSFVSENRETVVTPDSVCRDPQKIRDILTRHPL
FT                   WDAYDSRCISCGRCTTGCPTCTCYSVFDVAYDENPQRGERRRQWASCMVPGFSDMAGGH
FT                   GFREKPGERLRYRALHKVNDYKARNGIEHMCVGCGRCDDRCPQYIKFSLIINKMTAAVR
FT                   QALAEEA"
FT   gene            complement(356882..357760)
FT                   /locus_tag="SPAB_00384"
FT   CDS_pept        complement(356882..357760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfx:S2753 5.5e-108 putative enzyme; COG:
FT                   COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00384"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65819"
FT                   /inference="protein motif:HMMPfam:IPR000073"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217528.1"
FT                   /protein_id="ABX65819.1"
FT                   /translation="MTLQHTRRIVKSLFILFIIVVCIYLLPRVAINAFYYPDNKVYGPT
FT                   PAEAESITFTAKDGTHLHGWFIPTAFGRPENAVATVIHVHGNAGNMSAHWPLISWLPER
FT                   NVNLFMFDYRGFGESEGTPSQEGLLDDTKSAIDYVRHRADVNPERLVLLGQSLGGNNVL
FT                   AAVGHCVGCANMRYADQAGIRAIILDSTFLSYSSIANQMIPGSGYLLDDRYSADRNIAS
FT                   VSPIPVLILHGTADHVIPWQDSEKLYALAREPKQKIFIPDGDHIDAFSGRYANLYRDAM
FT                   IKFIQTALSAK"
FT   gene            complement(357905..358708)
FT                   /locus_tag="SPAB_00386"
FT   CDS_pept        complement(357905..358708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2540 6.9e-140 suhB; inositol
FT                   monophosphatase K01092; COG: COG0483 Archaeal
FT                   fructose-1,6-bisphosphatase and related enzymes of inositol
FT                   monophosphatase family; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00386"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65821"
FT                   /inference="protein motif:BlastProDom:IPR000760"
FT                   /inference="protein motif:FPrintScan:IPR000760"
FT                   /inference="protein motif:HMMPfam:IPR000760"
FT                   /inference="protein motif:ScanRegExp:IPR000760"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217527.1"
FT                   /protein_id="ABX65821.1"
FT                   /translation="MHPMLTIAVRAARKAGNVIAKNYETPDAVEASQKGSNDFVTNVDK
FT                   AAEAVIIDTIRKSYPQHTIITEESGEHVGTDQDVQWVIDPLDGTTNFIKRLPHFAVSIA
FT                   VRIKGRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQ
FT                   YATTYINIIGKLFSECADFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVRE
FT                   AGGIVSDFTGGHNYMMTGNIVAGNPRVVKAMLANMRDELSDALKR"
FT   gene            358703..358813
FT                   /locus_tag="SPAB_00385"
FT   CDS_pept        358703..358813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65820"
FT                   /protein_id="ABX65820.1"
FT                   /translation="MHRSLSLDVKERENGAEYSSEIGICLGFMVRCQNNL"
FT   gene            358827..359558
FT                   /locus_tag="SPAB_00387"
FT   CDS_pept        358827..359558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2545 2.5e-126 putative rRNA methylase
FT                   K02533; COG: COG0565 rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00387"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65822"
FT                   /inference="protein motif:BlastProDom:IPR001537"
FT                   /inference="protein motif:HMMPfam:IPR001537"
FT                   /inference="protein motif:HMMTigr:IPR004384"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457076.1"
FT                   /protein_id="ABX65822.1"
FT                   /translation="MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQ
FT                   AIALAAGASDVIGNAQIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEA
FT                   ANTPVALVFGRERVGLTNDELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLAT
FT                   QENGDAADHEETPYPLVDDLERFYGHLEQTLLSTGFIRENHPGQVMNKLRRLFTRARPE
FT                   SQELNILRGILASIEQQNKGK"
FT   gene            359718..360212
FT                   /locus_tag="SPAB_00388"
FT   CDS_pept        359718..360212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ama:AM656 1.7e-14 aminotransferase, class V
FT                   K04487; COG: COG1959 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65823"
FT                   /db_xref="GOA:A9N1X3"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1X3"
FT                   /inference="protein motif:BlastProDom:IPR000944"
FT                   /inference="protein motif:HMMPfam:IPR000944"
FT                   /inference="protein motif:HMMTigr:IPR000944"
FT                   /inference="protein motif:HMMTigr:IPR010242"
FT                   /inference="protein motif:ScanRegExp:IPR000944"
FT                   /inference="similar to AA sequence:INSD:AAV76341.1"
FT                   /protein_id="ABX65823.1"
FT                   /translation="MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQL
FT                   FSRLRKNGLVSSVRGPGGGYLLGKDAGSIAVGEVISAVDESVDATRCQGKGGCQGGDKC
FT                   LTHALWRDLSDRLTGFLNNITLGELVNNQEVLDVSGRQHTHDAPRASGRAQDAIDVKLR
FT                   A"
FT   gene            complement(360221..360340)
FT                   /locus_tag="SPAB_00389"
FT   CDS_pept        complement(360221..360340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00389"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65824"
FT                   /protein_id="ABX65824.1"
FT                   /translation="MYDRVDGTSASRPDSEFFFTLHPSDDRGIHRMRPPEEMA"
FT   gene            360393..361607
FT                   /locus_tag="SPAB_00390"
FT   CDS_pept        360393..361607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2537 8.4e-215 nifS; putative
FT                   aminotransferase class-V K04487; COG: COG1104 Cysteine
FT                   sulfinate desulfinase/cysteine desulfurase and related
FT                   enzymes; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65825"
FT                   /db_xref="GOA:A9N1X5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1X5"
FT                   /inference="protein motif:HMMPfam:IPR000192"
FT                   /inference="protein motif:HMMTigr:IPR010240"
FT                   /inference="protein motif:ScanRegExp:IPR000192"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149654.1"
FT                   /protein_id="ABX65825.1"
FT                   /translation="MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGW
FT                   QAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEH
FT                   KAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDI
FT                   ATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKP
FT                   RIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGI
FT                   KDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLR
FT                   ALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSI
FT                   EWAHH"
FT   gene            361635..362021
FT                   /locus_tag="SPAB_00391"
FT   CDS_pept        361635..362021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_1354 9.8e-16 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase
FT                   K00566; COG: COG0822 NifU homolog involved in Fe-S cluster
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65826"
FT                   /inference="protein motif:HMMPfam:IPR002871"
FT                   /inference="protein motif:HMMTigr:IPR011339"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149655.1"
FT                   /protein_id="ABX65826.1"
FT                   /translation="MAYSEKVIDHYENPRNVGSFDNNDDNVGSGMVGAPACGDVMKLQI
FT                   KVNDEGIIEDARFKTYGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIADELELPPVKI
FT                   HCSILAEDAIKAAIADYKSKREAK"
FT   gene            362050..362373
FT                   /locus_tag="SPAB_00392"
FT   CDS_pept        362050..362373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00392"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0316 Uncharacterized conserved protein;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65827"
FT                   /db_xref="GOA:A9N1X7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1X7"
FT                   /inference="protein motif:BlastProDom:IPR000361"
FT                   /inference="protein motif:HMMPanther:IPR000361"
FT                   /inference="protein motif:HMMPfam:IPR000361"
FT                   /inference="protein motif:HMMTigr:IPR000361"
FT                   /inference="protein motif:HMMTigr:IPR011302"
FT                   /inference="protein motif:ScanRegExp:IPR000361"
FT                   /inference="similar to AA sequence:SwissProt:Q8XFZ8"
FT                   /protein_id="ABX65827.1"
FT                   /translation="MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFV
FT                   DEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGES
FT                   FHV"
FT   gene            362569..363084
FT                   /locus_tag="SPAB_00393"
FT   CDS_pept        362569..363084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00393"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1076 DnaJ-domain-containing proteins 1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00393"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65828"
FT                   /db_xref="GOA:A9N1X8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1X8"
FT                   /inference="protein motif:HMMPfam:IPR001623"
FT                   /inference="protein motif:HMMPfam:IPR012895"
FT                   /inference="protein motif:HMMSmart:IPR001623"
FT                   /inference="protein motif:HMMTigr:IPR004640"
FT                   /inference="protein motif:superfamily:IPR001623"
FT                   /inference="protein motif:superfamily:IPR009073"
FT                   /inference="similar to AA sequence:INSD:AAL21434.1"
FT                   /protein_id="ABX65828.1"
FT                   /translation="MDYFTLFGLPARYQIDTQALSLRFQDLQRQYHPDKFANGTQAQQL
FT                   AAVQQSATINQAWQTLRHPLTRAEYLLSLHGFDLASEQHTVRDTAFLMEQLTLREELDD
FT                   IEQSKDDVRLESFIKHVQKMFDARLQQMVEQLDNAAWDAAADTVRKLRFLDKLRSSAEQ
FT                   LEEKLLDF"
FT   gene            363097..364947
FT                   /locus_tag="SPAB_00394"
FT   CDS_pept        363097..364947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2848 1.3e-298 hscA; chaperone
FT                   protein HscA K04044; COG: COG0443 Molecular chaperone;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65829"
FT                   /db_xref="GOA:A9N1X9"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1X9"
FT                   /inference="protein motif:BlastProDom:IPR013126"
FT                   /inference="protein motif:HMMPanther:IPR001023"
FT                   /inference="protein motif:HMMPfam:IPR013126"
FT                   /inference="protein motif:HMMTigr:IPR010236"
FT                   /inference="protein motif:ScanRegExp:IPR013126"
FT                   /protein_id="ABX65829.1"
FT                   /translation="MALLQISEPGLSAAPHQRRLAAGIDLGTTNSLVATVRSGQAETLP
FT                   DHEGRHLLPSVVHYQQQGHTVGYAARDNAAQDTTNTISSVKRMMGRSLADIQARYPHLP
FT                   YRFKASVNGLPMIDTAAGLLNPVRVSADILKALAARASESLSGELDGVVITVPAYFDDA
FT                   QRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLDSGKEGVIAVYDLGGGTFDISILRLSR
FT                   GVFEVLATGGDSALGGDDFDHLLADYIREQAGIADRSDNRVQRELLDAAIAAKIALSDA
FT                   DTVRVNVAGWQGEITREQFNDLISALVKRTLLACRRALKDAGVDPQDVLEVVMVGGSTR
FT                   VPLVRERVGEFFGRTPLTAIDPDKVVAIGAAIQADILVGNKPDSEMLLLDVIPLSLGLE
FT                   TMGGLVEKVIPRNTTIPVARAQDFTTFKDGQTAMSIHVMQGERELVQDCRSLARFALRG
FT                   IPPLPAGGAHIRVTFQVDADGLLSVTAMEKSTGVEASIQVKPSYGLTDGEIASMIKDSM
FT                   SFAEQDVKARMLAEQKVEAARVLESLTGALTADAALLSAAERQCIDDAAAHLSAVAQGD
FT                   DVDAIEQAIKNVDKQTQEFAARRMDQSVRRALKGHSVDEV"
FT   gene            364949..365284
FT                   /locus_tag="SPAB_00395"
FT   CDS_pept        364949..365284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2847 2.2e-56 fdx; ferredoxin,
FT                   2Fe-2S K04755; COG: COG0633 Ferredoxin; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65830"
FT                   /inference="protein motif:Gene3D:IPR012675"
FT                   /inference="protein motif:HMMPfam:IPR001041"
FT                   /inference="protein motif:HMMTigr:IPR011536"
FT                   /inference="protein motif:ScanRegExp:IPR001055"
FT                   /inference="protein motif:superfamily:IPR001041"
FT                   /inference="similar to AA sequence:INSD:AAO68042.1"
FT                   /protein_id="ABX65830.1"
FT                   /translation="MPKIVILPHQDLCPDGAVLEAETGETILDVALRNGIEIEHACEKS
FT                   CACTTCHCIVREGFDSLPESSEEEDDMLDKAWGLEPESRLSCQARVTDDDLVIEIPRYT
FT                   INHAREH"
FT   gene            365296..365496
FT                   /locus_tag="SPAB_00396"
FT   CDS_pept        365296..365496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00396"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2975 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00396"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65831"
FT                   /inference="protein motif:HMMPfam:IPR007479"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457068.1"
FT                   /protein_id="ABX65831.1"
FT                   /translation="MGLKWTDSREIGEALYDAYPDVDPKTVRFTDLHQWICELDDFDDD
FT                   PNASNEKILEAILLVWLDEAE"
FT   gene            365483..365617
FT                   /locus_tag="SPAB_00397"
FT   CDS_pept        365483..365617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65832"
FT                   /protein_id="ABX65832.1"
FT                   /translation="MKQSNFCVMILAAGALATFAHPSHIVCYAPGDSLTCRLPATRII"
FT   gene            365674..366957
FT                   /locus_tag="SPAB_00398"
FT   CDS_pept        365674..366957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00398"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2536 2.1e-232 pepB; peptidase B K07751;
FT                   COG: COG0260 Leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65833"
FT                   /db_xref="GOA:A9N1Y3"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR008330"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1Y3"
FT                   /inference="protein motif:HMMPfam:IPR000819"
FT                   /inference="protein motif:HMMPIR:IPR008330"
FT                   /inference="protein motif:ScanRegExp:IPR000819"
FT                   /inference="similar to AA sequence:INSD:AAL21430.1"
FT                   /protein_id="ABX65833.1"
FT                   /translation="MTEAMKITLSTQPADARWGDKATYSINNDGITLHLNGKDDLGLIQ
FT                   RAARKIDGLGIKQVALTGEGWDTERCWAFWAGYKGPKGVRTVMWPDLDDAQRQELDNRL
FT                   TIIDWVRDTINAPAEELGPEQLAQRAVDLLCSVACDSVTYRITKGEDLREQNYMGLHTV
FT                   GRGSERPPVLLALDYNPTGDKDAPVYACLVGKGITFDSGGYSIKQSAFMDSMKSDMGGA
FT                   ATVTGALAFAITRGLNKRVKLFLCCADNLISGNAFKLGDIIRYRNGKNVEVMNTDAEGR
FT                   LVLADGLIDASAQHPQLIIDMATLTGAAKTALGNDYHALFSFDDTLAGRLLTSAAQENE
FT                   PFWRLPLAEFHRNQLPSNFAELNNTGSAAYPAGASTAAGFLSHFVENYREGWLHIDCSA
FT                   TYRKAPVEQWAAGATGLGVRTIANLLTA"
FT   gene            367097..367843
FT                   /locus_tag="SPAB_00399"
FT   CDS_pept        367097..367843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00399"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06208 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00399"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65834"
FT                   /inference="protein motif:HMMPfam:IPR009839"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461470.1"
FT                   /protein_id="ABX65834.1"
FT                   /translation="MLEKAATEPAHRPAFFRTLLESTVWVPGSAAEGEAIVEDSALDLQ
FT                   HWEKEDGTTVIPFFTSLEALQQAVEDEQAFVVMPARTLFEMTLGETLFLNAKLPTGKEF
FT                   MPREISLLLAEEGSPLSTQEVLEGGESLILSEVAEPPSQMIDSLTTLFKTIKPVKRAFL
FT                   CAIKEHADAQPNLLIGIEADGEIEEIIHAAGNVATDTLPGDEPIDICQVRKGEQGISHF
FT                   ITEHIAPFYERRWGGFLRDFKQNRII"
FT   gene            complement(367847..368142)
FT                   /locus_tag="SPAB_00400"
FT   misc_RNA        complement(367847..368142)
FT                   /locus_tag="SPAB_00400"
FT                   /product="RyfA RNA"
FT                   /note="Rfam score 313.21"
FT                   /inference="nucleotide motif:Rfam:RF00126"
FT   gene            368240..368374
FT                   /locus_tag="SPAB_00401"
FT   CDS_pept        368240..368374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65835"
FT                   /protein_id="ABX65835.1"
FT                   /translation="MLWQQSLLERPRTGPAQKNRSIERFFCGLLKQNLCRFALNQPER"
FT   gene            complement(368412..369080)
FT                   /locus_tag="SPAB_00403"
FT   CDS_pept        complement(368412..369080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00403"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG26904 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65837"
FT                   /inference="similar to AA sequence:INSD:CAD02737.1"
FT                   /protein_id="ABX65837.1"
FT                   /translation="MDISLANLIELVKKVNRNKVPNPMPAEEISRLRVRKYRDPQNTET
FT                   TELPESLKALLAYDRDLLSNYNMPVIETLQRSIDNEGVIHSYSPDEEAYYGAGMDSSGI
FT                   DIEDLMPVWSNDPRLPALIRIDHVGDQAIFIYITERDANGEYPIARMERNEFWLAESSL
FT                   VEYLYNIISGAKDIGFTEEDLHLPQWKAQQKMNEQRDAALLDLEDYHEAFWAKLDALVD
FT                   "
FT   gene            369068..369190
FT                   /locus_tag="SPAB_00402"
FT   CDS_pept        369068..369190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65836"
FT                   /protein_id="ABX65836.1"
FT                   /translation="MKYPFSILKKLYLQELFPGENQNSGDDTPYTRRKVFTDKK"
FT   gene            complement(369198..369311)
FT                   /locus_tag="SPAB_00404"
FT   CDS_pept        complement(369198..369311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65838"
FT                   /protein_id="ABX65838.1"
FT                   /translation="MALTLIRPTVQADVKRSTDIVFIPLFSAVLQTGIIFS"
FT   gene            complement(369327..370169)
FT                   /locus_tag="SPAB_00405"
FT   CDS_pept        complement(369327..370169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0323 6.6e-151 sseA; putative thiosulfate
FT                   sulfurtransferase K01010; COG: COG2897 Rhodanese-related
FT                   sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65839"
FT                   /inference="protein motif:HMMPfam:IPR001763"
FT                   /inference="protein motif:HMMSmart:IPR001763"
FT                   /inference="protein motif:ScanRegExp:IPR001307"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457064.1"
FT                   /protein_id="ABX65839.1"
FT                   /translation="MTTAFFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAG
FT                   HIPGALFFDIEALSDRASPLPHMMPRPEAFAVAMRELGVRQDKHLVIYDEGNLFSAPRA
FT                   WWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFMPQAVVRLTDVLLA
FT                   SHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTELVYEGELKTTDELNEV
FT                   FFSHGVSFDRPIIASCGSGVTAAVVVLALATLDVPDVTLYDGAWSEWGARTDLPVEPA"
FT   gene            370378..375312
FT                   /locus_tag="SPAB_00406"
FT   CDS_pept        370378..375312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00406"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2373 Large extracellular alpha-helical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65840"
FT                   /inference="protein motif:HMMPfam:IPR002890"
FT                   /inference="protein motif:HMMPfam:IPR011625"
FT                   /inference="protein motif:superfamily:IPR008930"
FT                   /protein_id="ABX65840.1"
FT                   /translation="MKHLRVVACMIMLALAGCDNNDKTAPTTKSEAPAVAQPSPAQDPA
FT                   QLQKLAQQSQGKALTLLDASEAQLDGAATLVLTFSIPLDPEQDFSRVVHVVDKKSGSVD
FT                   GAWELAPNLKELRLRHLEPERVLVVTVDPAVKALNNATFGKSYEKTITTRDVQPSVGFA
FT                   SRGSLLPGKIAEGLPVMALNVNHVDVNFFRVKPGSLASFVSQWEYRSSLSNWESDHLLK
FT                   MADLVYTGRFDLNPARNTREKLLLPLSDIKPLQQAGVYVAVMNQAGHYNYSNAATLFTL
FT                   SDIGVSAHRYHNRLDIFTQSLENGAAQSGIEIVLLNDKGQTLAQATSDAQGHVQLEADK
FT                   AAALLLARKEEQTTLLDLTLPALDLSEFNVAGAPGYSKQFFMFGPRDLYRPGETVILNG
FT                   LLRDSDGKTLPDQPVKLEVVKPDGQVMRTVVSQPENGLYRLNYPLDINAPTGLWHVRAN
FT                   TGDNLLRSWDFHVEDFMPERMALNLTAQKTPLAPADEVKFSVVGYYLYGAPANGNTLQG
FT                   QLFLRPLRDAVAALPGFQFGNIAEENLSRSLDEVQLTLDKGGRGEVSAASQWQEAHSPL
FT                   QVILQASLLESGGRPVTRRVEQAIWPADTLPGIRPQFAAKAVYDYRTDTTVNQPIVDED
FT                   SNAAFDIVYANAQGEKKAVSGLQVRLIRERRDYYWNWSESEGWQSQFDQKDLVEGEQTL
FT                   DLNADETGKVSFPVEWGAYRLEVKAPNETVSSVRFWAGYSWQDNSDGSGAARPDRVTLK
FT                   LDKASYRPGDTMKLHIAAPVAGKGYAMVESSDGPLWWQAIDVPAQGLELTIPVDKTWNR
FT                   HDLYLSTLVVRPGDKSRSATPKRAVGLLHLPLGDENRRLDLALESPAKMRPNQPLTVRV
FT                   KASVKHGEMPKQINVLVSAVDSGVLNITDYATPDPWQAFFGQKRYGADIYDIYGQVIEG
FT                   QGRLAALRFGGDGDDLKRGGKPPVNHVNIIAQQAQPITLNEQGEGVVTLPIGDFNGELR
FT                   VMAQAWTADDFGRGESKVVVAAPVIAELNMPRFLAGGDVSRLVLDVTNLTDRPQTLNIA
FT                   LAASGLLELLSQQPQPVNLAPGVRTTLFVPVRALEGFGEGEIQATISGLNLPGETLDAQ
FT                   HKQWQIGVRPAWPAQTVNSGIALAPGESWHVPDQHLANVSPATLQGQLLLSGKPPLNLA
FT                   RYIRELKAYPYGCLEQTTSGLFPALYTNAAQLQSLGITGDSDEKRRAAVDIGISRILQM
FT                   QRDNGGFALWDENGAEEPWLTAYAMDFLIRAGEQGYSVPPEAINRGNERLLRYLQDPGT
FT                   MLIRYSDNTQASTFAAQAYAALVLARQQKAPLGALREIWERRSQAASGLPLMQLGIALN
FT                   TMGDARRGEEAITLALNTPRQDERQWIADYGSSLRDNALMLSLLEENNLRPDAQNALLS
FT                   SLSEQAFGQRWLSTQENNALFLAAHSRQASAGAWQAQTSLEAQPLSGDKALTRNLDADQ
FT                   LAALEVTNTGSQPLWLRLDSSGYPSSAPEPASNVLQIERQILGTDGQRKSLSSLRSGEL
FT                   VLVWLTVVADRNVPDALVVDLLPAGLELENQNLADSSASLPESGSEVQNLLNQMQQADI
FT                   QYMEFRDDRFVAAVVVNEGQPVTLVYLARAVTPGTYQLAQPQVESMYAPQWRATGASEG
FT                   LLIVTP"
FT   gene            375313..377628
FT                   /locus_tag="SPAB_00407"
FT   CDS_pept        375313..377628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2531 0. pbpC; transglycosylase of
FT                   penicillin-binding protein 1c K05367; COG: COG4953 Membrane
FT                   carboxypeptidase/penicillin-binding protein PbpC; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65841"
FT                   /inference="protein motif:BlastProDom:IPR001264"
FT                   /inference="protein motif:HMMPfam:IPR001264"
FT                   /inference="protein motif:HMMPfam:IPR001460"
FT                   /inference="protein motif:HMMPfam:IPR009647"
FT                   /inference="protein motif:HMMTigr:IPR011815"
FT                   /inference="protein motif:superfamily:IPR012338"
FT                   /protein_id="ABX65841.1"
FT                   /translation="MNGWRGKRGRWLWLAGAPLFILLALWAADKLWPLPLNEVHPARVV
FT                   VAHDGTPLWRFADAGGIWRYPVTIEEVSPRYLEALINYEDRWFWRHPGVNPFSVARAAW
FT                   QDLTAGRVISGGSTLTMQVARLLDPHSRTFGGKIRQLWRALQLEWHLSKRDILTLYLNR
FT                   APFGGTLQGIGAASWAYFGKPPARLSYADAALLAVLPQAPSRLRPDRWPARAEAARNKV
FT                   LDRMAAQGVWPAETVRESREEPVWLAPRQMPQLAPLFARMMLSKSRSDKIVTTLDAGLQ
FT                   RQLEDLARAWKGRLPARSSLAMIVVDHTDMSVRGWVGSVDLNDDSRFGHVDMVTAIRSP
FT                   GSVLKPFVYGLALDDGLIHPASLLQDVPRRTGDYRPGNFDSGFHGPVSMSDALVRSLNL
FT                   PAVQVLEAYGPKRFAAKLRNVGLPLYLPAGAAPNLSLILGGAGARLDEMAAAYSAFARH
FT                   GKAAKLRLQPDDPLSERPLMSPGAAWIIRRIMADEAQPLPDNALPRIVPLAWKTGTSYG
FT                   YRDAWAIGVNAHYIIGIWTGRPDGTPVVGQFGFASAVPLLNQVNNLLLAHTGRLPEDPR
FT                   PQTVSRGVICWPGGQTLPAGDSNCRRRLATWLLDDSQPPTLLLPEQEDINGIRFPVWLD
FT                   DTGRRVAADCPQARAHTFIVWPRPLEPWLPPAERRSARLPAASDHCPPLQGSDAAPLML
FT                   SGVRDGAVIRQLPGQENVTLPVSTTGGKGRRWWFLNGEPVNGENNRLSLLLNIAGRYQL
FT                   VVMDESGQVAAVNFELIR"
FT   gene            377784..380162
FT                   /locus_tag="SPAB_00408"
FT   CDS_pept        377784..380162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY0357 1.5e-238 dmsA; putative anaerobic
FT                   DMSO reductase chain A precursor K00369; COG: COG0243
FT                   Anaerobic dehydrogenases, typically
FT                   selenocysteine-containing; Psort location: Periplasmic,
FT                   score:9.76"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65842"
FT                   /inference="protein motif:HMMPfam:IPR006656"
FT                   /inference="protein motif:HMMPfam:IPR006657"
FT                   /inference="protein motif:HMMPfam:IPR006963"
FT                   /inference="protein motif:HMMTigr:IPR006311"
FT                   /inference="protein motif:HMMTigr:IPR011888"
FT                   /inference="protein motif:ScanRegExp:IPR006655"
FT                   /inference="protein motif:superfamily:IPR009010"
FT                   /protein_id="ABX65842.1"
FT                   /translation="MKNIKSQGNGEQPAISRRHFIQASSALIALPFVSSPATAQARAVT
FT                   ATENRPAEKVVQTCSTFDCGGKCDIRAHVSDGIVTRISTRPDNALDAQMPVMRACVRGR
FT                   AYRKFVYHPDRLKYPMKRVGKRGEGKFERISWDEATTLIADNLKSITEKYGPASRYVHV
FT                   GTAVSGGTFSGDKMARRLLNLTGGYLESYHSVSMGNTAAATPYTYGIAASGSSLDTLLE
FT                   TKLVILWGHNPTETIFGHTNYFLQKMKQNGTRFIVVDPRYSDTVSSLADQWIPLLPTTD
FT                   NALMDAMMYVIISENLHDRAFIARYAIGFDEDSMPEGVPANESLVAYLTGAKDGVVKSP
FT                   EWAEKITHVPAQTIRQLARDYANTKPAALIQGWGPQRHNCGERTARGSTLLATITGNVG
FT                   IKGGWAAGYGGCANRKFAAGPEMPDNPVKAKISVMNWVQAADDASKVTPDIGLKDADKL
FT                   DSNIRILFSLAGNYLANQNPDLHQAVRVLEDESKIQFIVASDLFMTPSAKYADLLLPET
FT                   SFMERWNIGETWGTASYLILSEKLIEPEFERRSDYDWLREVAAKLGIENEFSQGRDEKA
FT                   WIEHIWEQTRLAMPDENLPDFATLQKTRQHLFKSAPFIAFEDNIRDPDNHPFPTPSGKI
FT                   EIFSKRLYDMQHPEIPALSHYVPAHEGPEDALVKDFPLQLITWKGKNRANSTQYANPWL
FT                   IEVQQQTLWINPQDAQKRGITHGDMVRIHNSRGICEIPAEVTPRIIPGVVAMQAGAWWQ
FT                   PDENGIDKGGCANVLSSARITALAKGNSHQTMLVEVAKA"
FT   gene            380159..380788
FT                   /locus_tag="SPAB_00409"
FT   CDS_pept        380159..380788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY0356 9.7e-63 dmsB; putative anaerobic
FT                   DMSO reductase chain B iron-sulfur subunit K00369; COG:
FT                   COG0437 Fe-S-cluster-containing hydrogenase components 1;
FT                   Psort location: CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65843"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461464.1"
FT                   /protein_id="ABX65843.1"
FT                   /translation="MSQFTHYPPVSDKQLGFFIDSSRCSGCKACQVACKDKNNLEVGRR
FT                   FRRVYEVKGGSFIPTGQGGVSNNVFAYTLSISCNHCADPVCTKNCPTTAMHKRPGDGIV
FT                   RVDTDKCVGCGYCAWSCPYGAPQLNEQTGQMSKCDMCVDLLAKGEQPVCVATCPLEAIK
FT                   FGPIDELRAKYGSVCDVNGLPDSSITKPNLVVKAHQGAEKEGKRHA"
FT   gene            380781..381590
FT                   /locus_tag="SPAB_00410"
FT   CDS_pept        380781..381590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY1249 6.6e-32 dmsC; putative anaerobic
FT                   DMSO reductase chain C anchor subunit K00369; COG: COG3302
FT                   DMSO reductase anchor subunit; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65844"
FT                   /inference="protein motif:HMMPfam:IPR007059"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457060.1"
FT                   /protein_id="ABX65844.1"
FT                   /translation="MHELPLLIFTLCLQGSVGVTLWLALGRQYAVEGRVPARGALPAMV
FT                   GAFVLACVGLLASALHMGYPLNALNALRHVASSWLSREIVFASLYLAALGLGVVLLFFR
FT                   KPGWQPLLALAAAFGLVDVFCMAQVYIHASVATWQHSNTLALFFGTSGIIGSVVIALAY
FT                   LRNAGAAMRCAVVVVALMVLIRLIMQPLWLADINAVDTTVVTFPHHPLQALAQLRDVYL
FT                   LGWCVSAAGMLCFAAGGLRNARGTLVAGSVLLLIGEIMLRYVFFSIG"
FT   gene            381590..382453
FT                   /locus_tag="SPAB_00411"
FT   CDS_pept        381590..382453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mja:MJ0264 3.0e-10 carbon monoxide
FT                   dehydrogenase, iron sulfur subunit CooF-1 K00196; COG:
FT                   COG1145 Ferredoxin; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65845"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="similar to AA sequence:INSD:AAL21421.1"
FT                   /protein_id="ABX65845.1"
FT                   /translation="MVNLTIDPAVDVTQACVRRRFRFSSCRACADVCPAQAFSLAKGQV
FT                   SIDTTRCIACGDCLFVCPVDAITGIKPVKRFVQGDTLVGPFSLQAPTVDELLLWHSQYG
FT                   IRFIDIAVERSAQWLMALAGLNLALRRYGEPGWSFKHVVGAEINASRRTLFHVPRDAIT
FT                   PCAVEPGKRRLRQAFSAFSECVPEISPQECRMCGACWRSCPENVIQFDDNTLTIAAARC
FT                   TGCGGCAAVCPHQALRLRFDVEPALTRHSAAYTLTCESCKRTFHALTPEHTHCVLCQSP
FT                   EFAVRL"
FT   gene            complement(382480..382683)
FT                   /locus_tag="SPAB_00412"
FT   CDS_pept        complement(382480..382683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00412"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65846"
FT                   /protein_id="ABX65846.1"
FT                   /translation="MPTILNPAASKRAKMLPITFFATALGLMMEKVRSIAMFTSEICSV
FT                   VMSGADYKEHPINCLWMQVTFF"
FT   gene            382688..383005
FT                   /locus_tag="SPAB_00413"
FT   CDS_pept        382688..383005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2771 1.8e-52 ndk; nucleoside
FT                   diphosphate kinase (ndk) K00940; COG: COG0105 Nucleoside
FT                   diphosphate kinase; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65847"
FT                   /inference="protein motif:BlastProDom:IPR001564"
FT                   /inference="protein motif:FPrintScan:IPR001564"
FT                   /inference="protein motif:Gene3D:IPR001564"
FT                   /inference="protein motif:HMMPfam:IPR001564"
FT                   /inference="protein motif:HMMPIR:IPR012005"
FT                   /inference="protein motif:HMMSmart:IPR001564"
FT                   /inference="protein motif:ScanRegExp:IPR001564"
FT                   /inference="protein motif:superfamily:IPR001564"
FT                   /inference="similar to AA sequence:INSD:AAV76358.1"
FT                   /protein_id="ABX65847.1"
FT                   /translation="MLHLTVEQARGFYAEHDGKPFFDGLVEFMTSGPIVVSVLESENAV
FT                   QRHRDLLGATNPANALAGTLRADYADSLTENGTHGSDSLESAQREIAFFFGEGEVCPRT
FT                   R"
FT   gene            383212..384378
FT                   /locus_tag="SPAB_00414"
FT   CDS_pept        383212..384378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00414"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0820 Predicted Fe-S-cluster redox enzyme;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65848"
FT                   /db_xref="GOA:A9N1Z8"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N1Z8"
FT                   /inference="protein motif:HMMPfam:IPR007197"
FT                   /inference="protein motif:HMMTigr:IPR004383"
FT                   /inference="protein motif:superfamily:IPR009063"
FT                   /inference="similar to AA sequence:INSD:CAD02728.1"
FT                   /protein_id="ABX65848.1"
FT                   /translation="MSEQIVTPESSTPVVLNNETKINLLDLNRQQMREFFKNLGEKPFR
FT                   ADQVMKWMYHYCCDNFDEMTDINKVLRGKLKEVAEIRAPEVVEEQRSSDGTIKWAIAVG
FT                   DQRVETVYIPEDDRATLCVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIV
FT                   GAAKVTGQRPITNVVMMGMGEPLLNLTNVVPAMEIMLDDFGFGLSKRRVTLSTSGVVPA
FT                   LDKLGDMIDVALAISLHAPNDTIRDEIVPINKKYNIETFLGAVRRYLEKSNANQGRVTI
FT                   EYVMLDHVNDGTEHAHQLAELLKETPCKINLIPWNPFPGAPYGRSSNSRIDRFSKVLMS
FT                   YGFTTIVRKTRGDDIDAACGQLAGDVIDRTKRTLRKRMQGEVIDIKAI"
FT   gene            384375..384533
FT                   /locus_tag="SPAB_00415"
FT   CDS_pept        384375..384533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65849"
FT                   /protein_id="ABX65849.1"
FT                   /translation="MIAVAPRGIHYTVAQCQLNNVWRCTCLVNNNGAFLSTLRQYVMVQ
FT                   QEFSLVS"
FT   gene            384670..385674
FT                   /locus_tag="SPAB_00416"
FT   CDS_pept        384670..385674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00416"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bca:BCE_1379 0.00077 odhB; dihydrolipoamide
FT                   acetyltransferase K00658; COG: COG1426 Uncharacterized
FT                   protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65850"
FT                   /db_xref="GOA:A9N200"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR023690"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N200"
FT                   /inference="protein motif:HMMPfam:IPR001387"
FT                   /inference="protein motif:HMMSmart:IPR001387"
FT                   /inference="protein motif:superfamily:IPR010982"
FT                   /inference="similar to AA sequence:INSD:AAV76360.1"
FT                   /protein_id="ABX65850.1"
FT                   /translation="MNTEATHDQNEAQTTGVRLRNAREQLGLSQQAVAERLCLKVSTVR
FT                   DIEEDKAPSDLASTFLRGYIRSYARLVHVPEEELLPGLEKQAPLRAAKVAPMQSFSLGK
FT                   RRKKRDGWLMSFTWLVLFVVVGLTGAWWWQNHKAQQEEITTMADQSTAELNADKDSGQS
FT                   VPLDTGAATSQDTTPAQTAPAPATPVDSTAATQTPAPTAAATQNTVVAPSQANVDTAAT
FT                   SAAPAATETPSALPTSQAGVAAPAADPNALVMNFTADCWLEVTDATGKKLFSGMQRKDG
FT                   NLNLTGQAPYKLKIGAPAAVQIQYQGKPVDLSRFIRTNQVARLTLNAEPTPAQ"
FT   gene            385701..386819
FT                   /locus_tag="SPAB_00417"
FT   CDS_pept        385701..386819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0344 1.3e-191 gcpE; GcpE protein
FT                   (protein E) K03526; COG: COG0821 Enzyme involved in the
FT                   deoxyxylulose pathway of isoprenoid biosynthesis; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65851"
FT                   /db_xref="GOA:A9N201"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N201"
FT                   /inference="protein motif:HMMPfam:IPR004588"
FT                   /inference="protein motif:HMMTigr:IPR004588"
FT                   /inference="similar to AA sequence:INSD:AAV76361.1"
FT                   /protein_id="ABX65851.1"
FT                   /translation="MHNQAPIQRRKSTRIYVGNVPIGDGAPIAVQSMTNTRTTDVEATV
FT                   NQIKALERVGADIVRVSVPTMDAAEAFKLIKQQVNVPLVADIHFDYRIALKVAEYDVDC
FT                   LRINPGNIGNEERIRMVVDCARDKNIPIRIGVNAGSLEKDLQEKYGEPTPQALLESAMR
FT                   HVDHLDRLNFDQFKVSVKASDVFLAVESYRLLAKQIDQPLHLGITEAGGARSGAVKSAI
FT                   GLGLLLSEGIGDTLRVSLAADPVEEIKVGFDILKSLRIRARGINFIACPTCSRQEFDVI
FT                   GTVNALEQRLEDIITPMDVSIIGCVVNGPGEALVSTLGVTGGNKKSGLYEDGVRKDRLD
FT                   NDDMIAQLESRIRAKASQLDEARRIDVLQVEK"
FT   gene            386819..386910
FT                   /locus_tag="SPAB_00418"
FT   misc_RNA        386819..386910
FT                   /locus_tag="SPAB_00418"
FT                   /product="SroE RNA"
FT                   /note="Rfam score 108.48"
FT                   /inference="nucleotide motif:Rfam:RF00371"
FT   gene            386930..388204
FT                   /locus_tag="SPAB_00419"
FT   CDS_pept        386930..388204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2522 8.9e-227 hisS; histidine tRNA
FT                   synthetase K01892; COG: COG0124 Histidyl-tRNA synthetase;
FT                   Psort location: Cytoplasmic, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65852"
FT                   /db_xref="GOA:A9N202"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N202"
FT                   /inference="protein motif:Gene3D:IPR004154"
FT                   /inference="protein motif:HMMPfam:IPR002314"
FT                   /inference="protein motif:HMMPfam:IPR004154"
FT                   /inference="protein motif:HMMPIR:IPR004516"
FT                   /inference="protein motif:HMMTigr:IPR004516"
FT                   /inference="protein motif:superfamily:IPR004154"
FT                   /inference="similar to AA sequence:SwissProt:O52765"
FT                   /protein_id="ABX65852.1"
FT                   /translation="MAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPI
FT                   VEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQR
FT                   LWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDIDAELIMLTARWWRALGIAEHVSL
FT                   ELNSIGSLEARANYRDALVAFLEQHQETLDEDCKRRMYTNPLRVLDSKNPDVQALLNDA
FT                   PALGDYLDDDSREHFAGLCKLLDAAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQGT
FT                   VCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFIASPVVDIYLVAAGAQT
FT                   QSAAMTLAERLRDEMPGVKLMTNHGGGNFKKQFARADKWGARIALVLGESEVADGTVVV
FT                   KDLRSGEQTAVAQDSVAAHLRTLLG"
FT   gene            388218..388838
FT                   /locus_tag="SPAB_00420"
FT   CDS_pept        388218..388838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00420"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2976 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65853"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="similar to AA sequence:INSD:AAL21415.1"
FT                   /protein_id="ABX65853.1"
FT                   /translation="MEIYENEHDQVDAIKRFFAENGKALAVGVILGVGALVGWRYWSSH
FT                   QTESARAASLAYQNAVTAVSADKPDSIPAAEKFAAENKNTYGALASMELAQQFVDKNEL
FT                   KKAEAQLQQGLAATSDENLKAVINLRLARVQLQLKQADAALKTLDAVKGEGWTAIVADL
FT                   RGEALLSKGDKKGARSAWEAGVNSDASPALSEMMQMKINNLSI"
FT   gene            388849..390027
FT                   /locus_tag="SPAB_00421"
FT   CDS_pept        388849..390027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2833 3.5e-193 yfgL; hypothetical
FT                   protein YfgL K00870; COG: COG1520 FOG: WD40-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65854"
FT                   /inference="protein motif:HMMPfam:IPR002372"
FT                   /inference="protein motif:HMMSmart:IPR002372"
FT                   /inference="protein motif:superfamily:IPR011047"
FT                   /inference="similar to AA sequence:INSD:AAL21414.1"
FT                   /protein_id="ABX65854.1"
FT                   /translation="MQLRKLLLPGLLSVTLLSGCSLFSGEEDVVKMSPLPQVENQFTPT
FT                   TVWSTSVGNGIGEFYSNLHPVMVDNVVYAADRAGVVKALNADDGKEIWSVNLGEKDGWF
FT                   SRSSALLSGGVTVAGGHVYIGSEKAEVYALNTSDGTTAWQTKVAGEALSRPVVSDGIVL
FT                   IHTSNGQLQALNQADGAIKWTVNLDMPSLSLRGESAPATAFGAAIVGGDNGRVSAVLMQ
FT                   QGQMIWQQRISQATGPTEIDRLSDVDTTPVVVNGVVYALAYNGNLTALDLRSGQIMWKR
FT                   ELGSVNDFIVDGDRIYLVDQNDRVLALTTDGGVTLWTQSDLLHRLLTSPVLYNGDLVVG
FT                   DSEGYLHWINVDDGRFVAQQKVDSSGFLTEPTVADGKLLIQAKDGTVYAITR"
FT   gene            390146..391618
FT                   /locus_tag="SPAB_00422"
FT   CDS_pept        390146..391618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cjk:jk0878 9.5e-73 cmk; putative GTPases
FT                   K03977; COG: COG1160 Predicted GTPases; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65855"
FT                   /db_xref="GOA:A9N205"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N205"
FT                   /inference="protein motif:HMMPfam:IPR002917"
FT                   /inference="protein motif:HMMTigr:IPR005225"
FT                   /inference="protein motif:HMMTigr:IPR005289"
FT                   /inference="similar to AA sequence:INSD:AAV76365.1"
FT                   /protein_id="ABX65855.1"
FT                   /translation="MVPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGRA
FT                   EVEGREFICIDTGGIDGTEDGVETRMAEQSLLAIEEADVVLFMVDARAGLMPADEAIAK
FT                   HLRSREKPTFLVANKTDGLDPDQAVVDFYSLGLGEIYPIAASHGRGVLSLLEHVLLPWM
FT                   DDVAPQEEVDEDAEYWAQFEAEQNGEEAPEDDFDPQSLPIKLAIVGRPNVGKSTLTNRI
FT                   LGEERVVVYDMPGTTRDSIYIPMERDEREYVLIDTAGVRKRGKITDAVEKFSVIKTLQA
FT                   IEDANVVLLVIDAREGISDQDLSLLGFILNSGRSLVIVVNKWDGLSQEVKEQVKETLDF
FT                   RLGFIDFARVHFISALHGSGVGNLFESVREAYDSSTRRVSTAMLTRIMTMAVEDHQPPL
FT                   VRGRRVKLKYAHAGGYNPPIVVIHGNQVKDLPDSYKRYLMNYFRKSLEVMGTSIRIQFK
FT                   EGENPYANKRNTLTPTQMRKRKRLMKHIKKSK"
FT   gene            complement(391626..391766)
FT                   /locus_tag="SPAB_00424"
FT   CDS_pept        complement(391626..391766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00424"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65857"
FT                   /protein_id="ABX65857.1"
FT                   /translation="MRSIAIALQRVMANGAGYFHNILLRRMTHFYLKGLIAQRLSGLEY
FT                   Y"
FT   gene            391707..391928
FT                   /locus_tag="SPAB_00423"
FT   CDS_pept        391707..391928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00423"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aha:AHA_1764 5.4e-14 ubiquitin ligase sinat5
FT                   K01932; COG: NOG17950 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65856"
FT                   /inference="protein motif:HMMPfam:IPR010807"
FT                   /inference="similar to AA sequence:INSD:AAP83330.1"
FT                   /protein_id="ABX65856.1"
FT                   /translation="MEITCPVCHHALERNGDTAHCETCAKDFSLQALCPDCRQPLQVLK
FT                   ACGAVDYFCQNGHGLISKKRVNFVISDQ"
FT   gene            391943..392098
FT                   /locus_tag="SPAB_00425"
FT   CDS_pept        391943..392098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65858"
FT                   /protein_id="ABX65858.1"
FT                   /translation="MRRRAEAPTSYPAKGKSVIRYSRNISIVSCPAVILFFLLIQLFIG
FT                   NIIPEN"
FT   gene            complement(392157..392273)
FT                   /locus_tag="SPAB_00426"
FT   CDS_pept        complement(392157..392273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65859"
FT                   /protein_id="ABX65859.1"
FT                   /translation="MISLSLNKHASMKRYYMDDSDGIITNRPKYIPKKKSLI"
FT   gene            392274..394466
FT                   /locus_tag="SPAB_00427"
FT   CDS_pept        392274..394466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00427"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG08628 non supervised orthologous group;
FT                   Psort location: OuterMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65860"
FT                   /inference="protein motif:FPrintScan:IPR003535"
FT                   /inference="protein motif:superfamily:IPR012338"
FT                   /protein_id="ABX65860.1"
FT                   /translation="MVRRIRILVLLLVSGVSVAASGADNSASANDESHSSLPDLASESA
FT                   KKEEQENKGKSFKEQGADYFINSATQGFDNLTPEALESQARSYLQNQITSSAQSYLEGV
FT                   MSPYGKIRTSLSVGEGGDLDGSSLDYFIPWYDNQSTLLFSQISAQRKEDRTIGNFGLGV
FT                   RQNVGNWLLGGNAFYDYDFTRGHRRLGLGTEAWTDYLKFSGNYYHPLSDWKDSEDFDFY
FT                   EERPARGWDIRMESWLPFYPQLGAKLVYEQYYGDEVALFGTDNLQKDPHAVTLGLEYTP
FT                   VPLVTVGTDYKAGTGDSNDFSVNATVNYQIGTPLAAQLDPENVKIQHSLMGSRTDFVDR
FT                   NNFIILEYREKDPLDVTLWLKADATNEHPECVIEDTPEAAVGLEKCKWTVNALINHHYK
FT                   IISASWQAKNNAARTLVMPVVKANALTEGNNNSWNLVLPAWVNADTEEQRTALNTWKVR
FT                   MTLEDEKGNKQNSGVVEITVQQDRKIELIVDNIADTDRSDHSHEASALADGEDGVVMDL
FT                   LITDSFGDSTDRNGNELVDDAMTPVLYDSNDKKVTLAQTPCTTETPCVFIASRDKEAGT
FT                   VTLSSTLPGTFRWKAKADAYGDSNYVDVTFIGDNLSALNAVIYQVKAANPVNLIGKEDE
FT                   HPTVNNAYRFLLWRDKNKDGVFQMSEQLTEEEMALYDYQWEFTGQSTNGHTGALANTMN
FT                   EDLVLPVTNKEAAQKFAANVEDGVQGYGIRVTYSQK"
FT   gene            394524..395483
FT                   /locus_tag="SPAB_00428"
FT   CDS_pept        394524..395483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00428"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG20953 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65861"
FT                   /inference="similar to AA sequence:INSD:AAL21410.1"
FT                   /protein_id="ABX65861.1"
FT                   /translation="MQATVKRRLTKVALALVVAGYCAAPAVAANGNLKSGQWQIVSEQT
FT                   GTIQGTVPWITRAADKTADTDKDHVTVTIDRGDRKIVTEGDKQFHVGDKVTVNWAIGDT
FT                   EGDLDTDNTATKATVKWVSFSDQNGSDPKDLGTGDSYEIQAADADRYIGIKITPTTTTG
FT                   DPAVATELLLKDLSTDAGGGSDDDEIPEGPVVDENVHVVIHEKDSNTNLLKNSGTTLKT
FT                   NTTYQVLLWSDKNGNGTYDAGENVTDQYDYRWKFVGTSKIAGTGTGGIVNESWNDKDLV
FT                   IPVTNAEAKMAFEGADGGVTVGSDGVQGFGLSIDYKRK"
FT   gene            395621..401200
FT                   /locus_tag="SPAB_00429"
FT   CDS_pept        395621..401200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00429"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG25158 non supervised orthologous group;
FT                   Psort location: Extracellular, score:9.65"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00429"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65862"
FT                   /inference="protein motif:HMMPfam:IPR008541"
FT                   /inference="protein motif:HMMPfam:IPR008542"
FT                   /inference="protein motif:superfamily:IPR000627"
FT                   /inference="protein motif:superfamily:IPR008964"
FT                   /protein_id="ABX65862.1"
FT                   /translation="MNKVVHFLLTLLIMFAVSIAPAQALLKGGTWQELNSVTGAVNGTA
FT                   PLADGAIIPLYQGSTLLDPSKTHDIEFSAMPRDFSADATSTSMRAVNSTDTEGDLFSDP
FT                   PTIAWENRQPPAMGLVWADAATPDTPLSPQPVPNLTFCAQNLAGRQLVAWAQVEDETNV
FT                   PALWLFTRTGVPNYATIPLLSPKVALNIKPAVSDPVSVSGDHVDASFEASKVKVGESIT
FT                   LTVTTKACDGEPAINAPFVIRREDAINRQGVVNNANPVRVGNTELTTAQTEYHGVTDGQ
FT                   GNATVVVTQENGPGVKTRLIVSSQNYPTLTDNVDVIFTTITSPDSDKASMYGHMIESTT
FT                   ATLNGITYTFTRPKLAAEASGADKSVVDTNETWALFDWNGADNHCNILPDAEQLVQMRH
FT                   EHSTLATYTGWPATDDAEYWSSTKDQMSGYHAAVHMNSASVVRAADSDTLLVSCVDKAQ
FT                   PAAHPQITLSPQGPYKAQVGESIDLTMTVVDRNTQKPLPYRYMELFIDSAKNRKGEHQD
FT                   AWDNLRVTVDSEGMSASSPEHYTGVTDVNGQAHLTLKHNSGLGVETPIRIVMPDDEGGN
FT                   VELPFSVIFTVVTSPDVDGANMWGHMRGVVDAGNLYKRPLLAVEASHKDGQFSENNEEW
FT                   ATFNSVASATAQCGVGQVPDQSSLAHLYSEHAGGQMESEHGWPTEDYFIAADSDASGTV
FT                   HVNLENGDSGKFTDTPNYLTCSANEMVAVLDVYFNDDPVIKNADAKVGEQVKMNIHSRN
FT                   ALNGMAIGNTDFTITMANGRRRDGLTTGFTDTSNGEMQFDDVGYVAGQVYHGITDANGD
FT                   ATIILTQKKGVGLLTPLNIAPVDSLISTPVSRSVKFTVATSPDTPAAKMWGHMADTITV
FT                   GDWTFERPKLAGEVSNPLRTQDESNETWARVAHSDAVGNPDAGGCAANRLPRIDQLEAL
FT                   YNANSGGKIHSIQGWPTYLNYWSSTYQSATTWKLIALTNGSEFANSNVSIYASCLASDN
FT                   PVAASITIEPVNPSQWYDGSDVHAVKVKKGETMQLKVTVKDASGNPIPEAPFVLTRGDG
FT                   YDRRGEKYTAQDGDDLQGIVTPVVIDGESLAWTTTKMGSQTGTDGTRIISVTRPDTHGT
FT                   RTAINATLYENAAVSASIDTIFTVVTSPDVSVARMWGHMAPSLTAADGAVYQRPLLYAE
FT                   LSSTDNTASKQETNETWAVFHGPASEGANPARCAAGYYPAVEALDSLYSKYPSRTINTA
FT                   QGWPVYYSYWSGSNSTSFSSGAKLDFYYAVDLADGSRRSENSATSTAWQYQICATTPLP
FT                   QATQITLTSPQAMDDAIQAVKAKNSESIPLLITTTDAMGNPVPYATFSLKRDAGKARNP
FT                   DYNKFVATNGTNMTVTPLTGAQQQFYYATSVLTGATGADGTLALTLAEPGGIGLKNQLT
FT                   ANLNDTPTATSSLPVVFTVLTSPDSDKANMYGHMPETFTASNGAEFKRPLVAGEPSSEA
FT                   HTDTYFETNENWIMVNSFNTGNYGGCPMNQMAAIDDFTALYNDHPSGKVATDIGLPVGK
FT                   RWWAGDSLLKGSTLYWQYKDLKTGKNYSMSENPGNYYLQLCLTTSRSGLNIALSSDAWN
FT                   ADKSAAVAKKGETIPMTVTVTNDAGQPQAGVAVLLTRDYAYSRCAVDKQYIEPGVIGEP
FT                   VPFTTSPANMMLTPVAPAGTAVAFNNQNGLSTKWSGFTGDDGKLRFTLTQDKSLGLKTS
FT                   VTAALANQFDEAASVDAIFTVQTSPDTPYASYWGHMPDTVQVNGVTLRRPYLKAELSAA
FT                   PRDTWPFNNEFWGTNYYYQSEHVETSLTHLCGSQENIASLDDLKALQSVIGTLQWPTTS
FT                   SWDYVSQDEGQSNKYYCSFNETTGQTTCTREKATTSGLGSCRVP"
FT   gene            401366..408673
FT                   /locus_tag="SPAB_00430"
FT   CDS_pept        401366..408673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_3439 1.4e-05 CHU large protein;
FT                   possible glycerol kinase-related K01238; COG: NOG25158 non
FT                   supervised orthologous group; Psort location:
FT                   Extracellular, score:9.65"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65863"
FT                   /inference="protein motif:HMMPfam:IPR008541"
FT                   /inference="protein motif:HMMPfam:IPR008542"
FT                   /inference="protein motif:superfamily:IPR008964"
FT                   /protein_id="ABX65863.1"
FT                   /translation="MKSKKCVGFLPWLLLCALSLTPFFAQAVRSSGAWQELTEQTAAIN
FT                   GTPPQADSVTIPVYQGSVQLRSDAANPVDYSAKPSQFSTSDAGSALTLTNPHDTEGDIF
FT                   AVPPLVWQAERAPTVTLVWADAATPDTPLDPQPVSNISFCAQNLAGRHLVVWSQLDTST
FT                   AIPPLWLLTRTGVPYNTAVEVLDQKFAVDIAPAVGDPVTLAADHLDESLNAAKVKAGES
FT                   IMLTVTTKDCGGEPEGNVDFVITRGDAQNRQGVVNNAAPVRVGNTELTTTATEYHGTTN
FT                   AEGVATVVVTQANGPGVKTPLIAHPSSAPALKASVDVIFTTLTSPDSSSANMYGHMAET
FT                   STATVDGASYTFYRPKLAAETDGEDRTASINNETWAQFNWGHADAHCDILPDARQLEGL
FT                   KIARGDLATTLGWPVGLTSGDEEYWSSSQGSIATDHISIDMRSRSLTQMPDATQSLVSC
FT                   VDKAPPAVTPKLVISADNFDSTVNAAKVKVGEEINMKITVTDSATNKPLPYRYFNVYLG
FT                   DEQNRQNQKNADIDAAHQWTDEPVLITNLAGSDGHYHGVTDANGQFSLVLTQDKGAGVL
FT                   TPVRVVLFDGTEATQNVIFTVVTSPDVAQARMWGHMQGVVEAGNIYKRPLLAEEAAQDT
FT                   GSEFENNEYWATFNSVTAATNQCGTGQVPGQLLLDTLYQAHSGNAMETTYGWPTQKHSY
FT                   IAADTDGSTTAHVNLATGADSMFSGAEPNYLSCSGNELVTSLDVYFNGDESLRNAVAKV
FT                   GEQITMNVHSVNALNGLSVPNASFTVTMSHGKNRDNATTGFTDPSDGTLVMGGTPFGSS
FT                   QASMTYQGMTDAEGNATLVIEQPQGVGLLTPLTVLPVNSLITTPVNRSVKFTVPTSPDT
FT                   PEAQMWGHMADTLTVGGMEFQRPKLAAEATAATRTQEQDNETWARVSHADALNNPNAGG
FT                   CEAGHLPRADQLAALYASSDGNKIHTVSGWPTTYDYWSSTFASAATWQAVSLAAGGYTA
FT                   SGDASDYVSCLVSKNPTAASITIEPVDAALWYNANSEHAVKVKKGDTLQLKVTVKDASG
FT                   NPLPQAPFVLSRGDGYTRQGEKHIAGSGDGIVSAVVIDGDSLNDSATQIGGMTGENGSK
FT                   IINVTRPDAHGTKVAITAALYNNASATASIDTIFTVVTSPDSDKAKMWGHMSETTTAAN
FT                   GEVFKRPLLSAEIASGVTHGDNTENNEAWGIVDFEMANDACGAGYVPTLADMQSLYDAR
FT                   PGGAMNTQQGWPLDGKNYQDSTADLSRSTQNRYVKSINLRDGGVGSLLWNEQLYFVCLQ
FT                   NAHPAATQITLTSPVYNDSDGFAKAKVGETIPVIITTRDAQGNPAADTPVIFTRGDSVG
FT                   RANQEVNSSAAADIQINHSDGRSSGANYYTATGADGTLTLNISQDSGAGFKTPLTAAIE
FT                   HNGVTSAPLPVIFTVVTSPDTPKANYWGHMAETLTDSSGVAYRRPLLASEFSATPGKTL
FT                   TIANGYYDKGETWGMITVDKAWNGTGGGCGRDTLPTVANLQTLYGTYPDNAMRSRNGWP
FT                   MTSSGNNNVSRYWWAGDYVISSDGTKSLYAAVNLFNDGNDVKTTTSTSMYYMQTCLASP
FT                   CSAAASLTLTLAGQDETTGSAKAKKGEQMAATIDVKDAAGQPMKNVMVKISRGSSYNRA
FT                   NSATSSSSVTDDITLRNVMPSGLATYLLDTSAKYLYAQTDAQGQVTFTLAQDSTAGLKT
FT                   TISAATMDGSNLTDSKDAIFTVVTSPDSDKAKYWGHMPETFTNSKGVEFKRPLLRAELS
FT                   STADTSGYTENNETWYTWSRYPNMYQDTASPCDRLGLPTVNDLQTLYTDYPNGALTTTL
FT                   GLPVASGKYWGAGNSVPDATHSDSQFQYVRLSDNNTLTTKANTATAQLCLAKRRDLSIE
FT                   LTSSDMDADKGAPVAKKGESLPLTVTVRDGSGTPQPNTAIRLGRTLSIDRAGVVDGSSG
FT                   GGMVLTSVAPSTGSMTFNCTVSSCTSYWYGITDEDGKAQLEVTQDDSRGLRTPLQAMLV
FT                   DDPLTVSDMDVIFTVITSPDSDKAKYWGHMPETVTNSAGVKFRRPLLAAEMTSNSGTYL
FT                   VNNETWPLVTAANTEKAGATGCDAEYQPLSGDLQTLYGDNPNGAIGTNYGWPVAGNKSW
FT                   WVADRAPNTGYYQFINLNSGGKGTASSSTATGAQVCLVEPRTSTPASITLTSTAMDSAK
FT                   NAAVVAKGSAMPLTVTVKDSSGNPVANVGFTLSRGDSKNRAGMVITDGDVAADAGADDL
FT                   MLKELTPASASQSMTTTGIVFTGTTGSDGTATFTLNQDKSLGLKTPLTVKVTDNTTLHA
FT                   SLDVIFMVLTSPDTDKALFWGNMSDTTSVNGKTLHRPWLQAEMLSGVTPVFTNGVHANN
FT                   EYWAMAHTVDNTKWDIAKQCGSLSKAPDNNDLLTLYHSISSLGWPTLGYPYLSKSTSSG
FT                   GMYCGVDENTKSQNCAIKPAGTAGYATCVE"
FT   gene            408661..408774
FT                   /locus_tag="SPAB_00431"
FT   CDS_pept        408661..408774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65864"
FT                   /inference="protein motif:HMMPfam:IPR005063"
FT                   /protein_id="ABX65864.1"
FT                   /translation="MRGVTYYASGTKIICFSHSIELHEKVKVAFIEKYMFC"
FT   gene            409367..415486
FT                   /locus_tag="SPAB_00432"
FT   CDS_pept        409367..415486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bme:BMEII0148 1.6e-77 extracellular serine
FT                   protease; COG: COG3210 Large exoproteins involved in heme
FT                   utilization or adhesion; Psort location: OuterMembrane,
FT                   score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65865"
FT                   /inference="protein motif:HMMPfam:IPR004899"
FT                   /inference="protein motif:HMMPfam:IPR005546"
FT                   /inference="protein motif:HMMTigr:IPR006315"
FT                   /inference="protein motif:HMMTigr:IPR013425"
FT                   /inference="protein motif:ScanRegExp:IPR002173"
FT                   /inference="protein motif:ScanRegExp:IPR005836"
FT                   /inference="protein motif:superfamily:IPR011050"
FT                   /protein_id="ABX65865.1"
FT                   /translation="MRNMYVVASELARGHSKVKAQVCASEIHSPNQKSEYGQIIKATRA
FT                   ALACAVAAALGFFSPLAMADNQVSYADAQTHVLDASTPPMSYSGTDEGAALYVSGVATV
FT                   GWQPTTVTGTGLVIETSGGGADDPDGGKYVSNAISLDHYAILELTDAKITTTGIYTQGI
FT                   SAADGSKLTLTDSTLTIDGNFGVMTLYTGSEATLDGTIVEAANSSSAQVQQGSTLNVLD
FT                   GSTITLAQGQINVVAGNTATDEGSTLNLSDSSVSSAGTMSTIQGTNKAALNLTNATITH
FT                   TNASGAAVQANNATTLDISGGNITSAGMGVYILASDARIDGATINADGDGIFITSKKRS
FT                   TSYEDLNALTVSDANVTSKTVALNIDGSTTINDPIELTNSTFTAPTAIKLGSKATIQAE
FT                   KTMLTGNIVQTDASSSSLSLSQGSTLTGSVDAMFTTLSLDDTSQWNMTDPSTVGNLTND
FT                   GDITLGNASGSTGTLLTVDNTLTLQDGSQINATLDTANSSPIIKAANVTLDGTLDLSST
FT                   ATFVAPETDEHFGSITLIDSQTAITTDFDSVTLDADTSAMPDYLTINAGVDANDNTNYE
FT                   LSTGLSWYAGAKSARAAHGTFTVDAGSTFTVTSELDETTATSNWNGSKLTKQGDGTLIL
FT                   SNTGNDYGDTEIDGGILAAKDAAALGTGDVTIAESATLALSQGTLDNNVTGEGQIVKSG
FT                   SDELIVTGDNNYSGGTTISGGTLTADHADSLGSGDIDNSGVLKVGEGELENILSGSGSL
FT                   VKTGTGELTLSGDNSYSGGTTITGGTLTADHADSLGSGDIDNSGVLKVGEGDLENTLSG
FT                   SGSLVKTGTGELTLSGGNDYSGGTTIIGGTLTADHADSLGSGDIDNSGVLQVGEGELKN
FT                   TLFGSGSLVKTGTGELTLNGDNDYSGGTTIDDGVLIADNADSLGTGAVANNGVLQVGEG
FT                   ELKNTLSGTGSLVKIGTGELTLNGDNDYSGGTTITGGTLIAASVNALGSGDIDNSGVLQ
FT                   VGEGELKNTLFGSGSLVKTGTGELTLSGDNTYSGGTTISGGTLIAANVNALGSGDIDNS
FT                   GTLILDANGAFELANVTTHSGATTALAAGSTLDAGQFTQEDGSTLSIDLGAATDDAVIT
FT                   ADSVALGGTLNVTGIGSVTDSWTPEAYTYTLIGSDSAITTDFDDLTVAGMNREDVDFLT
FT                   IDGKVDEADNTHYDLTASLSWYADRDNATTDAHGTFTLSDPDGGFNVAATLTDVDDTLD
FT                   PGSRWDGKSLTKEGAGTLILSGDNDYSGGTTINEGTLVAASTTALGTGLVDNNATLVLD
FT                   VDGEVSAVGGITTHSGATTQLALGTSLDLGDSALIQQDGSTLNVELNSDSVQPLITGGS
FT                   ATLGGDLVVSDASLQARASDAEFQSFKLMDMDSDISGDFTSLTMNLTDQPDYLTVTGTI
FT                   NPADASEYLLTEGLSWNATATSATPAHGTFTLSAGDSFEVTSVLGDKTGNGDWDGKSLT
FT                   KLGAGKLTLSGANTYSGDTNVQEGTLWLTGAGTIGEVGSQQAVNVASDATFGGSNGTTV
FT                   NGKVTNEGTLVFGDSEETGAIFTLNGDLINMGTITSGSSSSTPGNTLYVDGDYTGNGGS
FT                   LYLNTVLGDDDSATDKLVITGDASGTTDLYINGIGDGAQTTNGIEVVDVGGVSTSDAFV
FT                   LKNEVNASLYTYRLYWNESDNDWYLASKAQSDDDDSGGDDTPSDGGDDGGNVTPPDDGG
FT                   DGGNVTPPDDGGDGGDVTPPDDGGDVAPQYRADIGAYMGNQWMARNLQMQTLYDREGSQ
FT                   YRNADGSVWARFKAGKAESEAVSGNIDMDSNYSQFQLGGDILAWGNGQQSVTVGVMASY
FT                   INADTDSTGNRGADGSQFTSSGNVDGYNLGVYATWFADAQTHSGAYVDSWYQYGFYNNS
FT                   VESGDAGSESYDSTANAVSLETGYRYDIALSNGNTVSLTPQAQVVWQNYSADSVKDNYG
FT                   TRIDGQDGDSWTTRLGLRVDGKLYKGSRTVIQPFAEANWLHTSDDVSVSFDDATVKQDL
FT                   PANRAELKVGLQADIDKQWSVRAQVAGQTGSNDFGDLNGSLNLRYNW"
FT   gene            complement(415648..416997)
FT                   /locus_tag="SPAB_00433"
FT   CDS_pept        complement(415648..416997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0355 1.9e-233 xseA;
FT                   exodeoxyribonuclease large subunit K03601; COG: COG1570
FT                   Exonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65866"
FT                   /db_xref="GOA:A9N216"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N216"
FT                   /inference="protein motif:HMMPfam:IPR003753"
FT                   /inference="protein motif:HMMPfam:IPR004365"
FT                   /inference="protein motif:HMMTigr:IPR003753"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /inference="similar to AA sequence:SwissProt:Q5PI54"
FT                   /protein_id="ABX65866.1"
FT                   /translation="MLSSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFTQPASG
FT                   HWYFTLKDDTAQVRCAMFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQP
FT                   AGEGLLQQKYEQLKAKLQAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRR
FT                   DPSLPVIIYPTAVQGDDAPGQIVRAIELANARGECDVLIIGRGGGSLEDLWSFNDERVA
FT                   RAIFANRIPVVSAVGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRL
FT                   GMAMDYYLANRSRRFTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQR
FT                   QQRVSQRLSQQNPQPRIHRAQSRIQQLEYRLTENIRSRLSEQRERFGNAVTHLEAVSPL
FT                   ATLARGYTVSTTTNGKVLKKIKQVKAGDIMTTRLEDGWLESEVKSVTPGT"
FT   gene            417074..418624
FT                   /locus_tag="SPAB_00434"
FT   CDS_pept        417074..418624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2509 4.2e-268 imdH;
FT                   inosine-5'-monophosphate dehydrogenase K00088; COG: COG0517
FT                   FOG: CBS domain; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65867"
FT                   /inference="protein motif:HMMPanther:IPR001093"
FT                   /inference="protein motif:HMMPfam:IPR000644"
FT                   /inference="protein motif:HMMPfam:IPR001093"
FT                   /inference="protein motif:HMMSmart:IPR000644"
FT                   /inference="protein motif:HMMTigr:IPR005990"
FT                   /inference="protein motif:ScanRegExp:IPR001093"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217496.1"
FT                   /protein_id="ABX65867.1"
FT                   /translation="MQKNVDATDYVLYNAAAIFINLPGEILPMLRIAKEALTFDDVLLV
FT                   PAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMDTVTEARLAIALAQEGGIGFIHKNMSI
FT                   ERQAEEVRRVKKHESGVVTDPQTVLPTTTLHEVKALTERNGFAGYPVVTEDNELVGIIT
FT                   GRDVRFVTDLNQPVSVYMTPKERLVTVREGEAREVVLAKMHEKRVEKALVVDDNFHLLG
FT                   MITVKDFQKAERKPNSCKDEQGRLRVGAAVGAGAGNEERVDALVAAGVDVLLIDSSHGH
FT                   SEGVLQRIRETRAKYPDLQIIGGNVATGAGARALAEAGCSAVKVGIGPGSICTTRIVTG
FT                   VGVPQITAVSDAVEALEGTGIPVIADGGIRFSGDIAKAIAAGASAVMVGSMLAGTEESP
FT                   GEIELYQGRSYKSYRGMGSLGAMSKGSSDRYFQSDNAADKLVPEGIEGRVAYKGRLKEI
FT                   IHQQMGGLRSCMGLTGCATIDELRTKAEFVRISGAGIQESHVHDVTITKESPNYRLGS"
FT   gene            418694..420271
FT                   /locus_tag="SPAB_00435"
FT   CDS_pept        418694..420271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2508 1.7e-285 guaA; GMP synthetase
FT                   K01951; COG: COG0518 GMP synthase - Glutamine
FT                   amidotransferase domain; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65868"
FT                   /db_xref="GOA:A9N218"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N218"
FT                   /inference="protein motif:HMMPfam:IPR000991"
FT                   /inference="protein motif:HMMPfam:IPR001674"
FT                   /inference="protein motif:HMMPfam:IPR004506"
FT                   /inference="protein motif:HMMTigr:IPR001674"
FT                   /inference="protein motif:HMMTigr:IPR004739"
FT                   /inference="protein motif:ScanRegExp:IPR012998"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149683.1"
FT                   /protein_id="ABX65868.1"
FT                   /translation="MTENIHKHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQ
FT                   IRDFNPSGIILSGGPESTTEENSPRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEGSN
FT                   EREFGYAQVEVLTDSALVRGIEDSLTADGKPLLDVWMSHGDKVTAIPSDFVTVASTESC
FT                   PFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEALWTPAKIIDDAVARIR
FT                   EQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVMDMFGDHF
FT                   GLNIVHVPAEERFLSALAGENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPD
FT                   VIESAASATGKAHVIKSHHNVGGLPKEMKMGLVEPLKELFKDEVRKIGLELGLPYDMLY
FT                   RHPFPGPGLGVRVLGEVKKEYCDLLRRADAIFIEELRKADLYDKVSQAFTVFLPVRSVG
FT                   VMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGK
FT                   PPATIEWE"
FT   gene            420494..420742
FT                   /locus_tag="SPAB_00436"
FT   CDS_pept        420494..420742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00436"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2801 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65869"
FT                   /inference="protein motif:HMMPfam:IPR001584"
FT                   /inference="protein motif:superfamily:IPR012337"
FT                   /inference="similar to AA sequence:INSD:AAL21403.1"
FT                   /protein_id="ABX65869.1"
FT                   /translation="MTKDIVLNALLMAVWRRHPQKQVLVQSDQGSQYTRYEWLESHGLE
FT                   GSMSRRGNCHNAVAESFFQLLKRERIKKKIYLRLRSV"
FT   gene            complement(420795..421115)
FT                   /locus_tag="SPAB_00437"
FT   CDS_pept        complement(420795..421115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00437"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65870"
FT                   /inference="protein motif:HMMPfam:IPR010862"
FT                   /inference="protein motif:ScanRegExp:IPR013838"
FT                   /inference="similar to AA sequence:INSD:AAL21402.1"
FT                   /protein_id="ABX65870.1"
FT                   /translation="MRDIEKEIIDFIDQEYNTKKYFLCGPKRIITLDTSIRDDLKLVFE
FT                   DSEELLQKYFKRWNVDSEGFDILNYLNPEYFGSKEPDPRKPLTVGMLLESAKLGVGYIV
FT                   EE"
FT   gene            complement(421671..421862)
FT                   /locus_tag="SPAB_00439"
FT   CDS_pept        complement(421671..421862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00439"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13900 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65872"
FT                   /inference="similar to AA sequence:INSD:AAL21400.1"
FT                   /protein_id="ABX65872.1"
FT                   /translation="MSQANSMRKRHRFNTRMTRIVLLISFLFFFGRFVYSSIGAWQHHQ
FT                   DKKEAQQSSLSVTTPGQR"
FT   gene            421731..421970
FT                   /locus_tag="SPAB_00438"
FT   CDS_pept        421731..421970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00438"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG31354 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00438"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65871"
FT                   /inference="similar to AA sequence:INSD:AAL21399.1"
FT                   /protein_id="ABX65871.1"
FT                   /translation="MVLPGADRRVDETSKEEEKTDKQYDTGHASVKSMSFSHTVGLTHK
FT                   GFLNVGPAIWAGSGWVLQGYYQGEERNKPAFTLH"
FT   gene            422041..422178
FT                   /locus_tag="SPAB_00440"
FT   CDS_pept        422041..422178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00440"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG34782 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65873"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217488.1"
FT                   /protein_id="ABX65873.1"
FT                   /translation="MEDNFSIYINNKLMITKNKKANKGCRRKVIIDLNQMLLLFNNYNR
FT                   "
FT   gene            422275..424488
FT                   /locus_tag="SPAB_00441"
FT   CDS_pept        422275..424488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3829 5.3e-23 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s) K01745;
FT                   COG: COG2199 FOG: GGDEF domain; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65874"
FT                   /inference="protein motif:HMMPfam:IPR001633"
FT                   /inference="protein motif:HMMPfam:IPR007895"
FT                   /inference="protein motif:HMMSmart:IPR000160"
FT                   /inference="protein motif:HMMSmart:IPR001633"
FT                   /protein_id="ABX65874.1"
FT                   /translation="MKLNKTYINIRDKWWGLPLILPSILLPVLSSANTYALTSTGNVVL
FT                   FYLPLAFMLSLMLFFGWAALPGIVLAIFWRRYPQTGLYETLSVTMHFIITIVLSWGGYR
FT                   VFSPRRNNVSHGDAHLLFQRIFWQVFCSATLFLVIYQFAAFVGMYESKASLMGVMPFNI
FT                   NTLINYQALLVGNLVGVPLCYFIIRTLRNPLHLRGYYQQLKLQIDSKATKKEIVIWLAV
FT                   LTTLMFILCMPLTDNSSIFSTNYTLSLLLPVMLWGAMRYGYKFISIIWAVVLITSIHYY
FT                   QRYMPWYSGYDTQLAITSSSYLVFSFIVNYMSVLATRQRVVSGRARRLAYLDPVVHLPN
FT                   LRALNRALQNAPWSTICFLHVPGLELLGKNYGVMLRIQYKQKLSHWITPMLASNECVYQ
FT                   MSGHDLVLRLNTEAHQQRIEALDKHIKQFRFIWDGLPLQPPVGVSYCCVRSPVSHLYLL
FT                   LGELSTSSDLSLTTNAPEDLQRRGAMHLQRDLKGRIAMMNRLQQALEHDHFFLMAQPIF
FT                   GVRGDVYHEILLRLRDDNGDVINPDNFLPVAHEFGLSSAIDLWVIENTLRFMAASREYM
FT                   PAHRFAINLSPTSVCRARFPAEVKQLLTQYQVEPWQLVFEVTESNSLTNAEQAQLTLGQ
FT                   LQQFGCQIAIDDFGTGYASYARLKNVDADILKIDGSFIRNIVSNSLDYQIVASICHLAR
FT                   MKNMQVVAEYVESEEIRSVVLSLGIDYLQGYLIGEPQLLSEIQ"
FT   gene            complement(424524..426065)
FT                   /locus_tag="SPAB_00442"
FT   CDS_pept        complement(424524..426065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2743 2.0e-275 ppx; exopolyphosphatase
FT                   K01514; COG: COG0248 Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65875"
FT                   /inference="protein motif:HMMPfam:IPR003695"
FT                   /inference="similar to AA sequence:SwissProt:P0A269"
FT                   /protein_id="ABX65875.1"
FT                   /translation="MPIYDKSPRPQEFAAVDLGSNSFHMVIARVVDGAMQIIGRLKQRV
FT                   HLADGLGADNKLSEEAMERGLSCLSLFAERLQGFSPSSVCIVGTHTLRQAQNAADFLKR
FT                   AEKVIPYPIEIISGNEEARLIFMGVEHTQPEKGRKLVIDIGGGSTELVIGENFEPRLVE
FT                   SRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQYRIQGWNVAMGASGTIKA
FT                   AHEVLLALGEKDGFITPERLDKLKSEVLKHRSFNALSLPGLSEERKAVFVPGLAILCGV
FT                   FDALAIRELRLSDGALREGVLYEMEGRFRHQDVRSRTAKSLANQYNIDREQARRVLETT
FT                   MQMYEQWQAQQPKLAHPQLEALLRWAAMLHEVGLNINHSGLHRHSAYILQHSDLPGFNQ
FT                   EQQMMMATLVRYHRKAIKLDDMPRFTLFKKKQYLPLIQLLRLGVLLNNQRQATTTPPTL
FT                   RLTTDDSHWTLCFPHDWFSQNALVLLDLEKEQQYWEAVTGWRLNIEEESSPEIAA"
FT   gene            complement(426070..428136)
FT                   /locus_tag="SPAB_00443"
FT   CDS_pept        complement(426070..428136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2498 0. ppk; polyphosphate kinase,
FT                   component of RNA degradosome K00937; COG: COG0855
FT                   Polyphosphate kinase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65876"
FT                   /inference="protein motif:HMMPfam:IPR003414"
FT                   /protein_id="ABX65876.1"
FT                   /translation="MGQEKLYIEKELSWLAFNERVLQEAADKSNPLIERMRFLGIYSNN
FT                   LDEFYKVRFAELKRRIIISEEQGSNSHSRHLLGKIQSRVLKADQEFDGLYNELLLEMAR
FT                   NQIFLINERQLSVNQQSWLRHYFKHYLRQHITPILINRETDLVQFLKDDYTYLAVEIIR
FT                   GDTINYALLEIPSDKVPRFVNLPPETPRRRKPMILLDNILRYCLDDIFKGFFDYDALNA
FT                   YSMKMTRDAEYDLVHEMESSLMELMSSSLKQRLTAEPVRFVYQRDMPAALVDVLREKLT
FT                   ISRYDSIVPGGRYHNFKDFINFPNVGKANLVNKPLPRLRHLWFDKEKFRNGFDAIRERD
FT                   VLLYYPYHTFEHVLELLRQASFDPSVLAIKINIYRVAKDSRIIDSMIHAAHNGKKVTVV
FT                   VELQARFDEEANIHWAKRLTEAGVHVIFSAPGLKIHAKLFLISRKEGDDVVRYAHIGTG
FT                   NFNEKTARLYTDYSLLTADARITNEVRRVFNFIENPYRPVTFDYLMVSPQNSRRLLYEM
FT                   IDREIANAQQGLPSGITLKLNNLVDKGLVDRLYAASGSGVQVNLLVRGMCSLIPQLEGI
FT                   SDNIRAISIVDRYLEHDRVYIFENGGDKQVWLSSADWMTRNIDYRIEVATPILDPRLKQ
FT                   RVLDIIDILFSDTVKARFIDKELSNRYVPRGNRRKVQAQLAIYDYIKSLEQPD"
FT   gene            complement(428325..428963)
FT                   /locus_tag="SPAB_00444"
FT   CDS_pept        complement(428325..428963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2497 3.6e-111 purN; polyphosphate
FT                   kinase, component of RNA degradosome K00601; COG: COG0299
FT                   Folate-dependent phosphoribosylglycinamide
FT                   formyltransferase PurN; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65877"
FT                   /inference="protein motif:Gene3D:IPR002376"
FT                   /inference="protein motif:HMMPfam:IPR002376"
FT                   /inference="protein motif:HMMPIR:IPR004607"
FT                   /inference="protein motif:HMMTigr:IPR004607"
FT                   /inference="protein motif:ScanRegExp:IPR001555"
FT                   /inference="protein motif:superfamily:IPR002376"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217484.1"
FT                   /protein_id="ABX65877.1"
FT                   /translation="MNIVVLISGNGSNLQAIIDACEAKKIKGTLRAVFSNKADAFGLER
FT                   AREAGIPAQALTADRFDSRDAFDRELIRKIDAYAPDVVVLAGFMRILSPMFVAHYYGRL
FT                   LNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFADDSED
FT                   DITARVQTQEHAIYPLVISWFAQGRLKMRDNAAWLDGRRLPPQGYASDE"
FT   gene            complement(428963..430015)
FT                   /locus_tag="SPAB_00445"
FT   CDS_pept        complement(428963..430015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2499.S 1.0e-186 purM;
FT                   phosphoribosylaminoimidazole synthetase K01933; COG:
FT                   COG0150 Phosphoribosylaminoimidazole (AIR) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65878"
FT                   /inference="protein motif:HMMPfam:IPR000728"
FT                   /inference="protein motif:HMMPfam:IPR010918"
FT                   /inference="protein motif:HMMTigr:IPR004733"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461434.2"
FT                   /protein_id="ABX65878.1"
FT                   /translation="MGNQAVTDKTSLSYKDAGVDIDAGNALVDRIKGVVKKTRRPEVMG
FT                   GLGGFGALCALPQKYREPVLVSGTDGVGTKLRLAMDLKRHDAIGIDLVAMCVNDLVVQG
FT                   AEPLFFLDYYATGKLDVDTAASVINGIAEGCLQSGCALVGGETAEMPGMYHGEDYDVAG
FT                   FCVGVVEKSEIIDGSRVAEGDVLIALGSSGPHSNGYSLVRKIIDVSGCDPQTTLLEGKP
FT                   LADHLLEPTRIYVKSVLELIENVDVHAIAHLTGGGFWENIPRVLPENTQAVINESSWQW
FT                   PAIFTWLQTAGNVSRHEMYRTFNCGVGMVIALSAPEADKALALLNEKGENAWKIGIIKA
FT                   SDSEQRVVIE"
FT   gene            430073..430276
FT                   /locus_tag="SPAB_00446"
FT   CDS_pept        430073..430276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65879"
FT                   /protein_id="ABX65879.1"
FT                   /translation="MRAWSAPWLSGRFFLHGFGRCLKISLLVKKKRISSTWFTTGGRDR
FT                   SFTLKIANIQTVVSLYRLFQRE"
FT   gene            complement(430284..430436)
FT                   /locus_tag="SPAB_00448"
FT   CDS_pept        complement(430284..430436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65881"
FT                   /protein_id="ABX65881.1"
FT                   /translation="MFDFHDLHTLLLSSDDWQPQKNRRIIPLFLSDATQCMLDLDQPKA
FT                   LIAEK"
FT   gene            430413..431039
FT                   /locus_tag="SPAB_00447"
FT   CDS_pept        430413..431039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2495 1.5e-105 upp; uracil
FT                   phosphoribosyltransferase K00761; COG: COG0035 Uracil
FT                   phosphoribosyltransferase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65880"
FT                   /db_xref="GOA:A9N2Y1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N2Y1"
FT                   /inference="protein motif:HMMPfam:IPR000836"
FT                   /inference="protein motif:HMMTigr:IPR005765"
FT                   /inference="similar to AA sequence:INSD:CAD02700.1"
FT                   /protein_id="ABX65880.1"
FT                   /translation="MKIVEVKHPLVKHKLGLMRENDISTKRFRELASEVGSLLTYEATA
FT                   DLETEKVTIEGWNGPVEIDQIKGKKITVVPILRAGLGMMEGVLENVPSARISVVGMYRN
FT                   EETLEPVPYFQKLVSNIDERMALIVDPMLATGGSVIATIDLLKKAGCSSIKVLVLVAAP
FT                   EGIAALEKAHPDVELYTASIDQGLNEHGYIIPGLGDAGDKIFGTK"
FT   gene            431127..432416
FT                   /locus_tag="SPAB_00449"
FT   CDS_pept        431127..432416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK0244 1.3e-07 guanine-hypoxanthine
FT                   permease; xanthine/uracil permease family protein K06901;
FT                   COG: COG2233 Xanthine/uracil permeases; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65882"
FT                   /inference="protein motif:HMMPfam:IPR006043"
FT                   /inference="protein motif:HMMTigr:IPR006042"
FT                   /inference="protein motif:ScanRegExp:IPR006042"
FT                   /inference="similar to AA sequence:INSD:AAL28077.1"
FT                   /protein_id="ABX65882.1"
FT                   /translation="MTRRAIGVSERPPLLQTIPLSLQHLFAMFGATVLVPVLFHINPAT
FT                   VLLFNGIGTLLYLFICKGKIPAYLGSSFAFISPVLLLLPLGYEVALGGFIMCGVLFCLV
FT                   SFIVKKAGTGWLDVMFPPAAMGAIVAVIGLELAGVAAGMAGLLPAQGQSPDTKTIIISM
FT                   VTLAVTVFGSVLFRGFLAIIPILIGVLAGYALSFALGVVDTTPIAQAHWFALPTFYTPR
FT                   FEWFAILTILPAALVVIAEHVGHLVVTANIVKKDLVRDPGLHRSMFANGLSTIISGFFG
FT                   STPNTTYGENIGVMAITRVYSTWVIGGAAIFAILLSCVGKLAAAIQIIPLPVMGGVSLL
FT                   LYGVIGASGIRVLIESKVDYNKAQNLILTSVILIIGVSGAKVHIGAAELKGMALATIVG
FT                   ICLSLIFKLISLLRPEEVVLEANDAESPHQ"
FT   gene            432535..433212
FT                   /locus_tag="SPAB_00450"
FT   CDS_pept        432535..433212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0009 3.8e-15 chromosomal
FT                   replication initiator protein DnaA K00972; COG: COG0593
FT                   ATPase involved in DNA replication initiation; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65883"
FT                   /db_xref="GOA:A9N2Y3"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR022864"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N2Y3"
FT                   /inference="protein motif:HMMPfam:IPR013317"
FT                   /inference="similar to AA sequence:INSD:AAL21390.1"
FT                   /protein_id="ABX65883.1"
FT                   /translation="MPLYLPDDETFASFWPGDNASLLAALQNVLRQEHSGYIYLWAREG
FT                   AGRSHLLHAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEHLSLVCIDNIECVAGDEL
FT                   WEMAIFDLYNRILESGKTRLLITGDRPPRQLNLGLPDLASRLDWGQIYKLQPLSDEDKL
FT                   QALQLRARLRGFELPEDVGRFLLKRLDREMRTLFMTLDQLDHASITAQRKLTIPFVKEI
FT                   LKL"
FT   gene            complement(433239..433598)
FT                   /locus_tag="SPAB_00451"
FT   CDS_pept        complement(433239..433598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA2520 5.8e-33 arsC; arsenate reductase;
FT                   COG: COG1393 Arsenate reductase and related proteins,
FT                   glutaredoxin family; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65884"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR006660"
FT                   /inference="protein motif:HMMTigr:IPR006659"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:AAV76385.1"
FT                   /protein_id="ABX65884.1"
FT                   /translation="MTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADAATV
FT                   RELLRMLGMSSARELMRQKEDLYKTLHLADSQLSEEALIQALVEHPKLMERPIVVANGQ
FT                   ARIGRPPEQVLDILG"
FT   gene            complement(433638..435101)
FT                   /locus_tag="SPAB_00452"
FT   CDS_pept        complement(433638..435101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2810 8.4e-238 yfgC; hypothetical
FT                   protein YfgC precursor; COG: COG4783 Putative Zn-dependent
FT                   protease, contains TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65885"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="protein motif:HMMPfam:IPR001915"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457029.1"
FT                   /protein_id="ABX65885.1"
FT                   /translation="MFRQLKKNLVATLIAALALGQVAPAFADPADTLPDMGTSAGSTLS
FT                   IGQEMQMGDFYVRQLRGSAPLINDPLLVQYINALGMRLVSHADSVKTPFHFFLINNDEI
FT                   NAFAFFGGNVVLHSALFRYADNESQLASVMAHEISHVTQRHLARAMEDQKRSAPLTWVG
FT                   ALGSILLAMASPQAGMAALTGTLAGTRQGMISFTQQNEQEADRIGIQVLQRAGFDPQAM
FT                   PSFLEKLLDQARYSTRPPEILLTHPLPESRLADARNRANQMRPVVVQSSADFYFAKARA
FT                   LGMYNSGRNQLTSDLLDQWSKGNVRQQHAAQYGRALQAMEASKYDEARKTLQPLLSAEP
FT                   NNAWYLDLATDIDLGQKRANDAINRLKNARDLRVNPVLQLNLANAYLQGGQPKAAETIL
FT                   NRYTFSHKDDGNGWDLLAQAEAALNNRDQELAARAESYALAGRLDQAISLLSSASAQAK
FT                   LGSQQQARYDARIDQLRQLQERFKPYTKM"
FT   gene            435318..436376
FT                   /locus_tag="SPAB_00453"
FT   CDS_pept        435318..436376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2668 7.0e-28
FT                   phosphoribosylaminoimidazole-succinocarboxamide (SAICAR)
FT                   synthetase K01923; COG: COG0628 Predicted permease; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00453"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65886"
FT                   /inference="protein motif:HMMPfam:IPR002549"
FT                   /inference="similar to AA sequence:INSD:AAL21387.1"
FT                   /protein_id="ABX65886.1"
FT                   /translation="MLMQWYRRRFSDPEAIALLVILVAGFSILFFFSGLLAPLLVAIVL
FT                   AYLLEWPTARLQAIGCSRRWAASIVLILFVGILLLMAFVVMPIAWQQGIYLIRDMPGML
FT                   NKLSDFAATLPRRYPALMDAGIIDAMAENMRTRMLNMGDSVVKYSLASLVGLLTLAVYL
FT                   VLVPLMVFFLVKDKEQMLNAVRRVLPRNRGLAGQVWNEMNQQITNYIRGKVLEMVVVGV
FT                   ATWLGFLLFGLNYSLLLAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGLGTEFWSCFAV
FT                   YLIIQALDGNLLVPVLFSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKAVVH
FT                   AWPDGQVTDTSS"
FT   gene            436433..436540
FT                   /locus_tag="SPAB_00454"
FT   CDS_pept        436433..436540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65887"
FT                   /protein_id="ABX65887.1"
FT                   /translation="MRTPDEGQALRKPLFFLMPHRVAAFLLSEPTKFSL"
FT   gene            436659..437840
FT                   /locus_tag="SPAB_00455"
FT   CDS_pept        436659..437840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_2682 6.1e-61 transcriptional
FT                   regulator, CdaR K01694; COG: COG3835 Sugar diacid
FT                   utilization regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65888"
FT                   /inference="protein motif:HMMPfam:IPR008599"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217476.1"
FT                   /protein_id="ABX65888.1"
FT                   /translation="MLRKHYLKGYTARQIVQRAMKIIPYSVNVMDEHGVIIASGEPSRL
FT                   RQRHEGAILALKENRIVEIDSATANQLKGVRSGINLPISFHEQLIGVVGITGEPEEVRA
FT                   YAELVKMAAELVIEHMALIEQRQWDKRYREELINQLILRENSTESLRSMAAYLGIDLAV
FT                   PRVVLIIELSQPDREALRNVMDYFENHARNHLVTFTEFNELIIIKPITLKEGKWNTRQE
FT                   MGELQIFKSWAASSGFSRILVGGYFAGETGLHRSLLTARATQAMAKRQKLRSQYIFYHD
FT                   HALPALLSGLSESWQVQELSRLWLQLAQHDAKGVLQQTLRTWFEHNCDLTQTAKALHIH
FT                   VNTLRYRLQRCEDITHIKINELKSTLWLYIGMELQAESVPSDKLPLPGRIEIC"
FT   gene            437908..439176
FT                   /locus_tag="SPAB_00456"
FT   CDS_pept        437908..439176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3106 7.8e-19 ygbN; hypothetical
FT                   permease YgbN K03299; COG: COG2610 H+/gluconate symporter
FT                   and related permeases; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00456"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65889"
FT                   /inference="protein motif:HMMPfam:IPR004680"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149700.1"
FT                   /protein_id="ABX65889.1"
FT                   /translation="MTSISTLGAIAALVVAIVLILRKVSPAYGMMAGALVGGLIGGADL
FT                   LQTVSLMVSGAQGIVNAVLRILAAGVLAGVLIESGAANTIAETIVRKVGETRALLALAI
FT                   ATLCLTAVGVFIDVAVITVAPIALSIARNAGLSKSAILLAMVGGGKAGNVMSPNPNAIA
FT                   ASDAFHVPLTSIMLAGVVPGIVGLIIAYLLAKRLNNKGAGVADHEVTYHDDSVARPGFL
FT                   VAISAPLVAIFLLSLRPFAGISIDPLIALPVGGLVGLLLMGRARHCNQYMVAGLMRMAP
FT                   VAIMLLGTGTLAGIIANSELKDVLIHGLTASGLPSWLLAPVSGAMMSMATASTTAGTAV
FT                   ASGVFSPTLLELGVSALAGAAMIHAGATVLDHLPHGSFFHATGGSVNMQIHERLKLMPY
FT                   ETLVGLAITFISTLMFGFFGFAG"
FT   gene            439182..440321
FT                   /locus_tag="SPAB_00457"
FT   CDS_pept        439182..440321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0377 2.8e-198 putative glycerate kinase
FT                   K00865; COG: COG1929 Glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00457"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65890"
FT                   /inference="protein motif:HMMPanther:IPR004381"
FT                   /inference="protein motif:HMMPfam:IPR004381"
FT                   /inference="protein motif:HMMTigr:IPR004381"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149701.1"
FT                   /protein_id="ABX65890.1"
FT                   /translation="MKIVIAPDSFKESLSAMAVAEAIEKGFREIYPDADYIKVPMADGG
FT                   EGTVQSMVEASGGRYVDQWVQGPLGQPVAARWGMLGDSDTAVIEMAAASGLHHVSPELR
FT                   NPLNTTSYGTGELIVAALERGVKRIILGIGGSATNDGGAGMMQALGVILRDKQGRSLSP
FT                   GGEALAALASIDLSGCHPLLRKVSITVACDVNNPLCGPQGASAIFGPQKGATAEMVNTL
FT                   DAALENWGRHIYQATGREVINAPGAGAAGGMGAALLGLLNAELRAGVEIVVETLQLEQA
FT                   VKDADLVITGEGRLDSQSICGKTPIGVARVAKRYHKPVIALAGGLQHDHHVVYQQGIDA
FT                   ALSILSHIVTLPEALHEAEYNLSLSARNVAAIWRLARQA"
FT   gene            complement(440368..440838)
FT                   /locus_tag="SPAB_00458"
FT   CDS_pept        complement(440368..440838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecj:JW2465 8.2e-82 bcp; thiol peroxidase,
FT                   thioredoxin-dependent K03564; COG: COG1225 Peroxiredoxin;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00458"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65891"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR013740"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:AAO68086.1"
FT                   /protein_id="ABX65891.1"
FT                   /translation="MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPG
FT                   CTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDENHQVCEQFG
FT                   VWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA"
FT   gene            complement(440838..441410)
FT                   /locus_tag="SPAB_00459"
FT   CDS_pept        complement(440838..441410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2806 3.6e-88 gcvR; glycine cleavage
FT                   system transcriptional repressor K03567; COG: COG2716
FT                   Glycine cleavage system regulatory protein; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00459"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65892"
FT                   /inference="protein motif:HMMPfam:IPR002912"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461425.1"
FT                   /protein_id="ABX65892.1"
FT                   /translation="MTPSSQHYLVITALGADRPGIVNTITRHVSSCGCNIEDSRLAMLG
FT                   DEFTFIMLLSGTWNAITLIESTLPLKGAELDLLIVMKRTSDRPRPAMPATVWVQVEVAD
FT                   SPHLIERFTALFNSHEMNIAELVSRTQPAEGDKAAQLFIQITAHSPASQNSANIEQAFK
FT                   ALCTELNAQGSINVVNYSQHDEQDGVK"
FT   gene            441556..442434
FT                   /locus_tag="SPAB_00460"
FT   CDS_pept        441556..442434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2484 3.9e-153 dapA; dihydrodipicolinate
FT                   synthase K01714; COG: COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65893"
FT                   /inference="protein motif:BlastProDom:IPR002220"
FT                   /inference="protein motif:Gene3D:IPR013785"
FT                   /inference="protein motif:HMMPfam:IPR002220"
FT                   /inference="protein motif:HMMPIR:IPR002220"
FT                   /inference="protein motif:HMMTigr:IPR005263"
FT                   /inference="protein motif:ScanRegExp:IPR002220"
FT                   /inference="similar to AA sequence:INSD:AAX66390.1"
FT                   /protein_id="ABX65893.1"
FT                   /translation="MFTGSIVALVTPMDEKGNVSRSCLKKLIDYHVANGTSAIVSVGTT
FT                   GESATLSHDEHGDVVMMTLELADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVT
FT                   PYYNRPTQEGLFQHFKAIAEHTDLPQILYNVPSRTGCDMLPETVGRLAEIKNIIAIKEA
FT                   TGNLTRVHQIKELVSDDFILLSGDDASALDFMQLGGHGVISVTANVAARDMADMCKLAA
FT                   EGQFAEARAINQRLMPLHNKLFVEPNPIPVKWACKALGLVATDTLRLPMTPITDHGRDI
FT                   VKAALQHAGLL"
FT   gene            442451..443485
FT                   /locus_tag="SPAB_00461"
FT   CDS_pept        442451..443485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00461"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3317 Uncharacterized lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65894"
FT                   /inference="protein motif:HMMPfam:IPR010653"
FT                   /inference="protein motif:ScanRegExp:IPR001360"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461423.1"
FT                   /protein_id="ABX65894.1"
FT                   /translation="MAYSVQKSRLAKVAGVSLVLLLAACSSDSRYKRQVSGDESYLDAA
FT                   PLAELHAPAGMILPITTGDYVIPVTKGSGAVGKALDIRPPAQPLALVSGARTQFSGDTA
FT                   TLLVENGRSSTLWPQVVSVIQAKNYPIEKRDDASQTLTTDWVNWNRLDEDEQYRGRYQI
FT                   SVKPQGYQQAVTVKLVNLEQAGKPVADAASLQRYSTEMMNVISAGLDKTATDAANAAQN
FT                   RSAATMDVQSAADDTGLPMLVVRGPFNLVWQRLPAALEKVGMKVTDSTRSQGSMAVTYK
FT                   PLSDSDWRDLGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQA
FT                   AFNK"
FT   gene            443660..444373
FT                   /locus_tag="SPAB_00462"
FT   CDS_pept        443660..444373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2487 1.3e-124 purC;
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthetase
FT                   (SAICAR synthetase) K01923; COG: COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65895"
FT                   /db_xref="GOA:A9N2Z5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N2Z5"
FT                   /inference="protein motif:BlastProDom:IPR001636"
FT                   /inference="protein motif:Gene3D:IPR013816"
FT                   /inference="protein motif:HMMPanther:IPR001636"
FT                   /inference="protein motif:HMMPfam:IPR001636"
FT                   /inference="protein motif:HMMTigr:IPR001636"
FT                   /inference="protein motif:ScanRegExp:IPR001636"
FT                   /inference="similar to AA sequence:INSD:AAV76394.1"
FT                   /protein_id="ABX65895.1"
FT                   /translation="MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDR
FT                   KGMVNNKFNHFIMTKLAEAGIPTQMERLLSDTECLVKKLEMVPVECVVRNRAAGSLVKR
FT                   LGVEEGMELNPPIFDLFLKNDALHDPMVNSSYCETFGWVSQENLARMKELTYKANDVLK
FT                   KLFDDAGLILVDFKLEFGLYKGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLI
FT                   EAYEAVAHRLGVKLD"
FT   gene            444504..445367
FT                   /locus_tag="SPAB_00463"
FT   CDS_pept        444504..445367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2802 1.5e-146 ypfJ; hypothetical
FT                   protein; COG: COG2321 Predicted metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65896"
FT                   /inference="protein motif:HMMPfam:IPR007343"
FT                   /inference="protein motif:ScanRegExp:IPR006025"
FT                   /inference="similar to AA sequence:INSD:AAV76395.1"
FT                   /protein_id="ABX65896.1"
FT                   /translation="MRWQGRRESNNVEDRRNRPGGPSLGGPGFRLPRGKGGIILLVVVL
FT                   VAGYYGVDLTGLLTGQPVSQQQSTRSISPNDDEAAKFTSVILATTEDTWGQLFQKMGRG
FT                   YQQPKLVMYRGMTRTGCGAGQSVMGPFYCPADGTVYIDLSFYDDMKNKLGADGDFAQGY
FT                   VIAHEVGHHVQKLLGIEPKVRQLQQNASQTEVNRLSVRMELQADCFAGVWGHSMQQQGV
FT                   LEAGDLEEALNAAQAIGDDRLQQQGQGRVVPDSFTHGTSEQRYSWFKRGFDSGDPAQCN
FT                   TFGKNF"
FT   gene            445383..447401
FT                   /locus_tag="SPAB_00464"
FT   CDS_pept        445383..447401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00464"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1444 Predicted P-loop ATPase fused to an
FT                   acetyltransferase; Psort location: CytoplasmicMembrane,
FT                   score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65897"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="protein motif:HMMPfam:IPR007807"
FT                   /protein_id="ABX65897.1"
FT                   /translation="MSDIDALRALTSQMTQEGIRRLLVISGDAAWCRERAEAIRAALPG
FT                   DWLWVAPDAPAQPCCTPQALQTLLGREFRHAIFDAWQGFDAAAFAALSGTLQAGSWLLL
FT                   LMPPYETWESRPDTDSLRWSDCAQPIPTPQFAQHLKRTLSRDPQTLLWRQRQPFCWPSY
FT                   PFRGRWRPATGEPQPEQAAILSRLREMPPGVATVIAPRGRGKSALAGQFISRMAGTAIV
FT                   TAPAKTATDILAAFAGERFCFMAPDALLASGARADWLVVDEAAAIPAPLLLQLVSRFPR
FT                   ILLTTTVQGYEGTGRGFLLKFCARFPQLHRFTLRQPVRWAPECPLENIVSEALIFDDEA
FT                   FAQAPHGAIAISAFYQQAWGETPALPRAVYQLLSGAHYRTSPLDLRRMMDAPGQHFLQA
FT                   TANNRVAGALWLVEEGGLSAELSQAVWCGFRRPRGNLVAQSLAAHGSDPLAATLVGRRV
FT                   SRIAVHPARQREGIGQQLIACACVQAAQCDYLSVSFGYTPELWRFWQRCGFVLVRMGNH
FT                   REASSGCYTAMALLPLSDAGKRLAQQEHRRLRRDADILTQWNGEAIPLAALDEQALNDE
FT                   DWRELVGFAFAHRPLLTSLGCLHRLLQYSALPLPALRGRLEEKASDAELCARLRISGRK
FT                   ALLALQRAQAAQALIALDAGRTQRLRDVMPGGGDHAG"
FT   gene            complement(447428..447628)
FT                   /locus_tag="SPAB_00465"
FT   CDS_pept        complement(447428..447628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00465"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13899 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65898"
FT                   /db_xref="GOA:A9N2Z8"
FT                   /db_xref="InterPro:IPR020910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N2Z8"
FT                   /inference="similar to AA sequence:SwissProt:Q8XF02"
FT                   /protein_id="ABX65898.1"
FT                   /translation="MDWLAKYWWILVLVFLVGVLLNVIKDLKRIDHKKFLANKPELPPH
FT                   RDFNDKWDDEDGWPKKDQPKK"
FT   gene            complement(447656..448783)
FT                   /locus_tag="SPAB_00466"
FT   CDS_pept        complement(447656..448783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2483 4.8e-203 dapE;
FT                   succinyl-diaminopimelate desuccinylase K01439; COG: COG0624
FT                   Acetylornithine deacetylase/Succinyl-diaminopimelate
FT                   desuccinylase and related deacylases; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65899"
FT                   /db_xref="GOA:A9N2Z9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N2Z9"
FT                   /inference="protein motif:HMMPfam:IPR002933"
FT                   /inference="protein motif:HMMPfam:IPR011650"
FT                   /inference="protein motif:HMMTigr:IPR005941"
FT                   /inference="protein motif:ScanRegExp:IPR001261"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461418.1"
FT                   /protein_id="ABX65899.1"
FT                   /translation="MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDF
FT                   GDTQNFWAWRGRGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSL
FT                   AAMVVAAERFVAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEP
FT                   SSTEIVGDVVKNGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRG
FT                   NDFFPATSMQVANIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEKHQLR
FT                   YTVDWWLSGQPFLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVEL
FT                   GPVNATIHKINECVNAADLQLLARMYQRIMEQLVA"
FT   gene            complement(448787..449143)
FT                   /locus_tag="SPAB_00467"
FT   CDS_pept        complement(448787..449143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2797 5.8e-49 yffB; conserved
FT                   thioredoxin-like protein; COG: COG1393 Arsenate reductase
FT                   and related proteins, glutaredoxin family; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00467"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65900"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR006660"
FT                   /inference="protein motif:HMMTigr:IPR006504"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:CAD02682.1"
FT                   /protein_id="ABX65900.1"
FT                   /translation="MITLYGIKNCDTIKKARRWLEEHGIDYRFHDYRVDGIDLPLLNTF
FT                   IAELGWQPLLNTRGTTWRKLDEGDRSGITDADSAAALMVEQPAIIKRPLLCAPGKPMLL
FT                   GFSESRYQQFFDEV"
FT   gene            complement(449520..449630)
FT                   /locus_tag="SPAB_00468"
FT   CDS_pept        complement(449520..449630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65901"
FT                   /protein_id="ABX65901.1"
FT                   /translation="MPSRHLFTKHDFDKIFPVPQFTFNHNSLSYYYGYST"
FT   gene            complement(449717..452830)
FT                   /locus_tag="SPAB_00469"
FT   CDS_pept        complement(449717..452830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2351 5.3e-110 yegO; hypothetical
FT                   protein YegO K07789; COG: COG0841 Cation/multidrug efflux
FT                   pump; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65902"
FT                   /inference="protein motif:FPrintScan:IPR001036"
FT                   /inference="protein motif:HMMPfam:IPR001036"
FT                   /inference="protein motif:HMMTigr:IPR004764"
FT                   /protein_id="ABX65902.1"
FT                   /translation="MANFFIDRPIFAWVLAILLCLTGALAIFSLPVEQYPDLAPPNVRI
FT                   TANYPGASAQTLENTVTQVIEQNMTGLDNLMYMSSQSSGTGQATITLSFIAGTDPDEAV
FT                   QQVQNQLQSAMRKLPQAVQDQGVTVRKTGDTNILTIAFVSTDGSMDKQDIADYVASNIQ
FT                   DPLSRVNGVGDIDAYGSQYSMRIWLDPAKLNSFQMTTKDVTDAIESQNAQIAVGQLGGT
FT                   PSVDKQALNATINAQSLLQTPQQFRDITLRVNQDGSEVKLGDVATVELGAEKYDYLSRF
FT                   NGNPASGLGVKLASGANEMATAKLVLDRLNELAQYFPHGLEYKIAYETTSFVKASIIDV
FT                   VKTLLEAIALVFLVMYLFLQNFRATLIPTIAVPVVLMGTFSVLYAFGYSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERIMSEEGLTPREATRKSMGQIQGALVGIAMVLSAVFVPMAF
FT                   FGGTTGAIYRQFSITIVSAMVLSVLVAMILTPALCATLLKPLHKGEQHGQRGFFGWFNR
FT                   TFNRNAERYEKGVAKILHRSLRWILIYVLLLGGMVFLFLRLPTSFLPQEDRGMFTTSIQ
FT                   LPSGSTQQQTLKVVEKVENYYFTHEKDNIMSVFSTVGSGPGGNGQNVARMFVRLKDWDA
FT                   RDPTTGSSFAIIERATKAFNQIKEARVFASSPPAISGLGSSAGFDMELQDHAGAGHDAL
FT                   MAARDQLIELAGKNSSLTRVRHNGLDDSPQLQIDIDQRKAQALGVSIDDINDTLQTAWG
FT                   SSYVNDFMDRGRVKKVYVQAAAKYRMLPDDINLWYVRNKDGGMVPFSAFATSRWETGSP
FT                   RLERYNGYSAVEIVGEAAPGVSTGTAMDVMESLVHQLPGGFGLEWTAMSYQERLSGAQA
FT                   PALYAISLLVVFLCLAALYESWSVPFSVMLVVPLGVIGALLATWMRGLENDVYFQVGLL
FT                   TVIGLSAKNAILIVEFANEMNQKGHALLDATLYASRQRLRPILMTSLAFIFGVLPMATS
FT                   AGAGSGSQHAVGTGVMGGMISATILAIFFVPLFFVLIRRRFPLKPRPE"
FT   gene            complement(453015..454853)
FT                   /locus_tag="SPAB_00470"
FT   CDS_pept        complement(453015..454853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2480 1.4e-297 narQ; sensory histidine
FT                   kinase in two-component regulatory system with NarP ( NarL)
FT                   K07674; COG: COG3850 Signal transduction histidine kinase,
FT                   nitrate/nitrite-specific; Psort location:
FT                   CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65903"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMPfam:IPR011712"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR003660"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="similar to AA sequence:INSD:AAL21374.1"
FT                   /protein_id="ABX65903.1"
FT                   /translation="MLLTDEGGVGNVHLPRKHNYLSRTCGRSIYFKANAIAIQLNAGST
FT                   SVTVKRPVSASLAKAFFYIVLLSILSTGSALLTLTSSLRDAEAINIAGSLRMQSYRLGY
FT                   DLQSRSPQINAHRQLFQHALNSPVLQNLNAWYVPQAVKTRYARLHANWLEMNSRLQDGD
FT                   IAWYQTNINNYVDQIDLFVLALQHYAERKVMLVVAISLAGGIGIFTLVFFTLRRIRQQV
FT                   VRPLNQLVTASQRIEHGQFAPLPLDTSLPNELGLLAKTFSQMSSELHKLYRSLEASVEE
FT                   KTHDLHEAHRRLEVLYQCSQALNTSQIDVHCFRHILQIVREHDAAWYLELTVGDNWRIS
FT                   EGAQSPDLPMQMLPVTMQDTVYGELHWQSPNVNASTPLLNSVSTMLGRGLYFNQAQKHF
FT                   QQLLLMEERATIARELHDSLAQVLSYLRIQLTLLKRAIPEDNAGAQSIMADFSRALNDA
FT                   YRQLRELLTTFRLTLQQADLPSALHEMLEDLQSQTPAKLTLDCRLPTLALDAQMQVHLL
FT                   QIVREAVLNAIKHANASEIAVSCVTAPDGDHTVYIRDNGIGIGEPHEPAGHYGLNIMRE
FT                   RAERLGGTLNFSQPSGGGTLVSISFRSSNKEESQLT"
FT   gene            454901..456862
FT                   /locus_tag="SPAB_00471"
FT   CDS_pept        454901..456862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2794 0. aegA, yffG; putative
FT                   oxidoreductase Fe-S subunit K00264; COG: COG0493
FT                   NADPH-dependent glutamate synthase beta chain and related
FT                   oxidoreductases; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65904"
FT                   /inference="protein motif:BlastProDom:IPR001327"
FT                   /inference="protein motif:FPrintScan:IPR000103"
FT                   /inference="protein motif:FPrintScan:IPR000759"
FT                   /inference="protein motif:FPrintScan:IPR013027"
FT                   /inference="protein motif:HMMPfam:IPR001327"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:HMMPfam:IPR013027"
FT                   /inference="protein motif:HMMTigr:IPR006006"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="protein motif:superfamily:IPR009051"
FT                   /protein_id="ABX65904.1"
FT                   /translation="MNRFIMANSQQCLGCHACEVACVMAHNDERHVLTSQRYQPRITVI
FT                   KHQHQRSAVTCHHCEDAPCARSCPNGAIAHINDSVQVNAQKCIGCKSCVVACPFGTMQM
FT                   VLTPVAPNQFKASAHKCDLCQGREQGPACVENCPADALQLVTEDSLTRLAKTRRLRTAR
FT                   QEIRPWHTVDTQHSGTASSKVERMQATPPRGEPDKLAIEARKTTFEEIYLPFRAAQAER
FT                   EAARCLTCGEHSICEWTCPLHNHIPQWIELVKAGDIDAAVELSHQTNCLPEITGRVCPQ
FT                   DRLCEGACTLRDEYGAVTIGNIERYISDRALSKGWRPDLSDVQKSDKRVAIIGAGPAGL
FT                   ACADVLARHGVSATVYDRHPEIGGLLTFGIPAFKLDKSLLARRREIFSAMGIRFELNCE
FT                   VGKDISLETLLESYDAVFVGVGTYRSMKADLPNEDAPGVYDALPFLIANTKQVMGLPAL
FT                   PDEPFIDTAGLNVVVLGGGDTAMDCVRTALRHGAANVTCAYRRDEANMPGSKKEVKNAR
FT                   EEGANFEFNVQPVELVLDTHGRASGIRFLRTRLGEPDGQGRRRPVPVPDSEFVMPADAV
FT                   IMAFGFHPHGMSWLESHGVKVDNWGRIAASVESEFRYQTSNPKIFAGGDAVRGADLVVT
FT                   AMAEGRHAAQGILDWLAK"
FT   gene            complement(456927..457037)
FT                   /locus_tag="SPAB_00472"
FT   CDS_pept        complement(456927..457037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65905"
FT                   /protein_id="ABX65905.1"
FT                   /translation="MASSGLLNVDPTEKCLSQGVQPCERQHFCKRSKVSQ"
FT   gene            complement(457116..457223)
FT                   /locus_tag="SPAB_00473"
FT   CDS_pept        complement(457116..457223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00473"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65906"
FT                   /protein_id="ABX65906.1"
FT                   /translation="MRFDSLRSPFGPPLAAFKTLTRFGEHCPGPKWQVK"
FT   gene            complement(457311..458609)
FT                   /locus_tag="SPAB_00474"
FT   CDS_pept        complement(457311..458609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oih:OB0667 3.5e-49 beta-lactamase K01467; COG:
FT                   COG1680 Beta-lactamase class C and other penicillin binding
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65907"
FT                   /db_xref="GOA:A9N307"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N307"
FT                   /inference="protein motif:HMMPfam:IPR001466"
FT                   /inference="protein motif:superfamily:IPR012338"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217461.1"
FT                   /protein_id="ABX65907.1"
FT                   /translation="MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDG
FT                   WIQNQIDAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNT
FT                   KMYATNFALQKLVYEGKIDVNDLVSKYIPGFKDMPGDKIKGKDKLRIIDILHHVAGFPA
FT                   DPQYPNKNVAGKLFSQSKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAMP
FT                   LDRYVETTIYKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQ
FT                   VHDEKAWYSMGGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNVKLFDDKTVAQFTRRSPE
FT                   DATFGLGWRVNGNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSP
FT                   VANPKVNPNVFVSGLLPAATYGWIVDQIYGSLK"
FT   gene            458813..459388
FT                   /locus_tag="SPAB_00475"
FT   CDS_pept        458813..459388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2793 1.7e-88 yffH; hypothetical
FT                   protein YffH K01515; COG: COG0494 NTP pyrophosphohydrolases
FT                   including oxidative damage repair enzymes; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65908"
FT                   /db_xref="GOA:A9N308"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N308"
FT                   /inference="protein motif:Gene3D:IPR000086"
FT                   /inference="protein motif:HMMPfam:IPR000086"
FT                   /inference="protein motif:HMMTigr:IPR004385"
FT                   /inference="protein motif:superfamily:IPR000086"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149715.1"
FT                   /protein_id="ABX65908.1"
FT                   /translation="MSQTITLIKDKILSDNYFTLRNITYDLTRRNGEVIRHKREVYDRG
FT                   NGATILLYNSTKKTVLLVRQFRVATWVNGNQDGMLIETCAGLLDNDEPEVCIRKEAIEE
FT                   TGYDVGEVRKIFELYMSPGGVTELIHFFIAEYHDSERASIGGGVEDEEIEVLELPFSRA
FT                   LEMVRSGEIRDGKTVLLLNYLQTSHLMD"
FT   gene            459513..460556
FT                   /locus_tag="SPAB_00476"
FT   CDS_pept        459513..460556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00476"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06758 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65909"
FT                   /inference="protein motif:HMMPfam:IPR009560"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149716.1"
FT                   /protein_id="ABX65909.1"
FT                   /translation="MRYRVIVFCLFGLLPVQLLWAAPAQRTFSDWQVTCNNQNFCVARN
FT                   TGEHHGLVMTLSRSAGARTDAVLRIDRGGLAPPDAKEAAIAPRLLLDGKPLSFNSPHWR
FT                   VSPWHLMTGDPATITAFLQTIQDAQAITLKNGVQTLSLAGLKAALLFIDAQQKRVGSET
FT                   AWIEKGNEPPLSVPPAPALKGIAVINPTPVPLSEEERGDLLDYAAWRVNGIRCSLDPLR
FT                   RETQVSALTDDKALLIVNCEAGAYNTIDLAWVVSRKKTLVSRAVRLRLPFNRGVESNDM
FT                   ELMNAFFDEKTRELVTLAKGRGLTDCGVQTRWRYDGDRFRLVRYAEEPSCDNWHGPDAW
FT                   PTLWITR"
FT   gene            460684..460914
FT                   /locus_tag="SPAB_00477"
FT   CDS_pept        460684..460914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00477"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG31287 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65910"
FT                   /inference="similar to AA sequence:INSD:AAL21369.1"
FT                   /protein_id="ABX65910.1"
FT                   /translation="MKINNGPVLCPHCGCLSAYYEIDRLAAIREKVNKEGGSAAWDSTL
FT                   QAHKKKAFCLMCHKSIDEVVIGQSDAPESTK"
FT   gene            complement(460977..462977)
FT                   /locus_tag="SPAB_00478"
FT   CDS_pept        complement(460977..462977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00478"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2474 0. tktB; transketolase K00615;
FT                   COG: COG0021 Transketolase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65911"
FT                   /inference="protein motif:Gene3D:IPR009014"
FT                   /inference="protein motif:HMMPanther:IPR005478"
FT                   /inference="protein motif:HMMPfam:IPR005474"
FT                   /inference="protein motif:HMMPfam:IPR005475"
FT                   /inference="protein motif:HMMPfam:IPR005476"
FT                   /inference="protein motif:HMMPIR:IPR005478"
FT                   /inference="protein motif:HMMTigr:IPR005478"
FT                   /inference="protein motif:ScanRegExp:IPR005474"
FT                   /inference="protein motif:ScanRegExp:IPR005475"
FT                   /inference="protein motif:superfamily:IPR009014"
FT                   /protein_id="ABX65911.1"
FT                   /translation="MSRKDLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLK
FT                   HNPTDPTWYDRDRFILSNGHASMLLYSLLHLTGYDLPLEELKNFRQLHSKTPGHPEIGY
FT                   TPGVETTTGPLGQGLANAVGLAIAERTLGAQFNRPDHEIVDHYTYVFMGDGCLMEGISH
FT                   EVCSLAGTLGLGKLIGFYDHNGISIDGETEGWFTDDTAKRFEAYHWHVVHDIDGHDPEA
FT                   VKKAILEAQSVKDKPSLIICRTVIGFGSPNKAGKEESHGAALGEEEVALTRQKLGWHHP
FT                   AFEIPKEIYRAWDGREKGEKAQQQWQEKFAAYEKAYPELAAEFTRRMSGGLPEAWESAT
FT                   QKFINDLQANPAKIATRKASQNTLNAYGPLLPELLGGSADLAPSNLTIWKGSTSLKEDP
FT                   AGNYIHYGVREFGMTAIANGIAHHGGFVPYTATFLMFVEYARNAARMAALMKARQIMVY
FT                   THDSIGLGEDGPTHQAVEQLASLRLTPNFSTWRPCDQVEAAVGWKLAIERHHGPTALIL
FT                   SRQNLAQVERTPEQVKAIARGGYILKDSGGKPDIILIATGSEMEITLQAAEKLTGEGHN
FT                   VRVVSLPSTDIFDAQDEAYRESVLPAHVTARVAVEAGIADYWYKYVGLKGAIIGMTGYG
FT                   ESAPADKLFPYFGFTVENIVEKARRVLNIKG"
FT   gene            complement(462997..463947)
FT                   /locus_tag="SPAB_00479"
FT   CDS_pept        complement(462997..463947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2710 3.3e-165 talA; transaldolase A
FT                   K00616; COG: COG0176 Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00479"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65912"
FT                   /inference="protein motif:Gene3D:IPR013785"
FT                   /inference="protein motif:HMMPanther:IPR001585"
FT                   /inference="protein motif:HMMPfam:IPR001585"
FT                   /inference="protein motif:HMMTigr:IPR004730"
FT                   /inference="protein motif:ScanRegExp:IPR001585"
FT                   /inference="similar to AA sequence:INSD:CAD07703.1"
FT                   /protein_id="ABX65912.1"
FT                   /translation="MNQLDGIKQFTTVVADSGDIESIRHYQPQDATTNPSLLLKAAGLE
FT                   QYGHLIEDAIAWGKKHGGTQEQQVAAASDKLAVNFGAEILKSIPGRVSTEVDARLSFDK
FT                   EKSIEKARNLVDLYQQQDVDKSRILIKLAATWEGIRAAEQLEKEGINCNLTLLFSFAQA
FT                   RACAEAGVYLISPFVGRIYDWYQARSPLEPYVVEEDPGVKSVRNIYDYFKQHRYETIVM
FT                   GASFRRTEQILALTGCDRLTISPNLLKELKEKEEPVIRKLVPSSQMFHRPTPMTEAEFR
FT                   WEHNQDAMAVEKLSEGIRLFAIDQRKLEDLLAAKL"
FT   gene            complement(464017..464187)
FT                   /locus_tag="SPAB_00480"
FT   CDS_pept        complement(464017..464187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65913"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217455.1"
FT                   /protein_id="ABX65913.1"
FT                   /translation="MTRPGAPHIITVLRNTNFEGLQTITTQRKSLLSTYNGHVTCLYQQ
FT                   YHACLLCFLVM"
FT   gene            464219..466498
FT                   /locus_tag="SPAB_00481"
FT   CDS_pept        464219..466498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2709 0. maeB; NADP-dependent malate
FT                   dehydrogenase (decarboxylating) K00029; COG: COG0280
FT                   Phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65914"
FT                   /inference="protein motif:HMMPfam:IPR002505"
FT                   /inference="protein motif:HMMPfam:IPR012301"
FT                   /inference="protein motif:HMMPfam:IPR012302"
FT                   /inference="protein motif:HMMPIR:IPR012188"
FT                   /inference="protein motif:ScanRegExp:IPR001891"
FT                   /protein_id="ABX65914.1"
FT                   /translation="MDEQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAA
FT                   PCLEIEKDPLAAYKYTARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGI
FT                   DVFDIEVDELDPDKFINVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFHDDQ
FT                   HGTAIISTAAILNGLRVVEKNISDVRMVVSGAGAAAIACMNLLVALGMQKHNIVVCDSK
FT                   GVIYKGREPNMAETKAAYAVDDSGKRTLDEVIDGADIFLGCSGPKVLTQEMVKKMARAP
FT                   MILALANPEPEILPPLAKEVRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAIN
FT                   EEMKLAAVRAIAELAHAEQSEVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKA
FT                   AMDSGVATRPIADFDAYIDKLTEFVYKTNLFMKPIFSQARKDPKRVVLPEGEEARVLHA
FT                   TQELITLGLAKPILIGRPSVIEMRIQKLGLQIKAGVDFEIVNNESDPRFKEYWSEYYQI
FT                   MKRRGVTQEQAQRAMIGNHTAIGAIMVQRGEADAMICGTIGDYHEHFSVVKAVFGYRDG
FT                   VHTAGAMNALLLPSGNTFIADTYVNEDPTPEQLAEIAVMAAETVRRFGIEPKVALLSHS
FT                   NFGSSNSLSASKMRETLERVRERAPDLMIDGEMHGDAALVESIRNDRMPDSPLKGAANI
FT                   LVMPNMEAARISYNLLRVSSSEGVTVGPVLMGVSKPVHVLTPIASVRRIVNMVALAVVE
FT                   AQTTPL"
FT   gene            466916..467251
FT                   /locus_tag="SPAB_00482"
FT   CDS_pept        466916..467251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_00303 0.0048 hydroxyethylthiazole
FT                   kinase K00878; COG: COG4810 Ethanolamine utilization
FT                   protein; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65915"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:HMMPIR:IPR009307"
FT                   /inference="similar to AA sequence:INSD:AAV76409.1"
FT                   /protein_id="ABX65915.1"
FT                   /translation="MNKERIIQEFVPGKQVTLAHLIAHPGEELAKKIGVPDAGAIGIMT
FT                   LTPGETAMIAGDLAMKAADVHIGFLDRFSGALVIYGTVGAVEEALLQTVSGLGRLLNFT
FT                   LCELTKS"
FT   gene            467264..467743
FT                   /locus_tag="SPAB_00483"
FT   CDS_pept        467264..467743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2785 3.7e-70 eutP; ethanolamine
FT                   utilization protein EutP K04029; COG: COG4917 Ethanolamine
FT                   utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65916"
FT                   /inference="protein motif:HMMPIR:IPR012381"
FT                   /inference="protein motif:HMMTigr:IPR012381"
FT                   /inference="similar to AA sequence:INSD:AAL21363.1"
FT                   /protein_id="ABX65916.1"
FT                   /translation="MKRIAFVGAVGAGKTTLFNALRGNYSLARKTQAVEFNDHGDIDTP
FT                   GEYFSHPRWYHALITTLQDVDTLIYVHAANDKESRLPAGLLDVGTRKRHIAVISKTDMP
FT                   DADVAATRQLLCEIGFREPIFELNGHDPQSVRQLVDYLAALSEQEEEAGEKTYHS"
FT   gene            467721..468410
FT                   /locus_tag="SPAB_00484"
FT   CDS_pept        467721..468410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00484"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4766 Ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65917"
FT                   /inference="protein motif:HMMPfam:IPR010424"
FT                   /inference="protein motif:superfamily:IPR011051"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461403.1"
FT                   /protein_id="ABX65917.1"
FT                   /translation="MKKLITANDIRAAHARGEQAMSVVLRASIITPEAREVAELLGFTI
FT                   TECDESVPASTSAQACKSESQRIREAIIAQLPEGQFTESLVAQLMEKVLKEKQSLELGT
FT                   MQPSFTSVTGKGGVKVIDGSSVKFGRFDGAEPHCVGLTDLVTEQDGSSMAAGFMQWDNA
FT                   FFPWTLNYDEIDMVLEGELHVRHEGETMIAKAGDVMFIPKGSSIEFGTPTSVRFLYVAW
FT                   PANWQSV"
FT   gene            468407..469210
FT                   /locus_tag="SPAB_00485"
FT   CDS_pept        468407..469210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2467 1.3e-140 eutT; putative cobalamin
FT                   adenosyltransferase, ethanolamine utilization K04032; COG:
FT                   COG4812 Ethanolamine utilization cobalamin
FT                   adenosyltransferase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65918"
FT                   /inference="protein motif:HMMPfam:IPR002779"
FT                   /inference="protein motif:HMMPIR:IPR009194"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461402.1"
FT                   /protein_id="ABX65918.1"
FT                   /translation="MNDFITETWLRANHTLSEGSEIHLPADARLTPSARELLESRRLRI
FT                   KFLDPQGRLFVDDDEQQPQPVHGLTSSDTHPQACCELCRQPVVKKPDTLTHLTADKMVA
FT                   KSDPRLGFRAALDSAIALTVWLQIELAEPWQPWLFDIRSRLGNIMRADAIDEPLAAQSI
FT                   VGLNEDELHRLSHQPLRYLDHDHLVPEASHGRDAALLNLLRTKVRETETLAAQVFITRS
FT                   FEVLRPDILQALNRLSSTVYVMMILSVAKHPLTVAQIQQRLGEKP"
FT   gene            469207..470223
FT                   /locus_tag="SPAB_00486"
FT   CDS_pept        469207..470223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2782 3.7e-157 eutD, ypfA, eutI;
FT                   ethanolamine utilization protein EutD acetyl/butyryl
FT                   phosphate transferase K04020; COG: COG0280
FT                   Phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00486"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65919"
FT                   /inference="protein motif:HMMPfam:IPR002505"
FT                   /inference="protein motif:HMMPIR:IPR012147"
FT                   /inference="protein motif:HMMTigr:IPR004614"
FT                   /inference="similar to AA sequence:INSD:AAC78115.1"
FT                   /protein_id="ABX65919.1"
FT                   /translation="MIIERARELAVRAPARVVFPDALDERVLKAAHYLQQYGLARPVLV
FT                   ASPFALRQFALSHRMAMDGIQVIDPHSNLSMRQRFAQRWLARAGEKTPPDAVEKLSDPL
FT                   MFAAAMVSAGEADVCIAGNLSSTANVLRAGLRVIGLQPGCKTLSSIFLMLPQYAGPALG
FT                   FADCSVVPQPTAAQLADIALASADTWRAITGEEPRVAMLSFSSNGSARHPNVANVQQAT
FT                   ELVRERAPQLLVDGELQFDAAFVPEVAAQKAPDSPLQGRANVMIFPSLEAGNIGYKIAQ
FT                   RLGGYRAVGPLIQGLAAPMHDLSRGCSVQEIIELALVAAVPRQADVSRERSLHTLVE"
FT   gene            470264..470554
FT                   /locus_tag="SPAB_00487"
FT   CDS_pept        470264..470554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00487"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00487"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65920"
FT                   /inference="protein motif:BlastProDom:IPR000249"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:ScanRegExp:IPR000249"
FT                   /inference="similar to AA sequence:INSD:AAV76414.1"
FT                   /protein_id="ABX65920.1"
FT                   /translation="MEALGMIETRGLVALIEASDAMVKAARVKLVGVKQIGGGLCTAMV
FT                   RGDVAACKAATDAGAAAAQRIGELVSVHVIPRPHGDLEEVFPISFKGDSNI"
FT   gene            470554..470670
FT                   /locus_tag="SPAB_00488"
FT   CDS_pept        470554..470670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65921"
FT                   /protein_id="ABX65921.1"
FT                   /translation="MVGRIRRAASPSGMNARHCLMVRRFKAYDPTGNPWRRI"
FT   gene            470667..470954
FT                   /locus_tag="SPAB_00489"
FT   CDS_pept        470667..470954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00489"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4576 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65922"
FT                   /inference="protein motif:BlastProDom:IPR004992"
FT                   /inference="protein motif:HMMPfam:IPR004992"
FT                   /inference="similar to AA sequence:INSD:AAL21358.1"
FT                   /protein_id="ABX65922.1"
FT                   /translation="MKLAVVTGQIVCTVRHQGLAHDKLLMVEMIDAQGNPDGQCAVAID
FT                   SIGAGTGEWVLLVSGSSARQAHRSELSPVDLCVIGIVDEVVAGGKVVFHK"
FT   gene            470966..472369
FT                   /locus_tag="SPAB_00490"
FT   CDS_pept        470966..472369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A0914 4.8e-100 aldehyde dehydrogenase
FT                   K04021; COG: COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65923"
FT                   /inference="protein motif:HMMPfam:IPR002086"
FT                   /inference="protein motif:HMMPIR:IPR012408"
FT                   /inference="similar to AA sequence:INSD:AAL21357.1"
FT                   /protein_id="ABX65923.1"
FT                   /translation="MNQQDIEQVVKAVLLKMKDSSQPASTVHEMGVFASLDDAVAAAKR
FT                   AQQGLKSVAMRQLAIHAIREAGEKHARELAELAVSETGMGRVDDKFAKNVAQARGTPGV
FT                   ECLSPQVLTGDNGLTLIENAPWGVVASVTPSTNPAATVINNAISLIAAGNSVVFAPHPA
FT                   AKKVSQRAITLLNQAVVAAGGPENLLVTVANPDIETAQRLFKYPGIGLLVVTGGEAVVD
FT                   AARKHTNKRLIAAGAGNPPVVVDETADLPRAAQSIVKGASFDNNIICADEKVLIVVDSV
FT                   ADELMRLMEGQHAVKLTAAQAEQLQPVLLKNIDERGKGTVSRDWVGRDAGKIAAAIGLN
FT                   VPDQTRLLFVETSANHPFAVTELMMPVLPVVRVANVEEAIALAVQLEGGCHHTAAMHSR
FT                   NIDNMNQMANAIDTSIFVKNGPCIAGLGLGGEGWTTMTITTPTGEGVTSARTFVRLRRC
FT                   VLVDAFRIV"
FT   gene            472380..473219
FT                   /locus_tag="SPAB_00491"
FT   CDS_pept        472380..473219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00491"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4820 Ethanolamine utilization protein,
FT                   possible chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65924"
FT                   /inference="protein motif:HMMTigr:IPR013366"
FT                   /inference="similar to AA sequence:INSD:CAD07693.1"
FT                   /protein_id="ABX65924.1"
FT                   /translation="MAHDEQLWLTPRLQKAAALCNQTPASSDTPLWLGVDLGTCDVVSM
FT                   VVDGNAQPVAVCLDWADVVRDGIVWDFFGAVTLVRRHLDTLEQQLGCRFTHAATSFPPG
FT                   TDPRISINVLESAGLEVSHVLDEPTAVADLLALDNAGVVDIGGGTTGIAIVKQGKVTYS
FT                   ADEATGGHHISLTLAGNRRIPLEEAEQYKRSNAQEIWPVVKPVYEKMAEIVARHIEGQG
FT                   IADLWLAGGSCMQPGVEALFRQRFPELQVHLPQHSLFMTPLAIANSGRAKAEGLYAS"
FT   gene            473209..474396
FT                   /locus_tag="SPAB_00492"
FT   CDS_pept        473209..474396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2777 5.3e-181 eutG, yffV;
FT                   ethanolamine utilization protein EutG iron-containing
FT                   alcohol dehydrogenase K04022; COG: COG1454 Alcohol
FT                   dehydrogenase, class IV; Psort location: Cytoplasmic,
FT                   score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65925"
FT                   /inference="protein motif:HMMPfam:IPR001670"
FT                   /inference="protein motif:ScanRegExp:IPR001670"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217444.1"
FT                   /protein_id="ABX65925.1"
FT                   /translation="MQAELQTALFQAFDTLNLQRVKTFSVPPVTLCGLGALGACGQEAQ
FT                   ARGVSHLFVMVDSFLHQAGMTAPLVRSLAMKGVAMTVWPCPPGEPCITDVCAAVAQLRE
FT                   AACDGVVAFGGGSVLDAAKAVALLVTNPDQTLSAMTERSTLRPRLPLIAVPTTAGTGSE
FT                   TTNVTVIIDAVSGRKQVLAHASLMPDVAILDAAVTEGVPPNVTAMTGIDALTHAIEAYS
FT                   ALNATPFTDSLAIGAIAMIGKSLPKAVGYGHDLAARENMLLASCMAGMAFSSAGLGLCH
FT                   AMAHQPGAALHIPHGQANAMLLPTVMGFNRMVCRERFSQIGRALTNKKSDDRDAIAAVS
FT                   ELIAEVGQSKRLADAGAKPEHYSAWAQAALEDICLRSNPRTATQAQIIDLYAAAG"
FT   gene            474516..475742
FT                   /locus_tag="SPAB_00493"
FT   CDS_pept        474516..475742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1788 0.0037 fruA; PTS system,
FT                   fructose-specificIIBC component K02769:K02770; COG: COG3192
FT                   Ethanolamine utilization protein; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65926"
FT                   /inference="protein motif:HMMPfam:IPR007441"
FT                   /inference="similar to AA sequence:SwissProt:P41796"
FT                   /protein_id="ABX65926.1"
FT                   /translation="MGINEIIMYIMMFFMLIAAVDRILSQFGGSARFLGKFGKSIEGSG
FT                   GQFEEGFMAMGALGLAMVGMTALAPVLAHVLGPVIIPVYEMLGANPSMFAGTLLACDMG
FT                   GFFLAKELAGGDVAAWLYSGLILGSMMGPTIVFSIPVALGIIEPSDRRYLALGVLAGIV
FT                   TIPIGCIAGGLIAMYSGVQINGQPVEFTFALILMNMIPVLIVAVLVALGLKFIPEKMIN
FT                   GFQIFAKFLVALITIGLAAAVVKFLLGWELIPGLDPIFMAPGDKPGEVMRAIEVIGSIS
FT                   CVLLGAYPMVLLLTRWFEKPLMNVGKLLNVNNIAAAGMVATLANNIPMFGMMKQMDTRG
FT                   KVINCAFAVSAAFALGDHLGFAAANMNAMIFPMIVGKLIGGVTAIGVAMMLVPKDDAAQ
FT                   VKTEAEAQS"
FT   gene            475739..477142
FT                   /locus_tag="SPAB_00494"
FT   CDS_pept        475739..477142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00494"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4819 Ethanolamine utilization protein,
FT                   possible chaperonin protecting lyase from inhibition"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65927"
FT                   /inference="protein motif:HMMPfam:IPR009377"
FT                   /inference="similar to AA sequence:INSD:CAD07690.1"
FT                   /protein_id="ABX65927.1"
FT                   /translation="MNTRQLLSVGIDIGTTTTQVIFSRLELVNRAAVSQVPRYEFIKRD
FT                   ISWQSPVFFTPVDKQGGLKEAELKALILAQYQAADIAPESVDSGAIIITGESAKTRNAR
FT                   PAVMTLSQSLGDFVVASAGPHLESVIAGYGAGAQSLSEQRMCRVLNIDIGGGTSNYALF
FT                   DAGKVSGTACLNVGGRLLETDAQGRVVYAHQPGQMIIDEVFGSGTDARALAAAQLGQVA
FT                   RRMADLIVEVITGALSPLAQSLMQTGLLPADITPEVITLSGGVGECYRNQPADPFCFSD
FT                   IGPLLATALHEHPRLREMNVQFPAQTVRATVIGAGAHTLSLSGSTIWLEDVQLPLRNLP
FT                   VAIPQDDADLVNAWRQALLQLDLDPQTDAYVLALPATLPVRYAALLTVINALTAFVARY
FT                   PNPHPLLVVAEQDFGKALGMLLRPQLPQLPLAVIDEVVVRAGDYIDIGTPLFGGSVVPV
FT                   TVKSLAFPS"
FT   gene            477154..478515
FT                   /locus_tag="SPAB_00495"
FT   CDS_pept        477154..478515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0410 2.3e-242 eutB; ethanolamine
FT                   ammonia-lyase heavy chain K03735; COG: COG4303 Ethanolamine
FT                   ammonia-lyase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65928"
FT                   /inference="protein motif:HMMPfam:IPR010628"
FT                   /inference="similar to AA sequence:INSD:AAL21352.1"
FT                   /protein_id="ABX65928.1"
FT                   /translation="MKLKTTLFGNVYQFKDVKEVLAKANELRSGDVLAGVAAASSQERV
FT                   AAKQVLSEMTVADIRNNPVIAYEEDCVTRLIQDDVNETAYNRIKNWSISELREYVLSDE
FT                   TSVDDIAFTRKGLTSEVVAAVAKICSNADLIYGGKKMPVIKKANTTIGIPGTFSCRLQP
FT                   NDTRDDVQSIAAQIYEGLSFGAGDAVIGVNPVTDDVENLTRVLDTVYGVIDKFNIPTQG
FT                   CVLAHVTTQIEAIRRGAPGGLIFQSICGSEKGLKEFGVELAMLDEARAVGAEFNRIAGE
FT                   NCLYFETGQGSALSAGANFGADQVTMEARNYGLARHYDPFLVNTVVGFIGPEYLYNDRQ
FT                   IIRAGLEDHFMGKLSGISMGCDCCYTNHADADQNLNENLMILLATAGCNYIMGMPLGDD
FT                   IMLNYQTTAFHDTATVRQLLNLRPSPEFERWLETMGIMANGRLTKRAGDPSLFF"
FT   gene            478534..479430
FT                   /locus_tag="SPAB_00496"
FT   CDS_pept        478534..479430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2457 3.4e-154 eutC; ethanolamine
FT                   ammonia-lyase, light chain K03736; COG: COG4302
FT                   Ethanolamine ammonia-lyase, small subunit; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65929"
FT                   /db_xref="GOA:A9N329"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N329"
FT                   /inference="protein motif:HMMPfam:IPR009246"
FT                   /inference="similar to AA sequence:INSD:AAC78124.1"
FT                   /protein_id="ABX65929.1"
FT                   /translation="MDQKQIEEIVRSVMASMGQDVPQPVAPSTQEGAKPQCAAPTVTES
FT                   CALDLGSAEAKAWIGVENPHRADVLTELRRSTAARVCTGRAGPRPRTQALLRFLADHSR
FT                   SKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLSPEAIDALKSQCVMNPD
FT                   VQVVVSDGLSTDAITANYEEILPPLLAGLKQAGLNVGTPFFVRYGRVKIEDQIGEILGA
FT                   KVVILLVGERPGLGQSESLSCYAVYSPRVATTVEADRTCISNIHQGGTPPVEAAAVIVD
FT                   LAKRMLEQKASGINMTR"
FT   gene            479440..480099
FT                   /locus_tag="SPAB_00497"
FT   CDS_pept        479440..480099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00497"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4816 Ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65930"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:HMMPIR:IPR009193"
FT                   /inference="similar to AA sequence:INSD:AAX66360.1"
FT                   /protein_id="ABX65930.1"
FT                   /translation="MPALDLIRPSVTAMRVIASVNDGFARELKLPPHIRSLGLITADSD
FT                   DVTYIAADEATKQAMVEVVYGRSLYAGAAHGPSPTAGEVLIMLGGPNPAEVRAGLDAMV
FT                   ASIENGAAFQWANDAENTAFLAHVVSRTGSYLSSTAGIALGDPMAYLVAPPLEATFGID
FT                   AAMKSADVQLVTYVPPPSETNYSAAFLTGSQAACKAACNAFTDAVLDIARNPVQRA"
FT   gene            480112..480606
FT                   /locus_tag="SPAB_00498"
FT   CDS_pept        480112..480606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00498"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65931"
FT                   /inference="protein motif:BlastProDom:IPR000249"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:ScanRegExp:IPR000249"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461390.1"
FT                   /protein_id="ABX65931.1"
FT                   /translation="MINALGLLEVDGMVAAVDAADAMLKAANVRLLSHQVLDPGRLTLV
FT                   VEGDLAACRAALDAGSAAAQRTGRVISRKEIGRPEEDTQWLIGGFARATTQTEKTPQAP
FT                   ATPEFAEALLALLASVRQGMTAGEVAAHFGWPLEQARNVLEQLFSDGALRKRSSRYRIK
FT                   N"
FT   gene            480654..481706
FT                   /locus_tag="SPAB_00499"
FT   CDS_pept        480654..481706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00499"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2207 AraC-type DNA-binding domain-containing
FT                   proteins; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65932"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR000005"
FT                   /inference="protein motif:HMMSmart:IPR000005"
FT                   /inference="protein motif:ScanRegExp:IPR000005"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:INSD:AAL21348.1"
FT                   /protein_id="ABX65932.1"
FT                   /translation="MKKTRTANLHHLYHEALPEDVKLTPRVEVDNVHQRRTTDVYEHAL
FT                   TITAWQQIYDQLHPGKFHGEFTEILLDEIQVFREYTGLALRQSCLVWPNSFWFGIPATR
FT                   GEQGFIGAQGLGSAEIATRPGGTEFELSTPDDYTILGVVISEDVISRQATFLHNPERVL
FT                   HMLRNQLALEVKEQHKAALWGFVQQALATFSESPETLHQPAVRKVLSDNLLLAMGTMLE
FT                   EAKPIHSAESISHQGYRRLLSRAREYVLENMSEPLTVLDLCNQLHVSRRTLQNAFHAIL
FT                   GIGPNAWLKRIRLNAVRRELISPWSQSATVKDAAMQWGFWHLGQFATDYQQLFAEKPSL
FT                   TLHQRMRQWA"
FT   gene            481763..481918
FT                   /locus_tag="SPAB_00500"
FT   CDS_pept        481763..481918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65933"
FT                   /protein_id="ABX65933.1"
FT                   /translation="MAAGALPGLRIRCRLWLVARTRRASAASGEARAQRAKQFCHQVMR
FT                   MNVYVC"
FT   gene            complement(481906..483183)
FT                   /locus_tag="SPAB_00501"
FT   CDS_pept        complement(481906..483183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00501"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG18511 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65934"
FT                   /inference="similar to AA sequence:INSD:CAD07684.1"
FT                   /protein_id="ABX65934.1"
FT                   /translation="MDERIPCKNPQCSHFILPATAARTEGYCMPCVQARYRQEQEEYIR
FT                   KNRKTIDAFSGITNPVEMLKLVHEPREHDPLIEWIPCPIPTDELYKKLSDDESRDMVDY
FT                   AEELFDSGWQEEAQEIALCLAAFTQANLDNFLRQVINEEELELSSPLPFHRAPPDVRDA
FT                   LLQKVETDDENRDGILCALAWIGDEVVVEHFNRWHQEPPAWSASLHILPHRYAHQAGWE
FT                   LTENGRRRDLYFTQCTHLVKQAPEQPAVFRAVAEYGENCPHCSLPLINLFEVSPSAVGL
FT                   STQGWPGQIRILTCQCCTAYNTVFATVDPQGQPRWYEKNALSTLAVENSSDWITLPLDV
FT                   LHPGESRLPLFAAEIFLPTTFSQLGGHPAWVQDADYPTCPTCAQTMMFLAQLSYEDIEE
FT                   EEYAEGMLYGFICPSCQTTATSYQQT"
FT   gene            complement(483312..483500)
FT                   /locus_tag="SPAB_00502"
FT   CDS_pept        complement(483312..483500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00502"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG29106 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65935"
FT                   /inference="similar to AA sequence:INSD:CAD07683.1"
FT                   /protein_id="ABX65935.1"
FT                   /translation="MSFGLIVLLVINMVTIPVVMALIALLCFIVHIPRKSVNCILLCIL
FT                   ACILTIAGLFIAYPVGR"
FT   gene            complement(483662..484561)
FT                   /locus_tag="SPAB_00503"
FT   CDS_pept        complement(483662..484561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2451 4.9e-171 hemF; coproporphyrinogen
FT                   III oxidase K00228; COG: COG0408 Coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65936"
FT                   /db_xref="GOA:A9N336"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N336"
FT                   /inference="protein motif:HMMPanther:IPR001260"
FT                   /inference="protein motif:HMMPfam:IPR001260"
FT                   /inference="protein motif:HMMPIR:IPR001260"
FT                   /inference="protein motif:ScanRegExp:IPR001260"
FT                   /inference="similar to AA sequence:SwissProt:P33771"
FT                   /protein_id="ABX65936.1"
FT                   /translation="MKPDAHHVKQFLLRLQDDICQTLSAVDGANFVEDSWRREAGGGGR
FT                   SRVLRNGGIFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPT
FT                   SHANVRFFIAEKPGADPVWWFGGGFDLTPYYGFEEDAVHWHRTARDLCQPFGDDVYPRY
FT                   KKWCDDYFFLKHRNEQRGIGGLFFDDLNTPDFDHCFDFMQAVGNGYTRAYLPIVERRKA
FT                   MVWGERERNFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRWEYDWQPE
FT                   AGSPEAALSEFIQVRDWI"
FT   gene            complement(484564..485433)
FT                   /locus_tag="SPAB_00504"
FT   CDS_pept        complement(484564..485433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2687 2.6e-149 amiA; probable
FT                   N-acetylmuramoyl-L-alanine amidase K01448; COG: COG0860
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65937"
FT                   /inference="protein motif:HMMPfam:IPR002508"
FT                   /inference="protein motif:HMMSmart:IPR002508"
FT                   /inference="similar to AA sequence:INSD:CAD07681.1"
FT                   /protein_id="ABX65937.1"
FT                   /translation="MSTFKLLKTLTSRRQVLKTGLAALTLSGMSHAIAKEETLKTSNGH
FT                   SKPKTKKTGSKRLVMLDPGHGGIDTGAIGRNGSQEKHVVLAIAKNVRAILRNHGIDARL
FT                   TRTGDTFIPLYDRVEIAHKHGADLFMSIHADGFTNPKAAGASVFALSNRGASSAMAKYL
FT                   SERENRADEVAGKKATDRDHLLQQVLFDLVQTDTIKNSLTLGSHILKKIKPIHKLHSRT
FT                   TEQAAFVVLKSPSIPSVLVETSFITNPEEERLLGTTAFRQKIATAIANGIISYFHWFDN
FT                   QKAHTKKR"
FT   gene            485511..486071
FT                   /locus_tag="SPAB_00505"
FT   CDS_pept        485511..486071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00505"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2767 7.6e-79 ypeA; hypothetical
FT                   protein YpeA K00680; COG: COG0456 Acetyltransferases; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65938"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217435.1"
FT                   /protein_id="ABX65938.1"
FT                   /translation="MFYFSFQYVTHRHYAIFSATSRQILAESDVCAIILVFPPEKATNT
FT                   MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKVNHDVSLFLVAEVSGEVVGTVM
FT                   GGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQIMVRDDNDVVLGMY
FT                   ERLGYEHSDALSLGKRLIEDEEY"
FT   gene            486058..486507
FT                   /locus_tag="SPAB_00506"
FT   CDS_pept        486058..486507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00506"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG08687 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65939"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217434.1"
FT                   /protein_id="ABX65939.1"
FT                   /translation="MKSTEFHPADYDVHGRLRLPFLFWCVLLLQARAWVLFVIAGSSRG
FT                   QGNTLLNFFYPDHDNFWLGLLPGVPAVVAFLLSGRREAFPGVWRWLRGLLILAQLVSLC
FT                   WLPVIWLGGDPVNGVGLALLLADIVALIWLLTNQRLRACFSFEKE"
FT   gene            486569..487144
FT                   /locus_tag="SPAB_00507"
FT   CDS_pept        486569..487144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00507"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06776 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65940"
FT                   /inference="protein motif:HMMPfam:IPR010938"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149742.1"
FT                   /protein_id="ABX65940.1"
FT                   /translation="MKSLRLTLLALPLALTGCSTLSSVNWSAANPWNWFGSSTEVTEQG
FT                   VGALTAATPLEEPAIAEALDGDYRLRSGMKTDNGNVVRFFEAMKGDNVAMVINGEQGTV
FT                   SRIDVLDSDIPTAAGGKIGTPFSDLYSKAFGHCEPVSSDSHTSVECKAEGSQHISYVFS
FT                   GEWSGPEGLMPPDDVLKNWDVRKIIWRR"
FT   gene            487239..488138
FT                   /locus_tag="SPAB_00508"
FT   CDS_pept        487239..488138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B0946 5.0e-43 predicted iron-dependent
FT                   peroxidase K00430; COG: COG2837 Predicted iron-dependent
FT                   peroxidase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65941"
FT                   /inference="protein motif:HMMPfam:IPR006314"
FT                   /inference="protein motif:HMMTigr:IPR006314"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804281.1"
FT                   /protein_id="ABX65941.1"
FT                   /translation="MSQVQSGILPEHCRAAIWIEANVKGDLDALRAASRTFADKLATFE
FT                   VKFPDAHLGAVVAFGNNTWRALSGGVGAEELKDFIPYGKGLAPATQYDVLIHILSLRHD
FT                   VNFSVAQAAMEAFGDCIDVKEEVHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDG
FT                   VDAGGSYVFVQRWEHNLKQLNRMSIHDQEMMIGRTKEANEEIDGDARPATSHLSRVDLK
FT                   EDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLHNIEQQLLSMFGDTDGKRDAMLRFTK
FT                   PVTGGYYFAPSLDRLLAL"
FT   gene            488376..489167
FT                   /locus_tag="SPAB_00509"
FT   CDS_pept        488376..489167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2445 6.0e-134 ucpA; putative
FT                   oxidoreductase; COG: COG1028 Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases); Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65942"
FT                   /inference="protein motif:HMMPanther:IPR002347"
FT                   /inference="protein motif:HMMPfam:IPR002198"
FT                   /inference="similar to AA sequence:INSD:AAO68131.1"
FT                   /protein_id="ABX65942.1"
FT                   /translation="MGKLTGKTALITGASQGIGEGIARVFARHGANLILLDISDEIEKL
FT                   ADELGGRGHRCTAVKADVRDFASVQAAVARAKETEGRIDILVNNAGVCRLGNFLDMSEE
FT                   DRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTGDMVADPGETAYALSKAAIV
FT                   GLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPDDPESVLTEMAKAIPLRRLA
FT                   DPLEVGELAAFLASDESSYLTGTQNVIDGGSTLPESVSVGV"
FT   gene            489325..490341
FT                   /locus_tag="SPAB_00510"
FT   CDS_pept        489325..490341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00510"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4150 ABC-type sulfate transport system,
FT                   periplasmic component; Psort location: Periplasmic,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65943"
FT                   /inference="protein motif:HMMPfam:IPR006059"
FT                   /inference="protein motif:HMMTigr:IPR005669"
FT                   /inference="protein motif:ScanRegExp:IPR000957"
FT                   /inference="protein motif:ScanRegExp:IPR002052"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217430.1"
FT                   /protein_id="ABX65943.1"
FT                   /translation="MAVNFLKKNALTLAASLLLVGQVQATELLNSSYDVSRELFAALNP
FT                   PFEQQWAKDNGGDKLTIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDKGKLLP
FT                   ADWQSRLPNNSSPFYSTMGFLVRKGNPKNIHDWSDLVRSDVKLIFPNPKTSGNARYTYL
FT                   AAWGAADNADGGDKAKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVN
FT                   NIRKQYEAQGFEVVIPKTNILAEFPVAWVDKNVQANGTEKAAKAYLNWLYSPQAQTIIT
FT                   HYYYRVNNPEIMGKQADKFPQTELFRVEDKFGSWPEMMKTHFASGGELDKLLAAGRK"
FT   gene            490341..491174
FT                   /locus_tag="SPAB_00511"
FT   CDS_pept        490341..491174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syn:sll0739 7.6e-30 modBC; ABC-type molybdate
FT                   transport system permease/ATP-binding protein K02018; COG:
FT                   COG0555 ABC-type sulfate transport system, permease
FT                   component; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65944"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR005667"
FT                   /inference="protein motif:HMMTigr:IPR011865"
FT                   /inference="similar to AA sequence:INSD:AAV76434.1"
FT                   /protein_id="ABX65944.1"
FT                   /translation="MLAVSSRRVLPGFTLSLGTSLLFVCLILLLPLSALVMQLSQMSWS
FT                   QYWDVVTNPQVVAAYKVTLLAAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPF
FT                   ALPTAVAGLTLASLFSVNGFYGQFLAQFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVL
FT                   EELGPEYEEAAQTLGATRLQSFRKVVLPELSPALIAGVALSFTRSLGEFGAVIFIAGNI
FT                   AWKTEVTSLMIFVRLQEFDYPAASAIASVILAASLLLLFSINTLQSRFGRRVVGH"
FT   gene            491174..492049
FT                   /locus_tag="SPAB_00512"
FT   CDS_pept        491174..492049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pac:PPA0505 8.2e-27 ABC transporter, putative
FT                   molybdenum transport system K02017:K02018; COG: COG4208
FT                   ABC-type sulfate transport system, permease component;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65945"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR005667"
FT                   /inference="protein motif:HMMTigr:IPR011866"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149747.1"
FT                   /protein_id="ABX65945.1"
FT                   /translation="MAEVTQLKRYDVPRINWGKWFLIGVGMLVSAFILLVPMIYIFVQA
FT                   FSKGLMPVLQNLADPDMLHAIWLTVLIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLT
FT                   LLDIPFAVSPVVAGLVYLLFYGSNGPLGGWLDEHNLQMMFSWPGMVLVTIFVTCPFVVR
FT                   ELVPVMLSQGSQEDEAAILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVS
FT                   VVSGSIRGETLSLPLQIELLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWRLENQEK
FT                   RAQQEENHEH"
FT   gene            492039..493136
FT                   /locus_tag="SPAB_00513"
FT   CDS_pept        492039..493136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2441 9.2e-193 cysA; ABC superfamily
FT                   (atp_bind), sulfate permease A protein; chromate resistance
FT                   K02045; COG: COG1118 ABC-type sulfate/molybdate transport
FT                   systems, ATPase component; Psort location: Cytoplasmic,
FT                   score:9.12"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65946"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR005666"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="protein motif:superfamily:IPR008995"
FT                   /inference="similar to AA sequence:SwissProt:P40860"
FT                   /protein_id="ABX65946.1"
FT                   /translation="MSIEIARIKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTLL
FT                   RIIAGLEHQSSGHIRFHGTDVSRLHARERKVGFVFQHYALFRHMTVFDNIAFGLTVLPR
FT                   RDRPTAAAIKTKVTQLLEMVQLAHLADRFPAQLSGGQKQRVALARALAVEPQILLLDEP
FT                   FGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPD
FT                   RVWREPATRFVLEFMGEVNRLTGTVRGGQFHVGAHRWPLGYTPAYQGPVDLFLRPWEVD
FT                   ISRRTSLDSPLPVQVIEASPKGHYTQLVVQPLGWYHDPLTVVMAGEDVPVRGERLFVGL
FT                   QKARLYNGDQRIETHEEELALAQSA"
FT   gene            493204..494115
FT                   /locus_tag="SPAB_00514"
FT   CDS_pept        493204..494115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2439 1.6e-158 cysM; cysteine synthase B
FT                   (O-acetylserine sulfhydrolase B) K01738; COG: COG0031
FT                   Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00514"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65947"
FT                   /inference="protein motif:HMMPfam:IPR001926"
FT                   /inference="protein motif:HMMTigr:IPR005856"
FT                   /inference="protein motif:HMMTigr:IPR005858"
FT                   /inference="protein motif:ScanRegExp:IPR001216"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217426.1"
FT                   /protein_id="ABX65947.1"
FT                   /translation="MNTLEQTIGNTPLVKLQRLAPDNGSEIWVKLEGNNPAGSVKDRAA
FT                   LSMIVEAEKRGEIKPGDVLIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMR
FT                   AYGAELILVTKEQGMEGARDLALAMSERGEGKLLDQFNNPDNPYAHYTTTGPEIWRQTS
FT                   GRITHFVSSMGTTGTITGVSRFLREQEKPVTIVGLQPEEGSSIPGIRRWPAEYMPGIFN
FT                   ASLVDEVLDIHQNDAENTMRELAVREGIFCGVSSGGAVAGALRVARATPGAIVVAIICD
FT                   RGDRYLSTGVFGEEHFSQGAGI"
FT   gene            complement(494246..494785)
FT                   /locus_tag="SPAB_00515"
FT   CDS_pept        complement(494246..494785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saz:Sama_2971 0.0011 peptidoglycan
FT                   glycosyltransferase K05364; COG: COG0744 Membrane
FT                   carboxypeptidase (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65948"
FT                   /inference="protein motif:HMMPfam:IPR001264"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217424.1"
FT                   /protein_id="ABX65948.1"
FT                   /translation="MPGVLLWFFKGVIALLLAFAVGLIVYYYLEIRPIAQTALQSASFW
FT                   LAESPQTRFLRRAAAKIHPKSYTARLLYTQAGVDGHFRTAIWVFWLDSLYRDDELYAMM
FT                   LAQAYYGRDSQGNAVYGTKNAALTLFHVPVTEMACQQQVQLIYIFKAPSLYRPGSARLV
FT                   ESSKHYMTLCQEQIQQ"
FT   gene            complement(494798..495178)
FT                   /locus_tag="SPAB_00516"
FT   CDS_pept        complement(494798..495178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00516"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG10258 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00516"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65949"
FT                   /inference="similar to AA sequence:INSD:AAL21332.1"
FT                   /protein_id="ABX65949.1"
FT                   /translation="MKKDFTMKKIVCAVVALLLTLPAWAKLNAHEEARINAMLNALAQK
FT                   KDLTFVRNGDAHNCEEAVSHLRLKLGNTRNRIDTAEQFIDKVASSSSITGKPYIVKIPG
FT                   KSDENAQPYLHALIAETDKNVE"
FT   gene            complement(495237..495956)
FT                   /locus_tag="SPAB_00517"
FT   CDS_pept        complement(495237..495956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_2237 2.1e-28 glutamine
FT                   amidotransferase class-I K01951; COG: COG0518 GMP synthase
FT                   - Glutamine amidotransferase domain; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65950"
FT                   /inference="protein motif:HMMPfam:IPR000991"
FT                   /inference="similar to AA sequence:SwissProt:P40194"
FT                   /protein_id="ABX65950.1"
FT                   /translation="MRVHFVVHESFESAGAYLKWAEDRGYTISWSRVYAGEALPPNADE
FT                   FDMLVVFGGPQSPRTTREECPYFDSRAEQHLINQAITARRMVIGICLGSQLIGEALGAA
FT                   VCQSPEKEIGHYPITLTEAGLRHPLITHFGSPLTVGHWHNDMPGLTDQATVLAESEGCP
FT                   RQIVQYGNFVYGFQCHMEFTVEAVEGLIQHSQQELADAQGKRFIRSVAEMRAWNYQQMN
FT                   EKLWRFLDELTLAHSQK"
FT   gene            complement(495971..497263)
FT                   /locus_tag="SPAB_00518"
FT   CDS_pept        complement(495971..497263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0881 5.3e-25 transcriptional
FT                   regulatory protein GntR family K00825; COG: COG1167
FT                   Transcriptional regulators containing a DNA-binding HTH
FT                   domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00518"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65951"
FT                   /inference="protein motif:Gene3D:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR004839"
FT                   /inference="protein motif:HMMSmart:IPR000524"
FT                   /inference="similar to AA sequence:SwissProt:P40193"
FT                   /protein_id="ABX65951.1"
FT                   /translation="MIDGKTANEIFDSIRQHIIAGTLRAEDSLPPVRELASELKVNRNT
FT                   VAAAYKRLITAGLAQSLGRNGTVIKGSPSPVALEGGDPHTPLHDLSGGNPDPQRLPDLS
FT                   RYFARLSRTPHLYGDAPVSPELHAWAARWLRDATPVAGEIDITSGAIDAIERLLCAHLL
FT                   PGDSVAVEDPCFLSSINMLRYAGFSASPVSVDSEGMQPEKLERALNQGARAVILTPRAH
FT                   NPTGCSLSARRAAALQNMLARYPQVLVIIDDHFALLSSSPWQPVIAQTTQHWAVIRSVS
FT                   KTLGPDLRLAIVASDSATSAKLRLRLNAGSQWVSHLLQDLVYACLTDPEYQHRLTQTRL
FT                   FYAARQQKLARALQQYGIAISPGDGVNAWLPLDTHSQATAFTLAKSGWLVREGEAFGVS
FT                   APSHGLRITLSTLNDSEINTLAADIHQALNR"
FT   gene            497346..498212
FT                   /locus_tag="SPAB_00519"
FT   CDS_pept        497346..498212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2435 7.6e-150 pdxK;
FT                   pyridoxal-pyridoxamine kinase/hydroxymethylpyrimidine
FT                   kinase K00868; COG: COG2240
FT                   Pyridoxal/pyridoxine/pyridoxamine kinase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00519"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65952"
FT                   /inference="protein motif:HMMPfam:IPR011611"
FT                   /inference="protein motif:HMMTigr:IPR004625"
FT                   /inference="similar to AA sequence:INSD:AAO68140.1"
FT                   /protein_id="ABX65952.1"
FT                   /translation="MGQESDIQSVLFDDNHRALQTDIVAVQSQVVYGSVGNSIAVPAIK
FT                   AQGLRVTAVPTVLFSNTPHYKTFYGGIIPAEWFAGYLTALNERDALRELKAITTGYMGS
FT                   ADQIVLLSKWLMAIRASHPEVCILVDPVIGDTDSGMYVQAEIPQAYRTHLLPQAQGLTP
FT                   NVFELEMLSGKPCRTLEEAVAAAQSLLSDTLKWVVITSAPGESLETITVAVVTAQVVEV
FT                   FAHPRVATELKGTGDLFCAELVSGIVQGKKLTTAAKDAAQRVLEVMTWTQQCGCDELIL
FT                   PPAGEAR"
FT   gene            498209..498448
FT                   /locus_tag="SPAB_00520"
FT   CDS_pept        498209..498448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00520"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG31214 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65953"
FT                   /inference="protein motif:ScanRegExp:IPR002086"
FT                   /inference="similar to AA sequence:INSD:AAV76442.1"
FT                   /protein_id="ABX65953.1"
FT                   /translation="MKSYRLVVRQQGRIVGHFETSGLDALEDICVARAMFGITGGYQCE
FT                   LQVSDSERRMLESGPDGMKILMREKCFRPVTSQL"
FT   gene            complement(498598..499107)
FT                   /locus_tag="SPAB_00521"
FT   CDS_pept        complement(498598..499107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0424 4.9e-84 crr; glucose-specific IIA
FT                   component of PTS system K02777; COG: COG2190
FT                   Phosphotransferase system IIA components; Psort location:
FT                   Cytoplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65954"
FT                   /inference="protein motif:BlastProDom:IPR001127"
FT                   /inference="protein motif:HMMPfam:IPR001127"
FT                   /inference="protein motif:HMMTigr:IPR001127"
FT                   /inference="protein motif:ScanRegExp:IPR001127"
FT                   /inference="protein motif:superfamily:IPR011055"
FT                   /inference="similar to AA sequence:INSD:AAV76443.1"
FT                   /protein_id="ABX65954.1"
FT                   /translation="MGLFDKLKSLVSDDKKDTGTIEIVAPLSGEIVNIEDVPDVVFAEK
FT                   IVGDGIAIKPTGNKMVAPVDGTIGKIFETNHAFSIESDSGIELFVHFGIDTVELKGEGF
FT                   KRIAEEGQRVKVGDPVIEFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSVTVGETP
FT                   VIRIKK"
FT   gene            complement(499148..500875)
FT                   /locus_tag="SPAB_00522"
FT   CDS_pept        complement(499148..500875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2432 6.3e-297 ptsI; General PTS family
FT                   (Enzyme I) PEP-protein phosphotransferase K08483; COG:
FT                   COG1080 Phosphoenolpyruvate-protein kinase (PTS system EI
FT                   component in bacteria); Psort location: Cytoplasmic,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65955"
FT                   /inference="protein motif:BlastProDom:IPR000121"
FT                   /inference="protein motif:HMMPfam:IPR000121"
FT                   /inference="protein motif:HMMPfam:IPR008279"
FT                   /inference="protein motif:HMMPfam:IPR008731"
FT                   /inference="protein motif:HMMTigr:IPR006318"
FT                   /inference="protein motif:ScanRegExp:IPR000121"
FT                   /inference="protein motif:ScanRegExp:IPR008279"
FT                   /inference="protein motif:superfamily:IPR008279"
FT                   /inference="protein motif:superfamily:IPR008731"
FT                   /inference="similar to AA sequence:INSD:AAO68143.1"
FT                   /protein_id="ABX65955.1"
FT                   /translation="MISGILASPGIAFGKALLLKEDEIVIDRKKISADKVDQEVERFLS
FT                   GRAKASAQLEAIKTKAGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAA
FT                   HEVIEGQATALEELDDEYLKERAADVRDIGKRLLRNILGLAIIDLSAIQEEVILVAADL
FT                   TPSETAQLNLQKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSVTAQVKNGDYLILDA
FT                   VNNQVYVNPTNDVIEQLRAVQEQVATEKAELAKLKDLPAITLDGHQVEVCANIGTVRDV
FT                   EGAERNGAEGVGLYRTEFLFMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDK
FT                   ELPYMNFPKEENPFLGWRAVRIAMDRKEILRDQVRAILRASAFGKLRIMFPMIISVEEV
FT                   RALRKEIEIYKQELRDEGKAFDESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQ
FT                   YTLAVDRGNDMISHLYQPMSPSVLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLG
FT                   MGLDEFSMSAISIPRIKKIIRNTNFEDAKVLAEQALAQPTTDELMTLVNKFIEEKTIC"
FT   gene            complement(500924..501181)
FT                   /locus_tag="SPAB_00523"
FT   CDS_pept        complement(500924..501181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00523"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bci:BCI_0069 1.5e-32 ptsH; phosphocarrier
FT                   protein HPr K00890; COG: COG1925 Phosphotransferase system,
FT                   HPr-related proteins; Psort location: Cytoplasmic,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65956"
FT                   /inference="protein motif:BlastProDom:IPR000032"
FT                   /inference="protein motif:Gene3D:IPR000032"
FT                   /inference="protein motif:HMMPfam:IPR000032"
FT                   /inference="protein motif:HMMTigr:IPR005698"
FT                   /inference="protein motif:ScanRegExp:IPR001020"
FT                   /inference="protein motif:ScanRegExp:IPR002114"
FT                   /inference="protein motif:superfamily:IPR000032"
FT                   /inference="similar to AA sequence:INSD:ABG70428.1"
FT                   /protein_id="ABX65956.1"
FT                   /translation="MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAK
FT                   SLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE"
FT   gene            complement(501225..501353)
FT                   /locus_tag="SPAB_00524"
FT   CDS_pept        complement(501225..501353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00524"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00524"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65957"
FT                   /protein_id="ABX65957.1"
FT                   /translation="MFNDERNVSGHKLPATDCVEHLLCRVPFTPALTIQAKVEPPG"
FT   gene            complement(501396..501557)
FT                   /locus_tag="SPAB_00525"
FT   CDS_pept        complement(501396..501557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65958"
FT                   /protein_id="ABX65958.1"
FT                   /translation="MLKTRKKAPFWVLFCGLLQTFTSPGIDSPCRNWYLTRLIILMREI
FT                   NRYRKSVS"
FT   gene            complement(501565..502536)
FT                   /locus_tag="SPAB_00526"
FT   CDS_pept        complement(501565..502536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2666 1.8e-166 cysK; cysteine synthase A
FT                   K01738; COG: COG0031 Cysteine synthase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00526"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65959"
FT                   /inference="protein motif:HMMPfam:IPR001926"
FT                   /inference="protein motif:HMMTigr:IPR005856"
FT                   /inference="protein motif:HMMTigr:IPR005859"
FT                   /inference="protein motif:ScanRegExp:IPR001216"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX65959.1"
FT                   /translation="MSKIYEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRI
FT                   GANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLL
FT                   KALGANLVLTEGAKGMKGAIQKAEEIVASDPQKYLLLQQFSNPANPEIHEKTTGPEIWE
FT                   DTDGQVDVFISGVGTGGTLTGVTRYIKGTKGKTDLITVAVEPTDSPVIAQALAGEEIKP
FT                   GPHKIQGIGAGFIPGNLDLKLIDKVVGITNEEAISTARRLMEEEGILAGISSGAAVAAA
FT                   LKLQEDESFTNKNIVVILPSSGERYLSTALFADLFTEKELQQ"
FT   gene            complement(502700..503563)
FT                   /locus_tag="SPAB_00527"
FT   CDS_pept        complement(502700..503563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH03674 2.9e-06 hypothetical protein
FT                   K01954; COG: COG2981 Uncharacterized protein involved in
FT                   cysteine biosynthesis; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65960"
FT                   /inference="protein motif:HMMPfam:IPR007496"
FT                   /inference="similar to AA sequence:INSD:AAA27050.1"
FT                   /protein_id="ABX65960.1"
FT                   /translation="MLFFRTFPNYPPSDNRVRYPTFTQGFKKKEYVLNMVSSSTTVPRS
FT                   GVYYFSQGWKLVTLPGIRRFVILPLLVNIVLMGGAFWWLFTQLDAWIPSLMSHVPDWLQ
FT                   WLSYLLWPIAVISVLLVFGYFFSTLANWIAAPFNGLLAEQLEARLTGATPPDTGILGIM
FT                   KDVPRIMKREWQKLAWYLPRAIVLLVLYFIPGIGQTIAPVLWFLFSAWMLAIQYCDYPF
FT                   DNHKVPFKTMRAALRTQKVANMQFGALTSLFTMIPVLNLFIMPVAVCGATAMWVDCWRA
FT                   KHALWK"
FT   gene            503693..504679
FT                   /locus_tag="SPAB_00528"
FT   CDS_pept        503693..504679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00528"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2744 1.2e-137 zipA; cell division
FT                   protein ZipA K03528; COG: COG3115 Cell division protein;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65961"
FT                   /db_xref="GOA:A9N361"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR011919"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N361"
FT                   /inference="protein motif:HMMPfam:IPR007449"
FT                   /inference="protein motif:HMMSmart:IPR007449"
FT                   /inference="protein motif:HMMTigr:IPR011919"
FT                   /inference="similar to AA sequence:INSD:AAV76448.1"
FT                   /protein_id="ABX65961.1"
FT                   /translation="MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMK
FT                   SKRDDDSYDDDVEEDEGVGEVRVHRVNHAPGQSQEHDAPRQSPQHQYQPPYASAQPRPA
FT                   APPQPQAPMQQPVQQPVQPAPQPQQVQPSAPPVQPPQQQPAPLSQAPQPVAQPAPPPSA
FT                   QTFQPAEPVVEAEPVVEEAPVVEKPQRKEAVIIMNVAAHHGSELNGEVLLNSIQQSGFK
FT                   FGDMNIFHRHLSPDGSGPALFSLANMVNPGTFDPEMTDFTTPGVTIFMQVPSYGDALQN
FT                   FKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDRIREVMDANA"
FT   gene            504751..506766
FT                   /locus_tag="SPAB_00529"
FT   CDS_pept        504751..506766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2427 0. lig; DNA ligase K01972; COG:
FT                   COG0272 NAD-dependent DNA ligase (contains BRCT domain type
FT                   II); Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65962"
FT                   /db_xref="GOA:A9N362"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N362"
FT                   /inference="protein motif:BlastProDom:IPR004150"
FT                   /inference="protein motif:Gene3D:IPR004150"
FT                   /inference="protein motif:HMMPfam:IPR000445"
FT                   /inference="protein motif:HMMPfam:IPR001357"
FT                   /inference="protein motif:HMMPfam:IPR004149"
FT                   /inference="protein motif:HMMPfam:IPR004150"
FT                   /inference="protein motif:HMMPfam:IPR013839"
FT                   /inference="protein motif:HMMSmart:IPR001357"
FT                   /inference="protein motif:HMMSmart:IPR013840"
FT                   /inference="protein motif:HMMTigr:IPR001679"
FT                   /inference="protein motif:ScanRegExp:IPR001679"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /inference="protein motif:superfamily:IPR010994"
FT                   /protein_id="ABX65962.1"
FT                   /translation="MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELREL
FT                   EAQRPDLITPDSPTQRVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKS
FT                   TENVIWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDN
FT                   IPARLEVRGEVFLPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTF
FT                   FCYGVGILEGGELPDTHLGRLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLG
FT                   FDIDGVVIKVNSLALQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPV
FT                   ARLEPVQVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEET
FT                   RPIVFPTHCPVCGSDVERVEGEAVTRCTGGLICSAQRKESLKHFVSRRAMDVDGMGDKI
FT                   IDQLVEREYVHTPADLFRLTAGKLTGLDRMGPKSAQNVVNALEKAKATTFARFLYALGI
FT                   REVGEATAAGLAAYFGTLEALQAATIDELQKVPDVGIVVATHVFNFFAEESNRDVIGQL
FT                   LAEGVHWPAPVVINVQEIDSPFAGKTVVLTGSLSQMSRDDAKARLVALGAKVAGSVSKK
FT                   TDLVIAGEAAGSKLAKAQELGITVIDEAEMIRLLGA"
FT   gene            506759..506986
FT                   /locus_tag="SPAB_00530"
FT   CDS_pept        506759..506986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cmu:TC0823 0.00043 DNA polymerase III, epsilon
FT                   subunit, putative K02342; COG: COG3530 Uncharacterized
FT                   protein conserved in bacteria; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65963"
FT                   /inference="similar to AA sequence:INSD:AAL21320.1"
FT                   /protein_id="ABX65963.1"
FT                   /translation="MPEMEKEQLVEIANTVMPFGKYQGRRLIDLPEEYLLWFARKDQFP
FT                   AGKLGELMQITLLIKTEGLTQLVQPLKRPL"
FT   gene            complement(506983..507981)
FT                   /locus_tag="SPAB_00531"
FT   CDS_pept        complement(506983..507981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00531"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0385 Predicted Na+-dependent transporter;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65964"
FT                   /inference="protein motif:HMMPfam:IPR002657"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149763.1"
FT                   /protein_id="ABX65964.1"
FT                   /translation="MKLFRILDPFTLTLITVVLLASFFPAEGSFVPVVEGITTAAIALL
FT                   FFMHGAKLSREAIIAGGSHWRLHLWVMCSTFVLFPVLGVLFAWWAPVNVDPMLYSGFLY
FT                   LCILPATVQSAIAFTSLAGGNVAAAVCSASASSLLGIFLSPLLVGLVMNIHGAQGSLEE
FT                   VGKIMLQLLLPFVLGHLSRPWIGNWVARNKKWIAKTDQTSILLVVYSAFSEAVVNGIWH
FT                   KVGWGSLLFIVVVSLVLLAIVIAINVFVARKCGFNKADEITIVFCGSKKSLANGIPMAN
FT                   ILFPTSVLGMMVLPLMIFHQIQLMVCAGLARRYKRQTEKLQAQQESRAAKA"
FT   gene            508071..508997
FT                   /locus_tag="SPAB_00532"
FT   CDS_pept        508071..508997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 6.8e-23 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65965"
FT                   /inference="protein motif:FPrintScan:IPR000847"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:INSD:AAL21318.1"
FT                   /protein_id="ABX65965.1"
FT                   /translation="MNYSLRQLRIFITVAQAKSFSRAGDRIGLSQSAVSHSVKELERQT
FT                   GVRLLDRTTREVVLTEAGQQLATRLERVLDELNSILRDAGRVGTQLTGTVRVAASQTIS
FT                   AHLIPQCIAQSNSLYPAIDFVLHDRPQQWVLESIRQGEVDFGIVIDPGAAVDLQCEAIL
FT                   SEPFLLLCRQDHPLAHQEWVSWQDLKQASLVLQDYASGSRPLIDAALAHFAIEADIVQE
FT                   IGHPATLFPMVEAGIGISVLPALALPLPQGSHLQVKRLTPVVERQLMLARRKNRSLSTA
FT                   AQALWDVVRTQASELTAARAKDPLYQL"
FT   gene            complement(509059..509820)
FT                   /locus_tag="SPAB_00533"
FT   CDS_pept        complement(509059..509820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00533"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06876 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65966"
FT                   /inference="protein motif:HMMPfam:IPR010786"
FT                   /inference="similar to AA sequence:INSD:AAL21317.1"
FT                   /protein_id="ABX65966.1"
FT                   /translation="MKKILTLTLSSLLIIPALTHAEFKGGFADIGLHYLDWTSDTTEKT
FT                   SKKSHKDDFGYLELEGGANFSWGEMYGFFDWENFYNGHHAKPGSEQRYTFKNTNRIYLG
FT                   DTGLNLYLHAYGTYGSPHRANFHDDMFLYGLGYNFTGNGYWFKPFFAKRYTDQTYYTGD
FT                   NGYVLGWVAGYSFSLGSEKFSVTNWNEYEFDRDASYAAGNGGKDGINGAVALWWNATPH
FT                   LTAGVQYRYADNKLGESFLQDGIIYSIKYLF"
FT   gene            510076..510909
FT                   /locus_tag="SPAB_00534"
FT   CDS_pept        510076..510909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2420 3.4e-147 xapA; xanthosine
FT                   phosphorylase (purine nucleoside phosphorylase) K03815;
FT                   COG: COG0005 Purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65967"
FT                   /inference="protein motif:HMMPanther:IPR001369"
FT                   /inference="protein motif:HMMPfam:IPR001369"
FT                   /inference="protein motif:HMMPIR:IPR011268"
FT                   /inference="protein motif:HMMTigr:IPR010943"
FT                   /inference="protein motif:HMMTigr:IPR011268"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217407.1"
FT                   /protein_id="ABX65967.1"
FT                   /translation="MPHALFSHNPEYCIDIIHAHKPAFTPRVAFILGSGLGALADQIED
FT                   AVAISYEKLPGFPVSTVHGHAGELVLGHLAGVPVACMKGRGHFYEGRGMAVMTDAIRTL
FT                   KLLGCEVLFCTNAAGSLRPEVGPGSLVALSDHINTMPGTPMVGPNDDRYGDRFFSLANA
FT                   YDADYRAMLQSVAAEEGFPLTEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVI
FT                   SARHCGLKVVAVSAITNLAEGLGDVKLSHAQTLAAAELSRQNFINLICGFLRKLA"
FT   gene            510964..512220
FT                   /locus_tag="SPAB_00535"
FT   CDS_pept        510964..512220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3355 1.5e-135 nupG; transport of
FT                   nucleosides, permease protein K03289; COG: NOG06211 non
FT                   supervised orthologous group; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65968"
FT                   /inference="protein motif:HMMPfam:IPR004740"
FT                   /inference="protein motif:HMMTigr:IPR004740"
FT                   /inference="similar to AA sequence:INSD:AAL21315.1"
FT                   /protein_id="ABX65968.1"
FT                   /translation="MGITSRLKVMSFLQYFIWGSWLVTLGSYMINTLDFTGANVGMVYS
FT                   SKGLAAIIMPGIMGIIADKWLRAERAYMLCHLVCAGALLYATTVTDPQTMFWVMLVNAM
FT                   AYMPTIALSNSVSYSCLAKAGQDPVTSFPPVRVFGTIGFIVAMWTVSLMGLELSSAQLY
FT                   IASGASLLLALYALTLPKIPVAEKKANTTLASKLGLDAFVLFKNPRMAIFFLFAMMLGA
FT                   VLQITNVFGNPFLHDFARNPEFADSFVVKYPSILLSVSQMAEVGFILTIPFFLKRFGIK
FT                   TVMLMSMLAWTLRFGFFAFGDPSPFGFVLLLLSMIVYGCAFDFFNISGSVFVEQEVDSS
FT                   IRASAQGLFMTMVNGVGAWIGSLLSGMAVDYFSIDGVKDWQTIWLVFAAYALALAVIFA
FT                   LFFKYQHHPEKLSTKSLAH"
FT   gene            512279..512437
FT                   /locus_tag="SPAB_00536"
FT   CDS_pept        512279..512437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00536"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG19353 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65969"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217405.1"
FT                   /protein_id="ABX65969.1"
FT                   /translation="MKEIILSSGIGFGIGAFFTLCRIPIPAPNVLPGVLSIVFMYIGYL
FT                   VVKSIFY"
FT   gene            512489..513373
FT                   /locus_tag="SPAB_00537"
FT   CDS_pept        512489..513373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 9.2e-19 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65970"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456957.1"
FT                   /protein_id="ABX65970.1"
FT                   /translation="MERAHRIDLKLLRYFLAVAEELHFGRAAARLNMSQPPLSIHIKEL
FT                   EQQLGTLLFIRHSRSVALTHAGKVLMEESRRLLANANQALARVEQIGRGEAGRIELGVV
FT                   GTALWGRMRPAMRHFLKANPNVEVLFREKSPGMQMALLERRELDAGIWRMAIEPAVGFT
FT                   SIRLHESAFMVAVPEDHDLASRDSVPLSALRNEYFVTLPSVHSDWGFLQRVCQQAGFSP
FT                   MIIREVVEPQTVLAMISMGIGITLMADGYAQMSWPGVVFRPLEERIPADLYIVYDQQQA
FT                   TPALEKLVAALTV"
FT   gene            513386..513520
FT                   /locus_tag="SPAB_00538"
FT   CDS_pept        513386..513520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65971"
FT                   /protein_id="ABX65971.1"
FT                   /translation="MATNVLSGLRGGVVCRPDKRSASGKTRTCCRFESSISQIAKKRL"
FT   gene            complement(513539..513611)
FT                   /locus_tag="SPAB_00539"
FT   tRNA            complement(513539..513611)
FT                   /locus_tag="SPAB_00539"
FT                   /product="tRNA-Lys"
FT   gene            complement(513619..513691)
FT                   /locus_tag="SPAB_00540"
FT   tRNA            complement(513619..513691)
FT                   /locus_tag="SPAB_00540"
FT                   /product="tRNA-Val"
FT   gene            complement(513736..513808)
FT                   /locus_tag="SPAB_00541"
FT   tRNA            complement(513736..513808)
FT                   /locus_tag="SPAB_00541"
FT                   /product="tRNA-Val"
FT   gene            complement(513857..513929)
FT                   /locus_tag="SPAB_00542"
FT   tRNA            complement(513857..513929)
FT                   /locus_tag="SPAB_00542"
FT                   /product="tRNA-Val"
FT   gene            514188..515603
FT                   /locus_tag="SPAB_00543"
FT   CDS_pept        514188..515603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2415 7.7e-260 gltX; glutamate tRNA
FT                   synthetase, catalytic subunit K01885; COG: COG0008
FT                   Glutamyl- and glutaminyl-tRNA synthetases; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65972"
FT                   /db_xref="GOA:A9N372"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N372"
FT                   /inference="protein motif:FPrintScan:IPR000924"
FT                   /inference="protein motif:Gene3D:IPR008925"
FT                   /inference="protein motif:HMMPanther:IPR000924"
FT                   /inference="protein motif:HMMPfam:IPR000924"
FT                   /inference="protein motif:HMMTigr:IPR004527"
FT                   /inference="protein motif:ScanRegExp:IPR001412"
FT                   /inference="protein motif:superfamily:IPR008925"
FT                   /inference="similar to AA sequence:SwissProt:P0A2K4"
FT                   /protein_id="ABX65972.1"
FT                   /translation="MKIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTD
FT                   LERSTPEAIEAIMDGMNWLNLEWDEGPYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKER
FT                   LEQLREDQMAKGEKPRYDGRCRHSHEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFS
FT                   NQELDDLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVP
FT                   MYAHVSMINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWSSGDQEIFTREE
FT                   MIKLFSLGAVSKSASAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQL
FT                   AELVKLLGERCKTLKEMAQSCRYFYEDFSEFDADAAKKHLRPVARQPLEVVRDKLSAIT
FT                   DWSAENVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERIN
FT                   KALGFIAERESQQ"
FT   gene            complement(515657..516049)
FT                   /locus_tag="SPAB_00544"
FT   CDS_pept        complement(515657..516049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00544"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09785 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65973"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR010749"
FT                   /inference="protein motif:superfamily:IPR009061"
FT                   /inference="similar to AA sequence:INSD:AAV76454.1"
FT                   /protein_id="ABX65973.1"
FT                   /translation="MKRLRSKMTTEELAECLGVARQTVNRWIREQHWKTEKFPGVKGGR
FT                   ARLIHIDASVREFILNIPAFRKLPAFYQAEEAFAEYANAAHSHAYRQIIDAVENMSAQE
FT                   QEKLALFLSREGIRGFLTRLGINEAD"
FT   gene            complement(516051..516398)
FT                   /locus_tag="SPAB_00545"
FT   CDS_pept        complement(516051..516398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1823 0.0090 tail-specific protease
FT                   K03797; COG: NOG09771 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65974"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR010749"
FT                   /inference="protein motif:superfamily:IPR009061"
FT                   /inference="similar to AA sequence:INSD:AAL21311.1"
FT                   /protein_id="ABX65974.1"
FT                   /translation="MTPEELANLTGYSRQTINKWVRKEGWATSPKPGVQGGKARLVHVN
FT                   EQVREYIRSAERSVDHHADTFTPASNASLEALLMTLAKEMTSSEQKQFTSLLVREGITG
FT                   LLQRLGIRDSK"
FT   gene            516635..516707
FT                   /locus_tag="SPAB_00546"
FT   tRNA            516635..516707
FT                   /locus_tag="SPAB_00546"
FT                   /product="tRNA-Ala"
FT   gene            516753..516825
FT                   /locus_tag="SPAB_00547"
FT   tRNA            516753..516825
FT                   /locus_tag="SPAB_00547"
FT                   /product="tRNA-Ala"
FT   gene            517019..519208
FT                   /locus_tag="SPAB_00548"
FT   CDS_pept        517019..519208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00548"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3829 1.1e-22 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s) K01745;
FT                   COG: COG2199 FOG: GGDEF domain; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65975"
FT                   /inference="protein motif:HMMPfam:IPR000160"
FT                   /inference="protein motif:HMMPfam:IPR001633"
FT                   /inference="protein motif:HMMPfam:IPR007895"
FT                   /inference="protein motif:HMMSmart:IPR000160"
FT                   /inference="protein motif:HMMSmart:IPR001633"
FT                   /protein_id="ABX65975.1"
FT                   /translation="MPDKCNVLKNIKIFLLAFCLTVPAILLSRLISPRATIDSSYIFLA
FT                   WLPLCVMFSVLFLFGRRGVAPMVGGMMLTNEWNFHLPLPQAMVLLFCQTFPVLLVCAIV
FT                   RWQLGARWRYGIPNQGIWLRVFWLGLMTPFGIKISMHLAGHYLAFPVTISTFFGTGTAI
FT                   FSIVDLLSLISAALIFTLFFYYPLRMIVSPHYMRIFWRRDVAPYLAKEKRLFTLLWFAT
FT                   LATLLAVLCTPFETKYIAGYLVPVLFIGFTIGVGKISYPLLNFSWALTALFLLSYNRNF
FT                   LQGVGSEYSLAFILSVLISFSICLLYMARINQRSEWLNRQWHSQALTDPLTQLPNLRAL
FT                   EQFLLQDAGQSVCYLRMENLEFLSRHYGMQMRVHCEREVFRMLQPLLLEKEKIFHLPGS
FT                   ELLLVLTGPETEARLQYMLNVLNNRKIYWNNTGLDMEYGASWGTFDGRQETLQPLLGQL
FT                   SWLAEQSCSHRRVLALTQSIEAASGQTTERVLRLQKIRQALERGALVLYAQPIRDAQGK
FT                   GYDEILTRLRCDDGIMMPNQFIPLIAQFNLSIRFDMQVMEALLQWLSAHPSAEQGARFS
FT                   VNLMPLTLLQKETASRIMQLFKRYGVPPASVIIEITEEQAFSHSEISMHNINQLRKFGL
FT                   KIAIDDFGTGYANYERLKRLKADIIKIDGCFVKDILTDSLDAMIVKSITDLAKAKSLSV
FT                   VAEFVETPAQRDLLLQLGVHSLQGYLIGRPRPLGK"
FT   gene            complement(519261..520463)
FT                   /locus_tag="SPAB_00549"
FT   CDS_pept        complement(519261..520463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00549"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1972 Nucleoside permease; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65976"
FT                   /inference="protein motif:BlastProDom:IPR008276"
FT                   /inference="protein motif:HMMPanther:IPR008276"
FT                   /inference="protein motif:HMMPfam:IPR002668"
FT                   /inference="protein motif:HMMPfam:IPR011642"
FT                   /inference="protein motif:HMMPfam:IPR011657"
FT                   /inference="protein motif:HMMTigr:IPR008276"
FT                   /inference="similar to AA sequence:INSD:AAL21309.1"
FT                   /protein_id="ABX65976.1"
FT                   /translation="MDRVLHFVLALAVVAVLALLVSSDRKKIRIRYVIQLLVIEVLLAW
FT                   FFLNSDVGLGFVKGFSEMFEKLLGFANEGTNFVFGSMNDQGLAFFFLKVLCPIVFISAL
FT                   IGILQHIRVLPVVIRAIGFLLSKVNGMGKLESFNAVSSLILGQSENFIAYKDILGKMSR
FT                   NRMYTMAATAMSTVSMSIVGAYMTMLDPKYVVAALVLNMFSTFIVLSLINPYVVDASEE
FT                   NIQMSNLHEGQSFFEMLGEYILAGFKVAIIVAAMLIGFIALIAALNALFATVTGWFGYS
FT                   ISFQGILGYIFYPVAWVMGVPSSEALQVGSIMATKLVSNEFVAMMDLQKIASTLSPRAE
FT                   GIISVFLVSFANFSSIGIIAGAIKGLNEEQGNVVSRFGLKLVYGSTLVSVLSASIAALV
FT                   L"
FT   gene            complement(520718..520852)
FT                   /locus_tag="SPAB_00550"
FT   CDS_pept        complement(520718..520852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65977"
FT                   /protein_id="ABX65977.1"
FT                   /translation="MRAARPLLFSTRLSVIFCLKNIAFAMFHAMFIDNDYQVHFNGYG"
FT   gene            520869..522047
FT                   /locus_tag="SPAB_00551"
FT   CDS_pept        520869..522047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00551"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1914 Mn2+ and Fe2+ transporters of the NRAMP
FT                   family; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65978"
FT                   /inference="protein motif:BlastProDom:IPR001046"
FT                   /inference="protein motif:FPrintScan:IPR001046"
FT                   /inference="protein motif:HMMPanther:IPR001046"
FT                   /inference="protein motif:HMMPfam:IPR001046"
FT                   /inference="protein motif:HMMTigr:IPR001046"
FT                   /inference="protein motif:superfamily:IPR008928"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461349.1"
FT                   /protein_id="ABX65978.1"
FT                   /translation="MGPAFIAAIGYIDPGNFATNIQAGASFGYQLLWVVVWANLMAMLI
FT                   QILSAKLGIATGKNLAEQIRDHYPRPVVWFYWVQAEIIAMATDLAEFIGAAIGFKLILG
FT                   VSLLQGAVLTGIATFLILMLQRRGQKPLEKVIGGLLLFVAAAYIVELFFSQPDMAQLGK
FT                   GMVIPALPNPEAVFLAAGVLGATIMPHVIYLHSSLTQHLHGGTRQQRYSATKWDVAIAM
FT                   TIAGFVNLAMMATAAAAFHFSGHTGIADLDQAYLTLEPLLSHAAATVFGLSLVAAGLSS
FT                   TVVGTLAGQVVMQGFVRFHIPLWVRRTITMLPSFIVILMGLDPTRILVMSQVLLSFGIA
FT                   LALVPLLIFTSNATLMGELVNTRRVKQVGWIIVVLVVALNIWLLVGTVMGLS"
FT   gene            complement(522108..522434)
FT                   /locus_tag="SPAB_00552"
FT   CDS_pept        complement(522108..522434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vpa:VP2751 0.00027 penicillin-binding protein
FT                   1A K05366; COG: NOG09770 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65979"
FT                   /inference="similar to AA sequence:INSD:AAL21307.1"
FT                   /protein_id="ABX65979.1"
FT                   /translation="MFRSLILAAALLAFTPLAANAGEITLLPSIKLQIGDRDDYGNYWD
FT                   GGRWRDRDYWHNHYEWRKNRWWRHDNGYHRGWDKRKAYERGYREGWRDRDDHRGRGRGH
FT                   KHHH"
FT   gene            complement(522548..523546)
FT                   /locus_tag="SPAB_00553"
FT   CDS_pept        complement(522548..523546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02454 2.4e-107 probable
FT                   oxidoreductase protein K05882; COG: COG0667 Predicted
FT                   oxidoreductases (related to aryl-alcohol dehydrogenases);
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00553"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65980"
FT                   /inference="protein motif:BlastProDom:IPR001395"
FT                   /inference="protein motif:Gene3D:IPR001395"
FT                   /inference="protein motif:HMMPanther:IPR001395"
FT                   /inference="protein motif:HMMPanther:IPR005399"
FT                   /inference="protein motif:HMMPfam:IPR001395"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217396.1"
FT                   /protein_id="ABX65980.1"
FT                   /translation="MIYQPDENRYHTMEYRRCGRSGVKLPAISLGLWHNFGDATRVENS
FT                   RALLQRAFDLGITHFDLANNYGPPPGSAECNFGRILQEDFLPWRDELIISTKAGYTMWD
FT                   GPYGDWGSRKYLIASLDQSLKRMGLEYVDIFYHHRPDPETPLKETMKALDHLVRQGKAL
FT                   YVGISNYPADLARQAIDILEDLSTPCLIHQPKYSLFERWVEDGLLALLQEKGVGSIAFS
FT                   PLAGGQLTDRYLNGIPEDSRAASGSRFLKPEQITADKLEKVRRLNELAARRGQKLSQMA
FT                   LAWVLRNDNVTSVLIGASKPSQIEDAVGMLANRRFSAAECAEIDAILEGRF"
FT   gene            complement(523543..523653)
FT                   /locus_tag="SPAB_00554"
FT   CDS_pept        complement(523543..523653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65981"
FT                   /protein_id="ABX65981.1"
FT                   /translation="MKAWKTMFTAANSKSRIPPGECNRIHYLFTPQGERS"
FT   gene            523726..525378
FT                   /locus_tag="SPAB_00555"
FT   CDS_pept        523726..525378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2405 3.8e-297 indolepyruvate
FT                   decarboxylase K01568; COG: COG3961 Pyruvate decarboxylase
FT                   and related thiamine pyrophosphate-requiring enzymes; Psort
FT                   location: CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65982"
FT                   /inference="protein motif:HMMPfam:IPR011766"
FT                   /inference="protein motif:HMMPfam:IPR012000"
FT                   /inference="protein motif:HMMPfam:IPR012001"
FT                   /inference="protein motif:HMMPIR:IPR012110"
FT                   /inference="protein motif:ScanRegExp:IPR000399"
FT                   /inference="protein motif:ScanRegExp:IPR000408"
FT                   /inference="similar to AA sequence:INSD:CAC48239.1"
FT                   /protein_id="ABX65982.1"
FT                   /translation="MQNPYTVADYLLDRLAGCGIGHLFGVPGDYNLQFLDHVIDHPTLR
FT                   WVGCANELNAAYAADGYARMSGAGALLTTFGVGELSAINGIAGSYAEYVPVLHIVGAPC
FT                   SAAQQRGELMHHTLGDGDFRHFYRMSQAISAASAILDEQNACFEIDRVLGEMLAARRPG
FT                   YIMLPADVAKKTAIPPTQALALPVHEAQSGVETAFRYHARQCLMNSRRIALLADFLAGR
FT                   FGLRPLLQRWMAETPIAHATLLMGKGLFDEQHPNFVGTYSAGASSKEVRQAIEDADRVI
FT                   CVGTRFVDTLTAGFTQQLPAERTLEIQPYASRIGETWFNLPMAQAVSTLRELCLECAFA
FT                   PPPTRSAGQPVRIDKGELTQESFWQTLQQYLKPGDIILVDQGTAAFGAAALSLPDGAEV
FT                   VVQPLWGSIGYSLPAAFGAQTACPDRRVILIIGDGAAQLTIQEMGSMLRDGQAPVILLL
FT                   NNDGYTVERAIHGAAQRYNDIASWNWTQIPPALNAAQQAECWRVTQAIQLAEVLERLAR
FT                   PQRLSFIEVMLPKADLPELLRTVTRALEARNGG"
FT   gene            complement(525398..526633)
FT                   /locus_tag="SPAB_00556"
FT   CDS_pept        complement(525398..526633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00556"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpr:CPR_1400 3.5e-09 chloride channel protein
FT                   K01529; COG: COG0038 Chloride channel protein EriC; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65983"
FT                   /inference="protein motif:HMMPanther:IPR001807"
FT                   /inference="protein motif:HMMPfam:IPR001807"
FT                   /inference="similar to AA sequence:INSD:AAL21304.1"
FT                   /protein_id="ABX65983.1"
FT                   /translation="MFHPRARTMLLLSLPALIIGVASSLVLIAAMKVASVFQQFLWQRL
FT                   PTSIGIAYDSLFWIVGMLTLTGIVVGLIIRYSPGHAGPDPAIEPLISMPVSPSALPGLL
FT                   LALIIGLAGGVSLGPEHPIMTINIALAAAFGSRLFPRITALDWTILASAGTIGALFGTP
FT                   VAAALIFSQTLSGSNDIPMWDRLFAPLMAAAAGSLTTSLFFHPHFSLPIAHYTQMRLVD
FT                   IASGAIVAAIAIAAGMVAVWCLPRLHELLHRLKNPVLILGIGGFILGILGVIGGPLTLF
FT                   KGLDEMQQMAFSQTLGAGDYFTLAVVKLAALVIAAASGFRGGRIFPAVFIGAALGLMLH
FT                   AHVEAVPAAITVSCAILGLVLVVTRDGWLSLFMAAVVVPDTNLLPLLCIVMLPAWLLLA
FT                   GKPLLAANRHEP"
FT   gene            526837..527802
FT                   /locus_tag="SPAB_00557"
FT   CDS_pept        526837..527802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2403 7.7e-173 glk; glucokinase K00845;
FT                   COG: COG0837 Glucokinase; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65984"
FT                   /db_xref="GOA:A9N432"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N432"
FT                   /inference="protein motif:HMMPfam:IPR003836"
FT                   /inference="protein motif:HMMTigr:IPR003836"
FT                   /inference="similar to AA sequence:SwissProt:Q5PNF2"
FT                   /protein_id="ABX65984.1"
FT                   /translation="MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVV
FT                   RVYLDEHSVSVEDGCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAV
FT                   SMAIPMLKKEHLIQFGGGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDF
FT                   APNSEEEAMILEILRAEIGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERA
FT                   LADSCIDCRRALSLFCVIMGRFGGDLALTMGTFGGVYIAGGIVPRFLEFFKASGFRGGF
FT                   EDKGRFKDYIHGIPVYLIVHDNPGLLGSGAHLRQTLGHIL"
FT   gene            528030..528176
FT                   /locus_tag="SPAB_00558"
FT   CDS_pept        528030..528176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00558"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65985"
FT                   /protein_id="ABX65985.1"
FT                   /translation="MSWRLVRRKQGFILLYVSGSLPYLRFHRGILLERILIFGEMSLKN
FT                   TAI"
FT   gene            528525..529763
FT                   /locus_tag="SPAB_00559"
FT   CDS_pept        528525..529763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00559"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2402 4.5e-223 yfdZ; putative
FT                   aminotransferase; COG: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65986"
FT                   /inference="protein motif:HMMPfam:IPR004839"
FT                   /inference="similar to AA sequence:INSD:AAX66311.1"
FT                   /protein_id="ABX65986.1"
FT                   /translation="MADFRPERRFTRIDRLPPYVFNITAELKMAARRRGEDIIDFSMGN
FT                   PDGATPPHIVEKLCTVAQRPDTHGYSTSRGIPRLRRAISHWYQERYDVDIDPETEAIVT
FT                   IGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVEGVDFFNELER
FT                   AIRESYPKPKMMILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVYDGWK
FT                   APSIMQVPGARDVAVEFFTLSKSYNMAGWRIGFMVGNKTLVSALARIKSYHDYGTFTPL
FT                   QVAAIAALEGDQQCVRDIAEQYKRRRDVLVKGLHEAGWMVEMPKASMYVWAKIPEQYAA
FT                   MGSLEFAKKLLNEAKVCVSPGIGFGDYGDTHVRFALIENRDRIRQAVRGIKAMFRADGV
FT                   LPSHPKPVEASTE"
FT   gene            complement(530050..530172)
FT                   /locus_tag="SPAB_00560"
FT   CDS_pept        complement(530050..530172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65987"
FT                   /protein_id="ABX65987.1"
FT                   /translation="MSAASLNSDSSLSEIKLSPIPDTCKLLKVNKKMPLVSPHF"
FT   gene            complement(530287..531207)
FT                   /locus_tag="SPAB_00561"
FT   CDS_pept        complement(530287..531207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_2404 4.5e-152 putative acyltransferase
FT                   K00680; COG: COG1560 Lauroyl/myristoyl acyltransferase;
FT                   Psort location: CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65988"
FT                   /inference="protein motif:HMMPfam:IPR004960"
FT                   /inference="protein motif:HMMTigr:IPR011920"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456943.1"
FT                   /protein_id="ABX65988.1"
FT                   /translation="MFPQSKFSRAFLHPRYWLTWFGVGVLWLLVQLPYPVLRFLGTRTG
FT                   KLARPFLKRRESIAQKNIELCFPTLSREEREKLIAENFHSLGMALLETGMAWFWPDSRV
FT                   RKWFDVDGLDNLTRAQAQNRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNPLMEW
FT                   VQTRGRMRSNKAMIGRNNLRGIVGALKKGEAVWFAPDQDYGPKGSSFAPFFAVENVATT
FT                   NGTYVLSRLSGAAMLTVTMVRKSDNSGYRLYITPEMEGYPADENQAAAYMNKIIEKEIM
FT                   RAPEQYLWIHRRFKTRPLGEASLYI"
FT   gene            531455..531568
FT                   /locus_tag="SPAB_00562"
FT   CDS_pept        531455..531568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65989"
FT                   /protein_id="ABX65989.1"
FT                   /translation="MYHQLFTRAQKFFIKKRKYFSRSKNKLIIIFNALFLQ"
FT   gene            531729..531971
FT                   /locus_tag="SPAB_00563"
FT   CDS_pept        531729..531971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00563"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13898 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00563"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65990"
FT                   /inference="similar to AA sequence:INSD:AAL21300.1"
FT                   /protein_id="ABX65990.1"
FT                   /translation="MIYLWTFLAISILAVSGYIGQVMGAFSAVSSFTGMVILAALIYLL
FT                   NVWLQDGDDIVSGLLLFLAPACGLIIRFMVGYGKR"
FT   gene            complement(532210..533601)
FT                   /locus_tag="SPAB_00564"
FT   CDS_pept        complement(532210..533601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptr:463007 0.0058 VNN2, LOC463007; vanin 2
FT                   K01463; COG: COG2271 Sugar phosphate permease; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00564"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65991"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="protein motif:HMMTigr:IPR000849"
FT                   /inference="protein motif:ScanRegExp:IPR000849"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217387.1"
FT                   /protein_id="ABX65991.1"
FT                   /translation="MLTILKTGQSAHKVPPEKVQATYGRYRIQALLSVFLGYLAYYIVR
FT                   NNFTLSTPYLKEQLDLSATQIGLLSSCMLIAYGISKGVMSSLADKASPKVFMACGLVLC
FT                   AIVNVGLGFSSAFWIFAALVVFNGLFQGMGVGPSFITIANWFPRRERGRVGAFWNISHN
FT                   VGGGIVAPIVGAAFAILGSEHWQSASYIVPACVAVIFALIVLVLGKGSPREEGLPSLEQ
FT                   MMPEEKVILKTKNTAKAPENMSAWQIFCTYVLRNKNAWYISLVDVFVYMVRFGMISWLP
FT                   IYLLTVKHFSKEQMSVAFLFFEWAAIPSTLLAGWLSDKLFKGRRMPLAMICMALIFVCL
FT                   IGYWKSESLLMVTIFAAIVGCLIYVPQFLASVQTMEIVPSFAVGSAVGLRGFMSYIFGA
FT                   SLGTSLFGVMVDKLGWYGGFYLLMGGIVCCILFCYLSHRGALELERQRQNALHNQDSLQ
FT                   LADAQ"
FT   gene            533733..533993
FT                   /locus_tag="SPAB_00565"
FT   CDS_pept        533733..533993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00565"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65992"
FT                   /inference="protein motif:ScanRegExp:IPR005829"
FT                   /protein_id="ABX65992.1"
FT                   /translation="MTHPEGCGETLIIGMAVLSLACADINKFAASDLIRFIDVFGRRTR
FT                   YYSNNVVLDANRNKRVSFVSIFSLCDIDIYERDHKSTFLML"
FT   gene            complement(533937..534149)
FT                   /locus_tag="SPAB_00567"
FT   CDS_pept        complement(533937..534149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65994"
FT                   /protein_id="ABX65994.1"
FT                   /translation="MTEPGSVCQRWIIQAVALGEKVVAITSSRLYAWQEPNIAASHSVK
FT                   APTLAKRLQHEKSRFVIPFINIDIT"
FT   gene            534007..535230
FT                   /locus_tag="SPAB_00566"
FT   CDS_pept        534007..535230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00566"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1840 ABC-type Fe3+ transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00566"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65993"
FT                   /inference="protein motif:BlastProDom:IPR011587"
FT                   /inference="protein motif:HMMPfam:IPR006059"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217386.1"
FT                   /protein_id="ABX65993.1"
FT                   /translation="MGAFTLWLAAMFGSCQAYSRELVMATTFSPSATAWIIQRWQTEPG
FT                   SVMIRTLNRTSGSLEQLLDTANAENVDLILTSSPMLLQHLQEHQKLALLDSAPAASQKL
FT                   VPRSIRSTSVAVAVSGFGLLINRSALAARHLPPPADWQDMGLPSYQGALLMSSPSRSDT
FT                   NHLMVESLLQQKGWTAGWATLLAISGNLVTISSRSFGVADKIKSGLGVAGPVIDNYANL
FT                   LLNDPNLAFTYFPYSAVSPTYVAVLKNSRHADEARAFIHYLLSPKGQRILADANTGKYP
FT                   VAPLSADNPRAAQQQRLMALPPLNYRLILKRQQLVQRMFDTAISFRLAQLKDAWRALHS
FT                   AETRLKRPLPEIRALLTSVPVDAASSEDETWLAQFDNKSFAEQKMMEWQIWFLNNQRLA
FT                   IHKLEELK"
FT   gene            535227..537233
FT                   /locus_tag="SPAB_00568"
FT   CDS_pept        535227..537233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00568"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2397 0. pgtB; Phosphoglycerate
FT                   transport: protein for signal transmission K08475; COG:
FT                   COG4192 Signal transduction histidine kinase regulating
FT                   phosphoglycerate transport system; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00568"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65995"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMPfam:IPR003661"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR003660"
FT                   /inference="protein motif:HMMSmart:IPR003661"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="protein motif:superfamily:IPR009082"
FT                   /protein_id="ABX65995.1"
FT                   /translation="MKGRLLQRLRQLSISNSLRGAFLTGALLTLIVSMVSLYSWHEQSS
FT                   QVRYSLDEYFPRIHSAFLIEGNLNLAVDQLNEFLLAPNTTVRLQLRTQIIQHLDKIERL
FT                   SQGLQLAERRQLAVILQDSRTLLAELDNALYNMFLVREKVSELSARIDWLHDDFTTELN
FT                   SLVQDFTWQQGTLLDQIEANQGDAAQYLQRSREVQNEQQQVYTLARIENQIVDDLRDRL
FT                   NELKSGNNDGMLVETHIRYLENLKKTADENIRALDDWPSTITLRQTIDELLEIGMVKNK
FT                   MPDTMRDYVAAQKALLDASRAREATLGRFRTLLEAQLGSSHQQMQTFNQRLEQIVRVSG
FT                   GLILVATLLALLLAWGLNHYFIRSRLVKRFTALNQAVVQIGLGRTDSTIPVYGRDELGR
FT                   IARLLRHTLGQLNMQRRQLEQEVAERKEIEADLRAMQDELIQTAKLAVVGQTMTTLAHE
FT                   INQPLNALSMYLFTAGRAIEQGQSGQARNTLTKAEGLINRIDAIIRSLRQFTRRAELET
FT                   PLYPVDLRQTFVAAWELLAMRHQSRQGALSLPTDTVWVSGDEVRIQQVLVNVLANALDA
FT                   CSHDAVIAVTWQTQGEALEVYIADNGPGWPVALLPSLLKPFTTSKAVGLGIGLSISVSL
FT                   MAQMKGDLRLASTLTRNACVVLQFSVTDVDDVE"
FT   gene            537223..538470
FT                   /locus_tag="SPAB_00569"
FT   CDS_pept        537223..538470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00569"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bms:BR1115 5.2e-32 ntrX; nitrogen regulation
FT                   protein NtrX; COG: COG2204 Response regulator containing
FT                   CheY-like receiver, AAA-type ATPase, and DNA-binding
FT                   domains; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65996"
FT                   /inference="protein motif:BlastProDom:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR002078"
FT                   /inference="protein motif:HMMPfam:IPR002197"
FT                   /inference="protein motif:HMMSmart:IPR001789"
FT                   /inference="protein motif:ScanRegExp:IPR002078"
FT                   /inference="protein motif:superfamily:IPR008931"
FT                   /inference="protein motif:superfamily:IPR011006"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461337.1"
FT                   /protein_id="ABX65996.1"
FT                   /translation="MLNDECSILLIDDDVDVLDAYTQMLEQAGYRVRGFTHPFEAKEWV
FT                   KADWEGIVLSDVCMPGCSGIDLMTLFHQDDDQLPILLITGHGDVPMAVDAVKKGAWDFL
FT                   QKPVDPGKLLILIEDALRQRRSVIARRQYCQQTLQVELIGRSEWMNQFRQRLQQLAETD
FT                   IAVWFYGEHGTGRMTGARYLHQLGRNAKGPFVRYELTPENAGQLETFIDQAQGGTLVLS
FT                   HPEYLTREQQHHLARLQSLEHRPFRLVGVGSASLVEQAAANQIAAELYYCFAMTQIACQ
FT                   SLSQRPDDIEPLFRHYLRKACLRLNHPVPEIAGELLKGIMRRAWPSNVRELANAAELFA
FT                   VGVLPLAETVNPQLLLQEPSPLDRRVEEYERQIITEALNIHQGRINEVAEYLQIPRKKL
FT                   YLRMKKYGLSKEHYKF"
FT   gene            538738..539676
FT                   /locus_tag="SPAB_00570"
FT   CDS_pept        538738..539676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2396 1.8e-171 pgtE; phosphoglycerate
FT                   transport: outer membrane protein E K08477; COG: COG4571
FT                   Outer membrane protease; Psort location: OuterMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65997"
FT                   /inference="protein motif:BlastProDom:IPR000036"
FT                   /inference="protein motif:HMMPfam:IPR000036"
FT                   /inference="protein motif:ScanRegExp:IPR000036"
FT                   /inference="protein motif:ScanRegExp:IPR002048"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217383.1"
FT                   /protein_id="ABX65997.1"
FT                   /translation="MKKHAIAVMMIAIFSESVYAESTLFIPDVSPDSVTTSLSVGVLNG
FT                   KSRELVYDTDTGRKISQLDWKIKNVATLQGDLSWEPYSFMTLDARGWTSLASGSGYMVD
FT                   HDWMSSEQPGWTDRSIHPDTSANYANEYDLNVKGWLLQGDNYKAGVTAGYQETRFSWTA
FT                   RGGSYIYDNGRYIGNFPHGVRGIGYSQRFEMPYIGLAGDYRINDFECNVLFKYSDWVNA
FT                   HDNDEHYMRKLTFREKTENSRYYGASIDAGYYITSNAKIFAEFAYSKYEEGKGGTQIID
FT                   KTSGDTAYFGGDAAGIANNNYTVTAGLQYRF"
FT   gene            complement(539836..539907)
FT                   /locus_tag="SPAB_00571"
FT   tRNA            complement(539836..539907)
FT                   /locus_tag="SPAB_00571"
FT                   /product="tRNA-Arg"
FT   gene            complement(539983..540924)
FT                   /locus_tag="SPAB_00572"
FT   CDS_pept        complement(539983..540924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00572"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_4690 1.1e-09 formate transporter
FT                   K00122; COG: COG2116 Formate/nitrite family of
FT                   transporters; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00572"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65998"
FT                   /inference="similar to AA sequence:INSD:CAD07625.1"
FT                   /protein_id="ABX65998.1"
FT                   /translation="MDSLNDDKINRHSSDLEVESEEKQSGKEIEVDEDRLPSRAMAIHE
FT                   HIRQDGEKEMERDAMALLWSAIAAGLSMGASLLAKGIFHVQLEGVPGGFLLENLGYTFG
FT                   FIIVIMARQQLFTENTVTAVLPVMQNPTLSNVGLLMRLWGVVLLGNLIGTGVAAWAFEY
FT                   MPIFDEETRDAFVKIGMEVMKNSPTEMFANAIISGWIIATMVWMFPAAGRAKIVVIILM
FT                   TWLIALGDTTHIVVGSVEILYLVFNGTLPWSDFLWPFALPTLAGNICGGTFIFALMSHA
FT                   QIRNDMSNKRKEEARLRGERLERERKKAEKQR"
FT   gene            541213..541968
FT                   /locus_tag="SPAB_00573"
FT   CDS_pept        541213..541968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00573"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2853 Surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ABX65999"
FT                   /inference="protein motif:FPrintScan:IPR007428"
FT                   /inference="protein motif:HMMPfam:IPR007428"
FT                   /inference="similar to AA sequence:INSD:AAV76474.1"
FT                   /protein_id="ABX65999.1"
FT                   /translation="MKLRLSALALGTTLLVGCASSGTEQQGRSDPFEGFNRTMYNFNFN
FT                   VLDPYVVRPVAVAWRDYVPQPARNGLSNFTGNLEEPAIMVNYFLQGDPYQGMVHFTRFF
FT                   LNTLLGMGGFIDVAGMANPKLQRVEPHRFGSTLGHYGVGYGPYMQLPFYGSFTLREDGG
FT                   DMADTLYPVLSWLTWPMSIGKWTIEGIETRAQLLDSDGLLRQSSDPYIMVREAYFQRHD
FT                   FIANGGKLKPQENPNAQAIQDELKEIDSE"
FT   gene            complement(542029..543336)
FT                   /locus_tag="SPAB_00575"
FT   CDS_pept        complement(542029..543336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00575"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2067 Long-chain fatty acid transport
FT                   protein; Psort location: OuterMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66001"
FT                   /inference="protein motif:HMMPfam:IPR005017"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461333.1"
FT                   /protein_id="ABX66001.1"
FT                   /translation="MSQKTLFTKSALAVAVAIISTQAWSAGFQLNEFSSSGLGRAYSGE
FT                   GAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSRRTLDADNIAPTAWV
FT                   PNVHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNE
FT                   AWSFGLGFDAVYARAKIERFAGDLGQLVAAQNPALAPVAGQIPSDTKIAHLNGNQWGFG
FT                   WNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLPIAINRFNLPIPTATGGATQSGYL
FT                   TLNLPEMWEVSGYNRVAPQWAIHYSLAYTSWSQFQELKAKSTAGDTLFEKHEGFKDAYR
FT                   IALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDV
FT                   GVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF"
FT   gene            543335..543463
FT                   /locus_tag="SPAB_00574"
FT   CDS_pept        543335..543463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66000"
FT                   /protein_id="ABX66000.1"
FT                   /translation="MTITSLIIFIQTMLHAVTGARSVGSAVRLRNQTSGESIGLTS"
FT   gene            complement(543460..543600)
FT                   /locus_tag="SPAB_00576"
FT   CDS_pept        complement(543460..543600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66002"
FT                   /protein_id="ABX66002.1"
FT                   /translation="MTEITLKNDLKQKSRDRVTVKPADFASQISFLRSQLKKLINILAT
FT                   F"
FT   gene            543707..543991
FT                   /locus_tag="SPAB_00577"
FT   CDS_pept        543707..543991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00577"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3691 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66003"
FT                   /inference="protein motif:HMMPfam:IPR005272"
FT                   /inference="protein motif:HMMTigr:IPR005272"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456931.1"
FT                   /protein_id="ABX66003.1"
FT                   /translation="MSKCSADETPVCCCMDVGTIMDNSDCTASYSRVFATRAEAEGTLA
FT                   ALTEKARSVESEPCQITPTFTEESEGVRLDIDFVFACEAETLIFQLGLR"
FT   gene            544169..545479
FT                   /locus_tag="SPAB_00578"
FT   CDS_pept        544169..545479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00578"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0475 7.2e-225 putative 3-ketoacyl-CoA
FT                   thiolase K00632; COG: COG0183 Acetyl-CoA acetyltransferase;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00578"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66004"
FT                   /db_xref="GOA:A9N452"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012806"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N452"
FT                   /inference="protein motif:HMMPanther:IPR002155"
FT                   /inference="protein motif:HMMPfam:IPR002155"
FT                   /inference="protein motif:HMMTigr:IPR002155"
FT                   /inference="protein motif:HMMTigr:IPR012806"
FT                   /inference="protein motif:ScanRegExp:IPR002155"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456930.1"
FT                   /protein_id="ABX66004.1"
FT                   /translation="MRQALPLVTRQGDRIAIVSGLRTPFARQATAFHGIPAVDLGKMVV
FT                   GELLARSEIPADAIEQLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQ
FT                   AVANVAESLMAGTIRAGIAGGADSSSVLPIGVSKALARVLVDGNKARTTRQRLTLFSRL
FT                   RLRDLLPVPPAVAEYSTGLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWAEGKL
FT                   AEEVMTTYVPPYKNPFAEDNNIRGASTLADYAKLRPAFDRKHGSVTAANSTPLTDGAAA
FT                   VIMMTESRAKELGLRPLGYLRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTMADLTLF
FT                   DMHEAFAAQTLANLQLLGSERFAREVLGRAQATGEVDDAKFNVLGGSIAYGHPFAATGA
FT                   RMITQTLHELRRRGGGFGLVTACAAGGLGAAMVLEAE"
FT   gene            545479..547626
FT                   /locus_tag="SPAB_00579"
FT   CDS_pept        545479..547626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2388 0. yfcX; enoyl-CoA hydratase /
FT                   3-hydroxyacyl-CoA dehydrogenase / 3-hydroxybutyryl-CoA
FT                   epimerase K00022:K01692:K01782; COG: COG1250
FT                   3-hydroxyacyl-CoA dehydrogenase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00579"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66005"
FT                   /db_xref="GOA:A9N453"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012802"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N453"
FT                   /inference="protein motif:Gene3D:IPR006108"
FT                   /inference="protein motif:HMMPfam:IPR001753"
FT                   /inference="protein motif:HMMPfam:IPR006108"
FT                   /inference="protein motif:HMMPfam:IPR006176"
FT                   /inference="protein motif:HMMTigr:IPR012802"
FT                   /inference="protein motif:ScanRegExp:IPR006180"
FT                   /inference="protein motif:superfamily:IPR008927"
FT                   /protein_id="ABX66005.1"
FT                   /translation="MTTTSAFMLNVRLDNVAVVAIDVPGEKVNTLKAEFAAQVRAILKQ
FT                   IRENKALQGVVFISAKADNFIAGADINMIGHCQNAQEAETLARQGQQLMAEIQALPVPV
FT                   IAAIHGACLGGGLEMALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVST
FT                   ALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELAKKERLAQRTLPVRERILAGP
FT                   LGRALLFRLVRKKTAQKTQGNYPATERIIDVIETGLAQGSSSGYDAEARAFGELAMTPQ
FT                   SQALRAIFFASTEVKKDPGSDAPPGPLNSVGILGGGLMGGGIAWVTACKGGLPVRIKDI
FT                   NTQGINHALKYSWDLLETKVRRRHIKASERDKQLALISGSTDYRGFSHRDLVIEAVFED
FT                   LPLKQQMVAEVEQNCAAHTIFASNTSSLPIGDIAANAARPEQVIGLHFFSPVEKMPLVE
FT                   VIPHASTSAQTIATTVKLAKKQGKTPIVVSDKAGFYVNRILAPYINEAIRMLTEGERVE
FT                   HIDAALVKFGFPVGPIQLLDEVGIDTGTKIIPVLEAAYGERFSAPANVVASILNDDRKG
FT                   RKNGRGFYLYGEKGRKSKKQVDPAIYKLIGVQGQSRLSAQQVAERCVMLMLNEAARCFD
FT                   EKVIRSARDGDIGAVFGIGFPPFLGGPFRYMDALGPGEMVATLQRLAALYGPRYAPCEQ
FT                   LVRMAERREHFWTNGETDQGN"
FT   gene            complement(547730..547858)
FT                   /locus_tag="SPAB_00580"
FT   CDS_pept        complement(547730..547858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66006"
FT                   /protein_id="ABX66006.1"
FT                   /translation="MTHDKNLHIAPLLLTSFTNTLTTCPYWLRQKCGGRHCALSIH"
FT   gene            547934..548320
FT                   /locus_tag="SPAB_00581"
FT   CDS_pept        547934..548320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00581"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2389 9.4e-65 sixA; phosphohistidine
FT                   phosphatase K08296; COG: COG2062 Phosphohistidine
FT                   phosphatase SixA; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66007"
FT                   /inference="protein motif:HMMTigr:IPR004449"
FT                   /inference="similar to AA sequence:INSD:AAX66295.1"
FT                   /protein_id="ABX66007.1"
FT                   /translation="MANWLKGQKVDIERVLVSPFLRAEQTLDVVGDCMNLPAQVDVLPE
FT                   LTPCGDVGLVSAYLQALVNEEIGSVLVISHLPLVGYLVSELCPGETPPMFTTSAIANVT
FT                   LDESGKGTFNWQMSPCNLKMAKAI"
FT   gene            548324..548428
FT                   /locus_tag="SPAB_00582"
FT   CDS_pept        548324..548428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66008"
FT                   /protein_id="ABX66008.1"
FT                   /translation="MLPDGASLIRPTTALAVRRLDKALAPPSGNSASG"
FT   gene            complement(548420..548971)
FT                   /locus_tag="SPAB_00583"
FT   CDS_pept        complement(548420..548971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00583"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2840 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00583"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66009"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR022990"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N457"
FT                   /inference="protein motif:HMMPfam:IPR002625"
FT                   /inference="protein motif:HMMSmart:IPR002625"
FT                   /inference="similar to AA sequence:INSD:CAD07618.1"
FT                   /protein_id="ABX66009.1"
FT                   /translation="MKKKTSLSEEDQALFRQLMVGTRKIKQDTIVHRPLRKKITEVPTR
FT                   RLIQEQADASHYFSDEFQPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLDLHGLT
FT                   QLQAKQELGALIAACRREHIFCACVMHGHGKHILKQQTPLWLAQHPHVMAFHQAPKEYG
FT                   GDAALLVLIEVEEWQPPELP"
FT   gene            complement(549074..550048)
FT                   /locus_tag="SPAB_00585"
FT   CDS_pept        complement(549074..550048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66011"
FT                   /inference="similar to AA sequence:INSD:CAE55836.1"
FT                   /protein_id="ABX66011.1"
FT                   /translation="MFTGREQLRFGQHKDAIAAVVKLQPGERHIRILLHQMYHAVSDFT
FT                   NQNAVIGQIIRRISQDTTGQFEAVSAGRQPQLRFVAIFVRQIGHILRIDIRRVSDNQIV
FT                   LNFRQIAEQIGTDWRHVMDKTVFFNVMLGDSQRIRRNIDRINLCVRESISTGDGDAAAA
FT                   GTHIQNIFRLLANKAGEVVINQLANGRTRHQHALIDIKFVAAEPGFIGQVGDRDTLVNA
FT                   TNHSLNNAVFFAGRQPRGPHIFRNIQRQIKRRQHQLYRFIPRVIGTVSIPDIRRAKAAY
FT                   RPAQHVLNGMQFTYCFIDENFIHVFLQGMLALNSAASLPRRQG"
FT   gene            549137..550069
FT                   /locus_tag="SPAB_00584"
FT   CDS_pept        549137..550069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00584"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2385 6.4e-169 yfcB; putative methylase
FT                   K07320; COG: COG2890 Methylase of polypeptide chain release
FT                   factors; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00584"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66010"
FT                   /inference="protein motif:HMMPfam:IPR013217"
FT                   /inference="protein motif:HMMTigr:IPR004556"
FT                   /inference="protein motif:ScanRegExp:IPR002052"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456926.1"
FT                   /protein_id="ABX66010.1"
FT                   /translation="MDKIFVDEAVSELHTIQDMLRWAVSRFSAANIWYGHGTDNPWDEA
FT                   VQLVLPSLYLPLDIPEDMRTARLTSSEKHRIVERVIRRINERIPVAYLTNKAWFCGHEF
FT                   YVDERVLVPRSPIGELINNHFAGLISQQPKYILDMCTGSGCIAIACAYAFPDAEVDAVD
FT                   ISPDALAVAEHNIEEHGLIHHVTPIRSDLFRDLPKVQYDLIVTNPPYVDAEDMSDLPNE
FT                   YRHEPELGLASGTDGLKLTRRILGNAPDYLSDDGVLICEVGNSMVHLMEQYPNVPFTWL
FT                   EFDNGGDGVFMLTKAQLLAAREHFNIYKD"
FT   gene            550105..551190
FT                   /locus_tag="SPAB_00586"
FT   CDS_pept        550105..551190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00586"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2386 2.4e-192 aroC; chorismate synthase
FT                   K01736; COG: COG0082 Chorismate synthase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00586"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66012"
FT                   /db_xref="GOA:A9N460"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N460"
FT                   /inference="protein motif:BlastProDom:IPR000453"
FT                   /inference="protein motif:HMMPfam:IPR000453"
FT                   /inference="protein motif:HMMTigr:IPR000453"
FT                   /inference="protein motif:ScanRegExp:IPR000453"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217373.1"
FT                   /protein_id="ABX66012.1"
FT                   /translation="MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDL
FT                   DRRRPGTSRYTTQRREPDQVKILSGVFDGVTTGTSIGLLIENTDQRSQDYSAIKDVFRP
FT                   GHADYTYEQKYGLRDYRGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDI
FT                   PLEIKDWRQVELNPFFCPDADKLDALDELMRALKKEGDSIGAKVTVMASGVPAGLGEPV
FT                   FDRLDADIAHALMSINAVKGVEIGEGFNVVALRGSQNRDEITAQGFQSNHAGGILGGIS
FT                   SGQHIVAHMALKPTSSITVPGRTINRAGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVL
FT                   MDHLLRHRAQNADVKTEIPRW"
FT   gene            551194..552018
FT                   /locus_tag="SPAB_00587"
FT   CDS_pept        551194..552018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00587"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2383 1.8e-150 mepA; murein
FT                   DD-endopeptidase, penicillin-insensitive K07261; COG:
FT                   COG3770 Murein endopeptidase; Psort location: Periplasmic,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00587"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66013"
FT                   /db_xref="GOA:A9N461"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N461"
FT                   /inference="protein motif:BlastProDom:IPR005073"
FT                   /inference="protein motif:HMMPfam:IPR005073"
FT                   /inference="protein motif:HMMPIR:IPR005073"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461325.1"
FT                   /protein_id="ABX66013.1"
FT                   /translation="MKKTAIALLAWFVSSASLAATPWQKITHPVPGAAQSIGSFANGCI
FT                   IGADTLPVQSDNYQVMRTDQRRYFGHPDLVMFIQRLSHQAQQRGLGTVLIGDMGMPAGG
FT                   RFNGGHASHQTGLDVDIFLQLPKTRWSQAQLLRPQALDLVSRDGKHVVPSRWSSDIASL
FT                   IKLAAQDNDVTRIFVNPAIKQQLCLDAGNDRDWLRKVRPWFQHRAHMHVRLRCPADSLE
FT                   CEDQPLPPPGDGCGAELQSWFEPPKLGTTKPEKKTPPPLPPSCQALLDEHVL"
FT   gene            552018..552827
FT                   /locus_tag="SPAB_00588"
FT   CDS_pept        552018..552827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00588"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0730 Predicted permeases; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00588"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66014"
FT                   /inference="protein motif:HMMPfam:IPR002781"
FT                   /inference="similar to AA sequence:INSD:AAV76484.1"
FT                   /protein_id="ABX66014.1"
FT                   /translation="MDNFYDLFMVSPLLLVVLFFVAVLAGFIDSIAGGGGLLTIPALMA
FT                   AGMSPANALATNKLQACGGSLSSSLYFIRRKVVNLAEQKLNILMTFIGSMSGALLVQHV
FT                   QADILRQILPILVIFIGLYFLLMPKLGEEDRQRRLYGLPFALIAGGCVGFYDGFFGPAA
FT                   GSFYALAFVTLCGYNLAKSTAHAKVLNATSNVGGLLLFIIGGKVIWATGFVMLVGQFLG
FT                   ARMGSRLVLSKGQKLIRPMIVIVSAVMSARLLYDSHGQEILHWLGMN"
FT   gene            552827..553375
FT                   /locus_tag="SPAB_00589"
FT   CDS_pept        552827..553375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00589"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3101 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00589"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66015"
FT                   /inference="protein motif:HMMPfam:IPR007411"
FT                   /inference="similar to AA sequence:INSD:AAL21282.1"
FT                   /protein_id="ABX66015.1"
FT                   /translation="MNNTHHYEQLIEIFNGCFAEEFNTRLIKGDDEPIYLPADAQVPYH
FT                   RIVFAHGFYASALHEISHWCIAGKARRELVDFGYWYCPDGRDAQTQSQFEDVEVKPQAF
FT                   DWLFCVAAGYPFNVSCDNLEGDIEPDRVAFQRRVHAQVMAYLEQGIPERPARFIKALQN
FT                   YYHTPELKAEQFPWPEALN"
FT   gene            553408..553683
FT                   /locus_tag="SPAB_00590"
FT   CDS_pept        553408..553683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00590"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13546 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66016"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456922.1"
FT                   /protein_id="ABX66016.1"
FT                   /translation="MIAEFESRILALIDDMVEHASDDELFASGYLRGHLTLAIAELESG
FT                   DDHSVEAVYANVSQSLEKAIGAGELSPRDQALVKAMWDNLFDKAKQ"
FT   gene            complement(553735..555735)
FT                   /locus_tag="SPAB_00591"
FT   CDS_pept        complement(553735..555735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF1701 1.5e-185 hypothetical protein
FT                   K00599; COG: COG0665 Glycine/D-amino acid oxidases
FT                   (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66017"
FT                   /db_xref="GOA:A9N465"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N465"
FT                   /inference="protein motif:HMMPfam:IPR006076"
FT                   /inference="protein motif:HMMPfam:IPR008471"
FT                   /protein_id="ABX66017.1"
FT                   /translation="MKQYAIQPATLEFNAEGTPVSRDFDDVYFSNDNGLEETRYVFLGG
FT                   NRLAERFPVHSHPLFIVAESGFGTGLNFLTLWQAFDSFRSAHPQATLQRLHFISFEKFP
FT                   LTRDDLALAHQHWPELAPWAEQLQAQWPLPLPGCHRLLLDRGRVTLDLWFGDINELTDQ
FT                   LDATLNQTVDAWFLDGFAPAKNPDMWTPNLFNAMARLARPGATLATFTSAGFVRRGLQE
FT                   AGFTMQKRKGFGRKREMLCGVMEQHLMPTLSAPWFYRSGSEKRETAIIGGGIASALLSL
FT                   ALLRRGWQVTLYCADDQPAQGASGNRQGALYPLLSKHDAAINRFFPTAFTFARRLYDAL
FT                   PVSFDHDWCGVTQLGWDEKSQQKIAQMLSLALPAELASALNAEEAEQAVGVTTRCGGIT
FT                   YPAGGWLCPEQLTRAVIALATEQGLQTRFRHTLTSLVAQESRWQLRFMSGETASHETVV
FT                   LANGHQINRFDQTRPLPVYAVGGQVSHIPTTPALSALRQVLCYDGYLTPQNPHNQQHCI
FT                   GASYHRGDESTVWREEDQRQNRQRLLDCFPDAKWATEVDVSGNSARCGVRCATRDHLPM
FT                   VGNVPDYHATLTHYADLADNKTSAAPAPVYPGLFMLGALGSRGLCSAPLCAEILAAQMS
FT                   NEPIPLDASTLAALNPNRLWVRKLLKGKAVK"
FT   gene            555895..557109
FT                   /locus_tag="SPAB_00592"
FT   CDS_pept        555895..557109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00592"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0486 4.1e-213 fabB;
FT                   3-oxoacyl-[acyl-carrier-protein] synthase I K00647; COG:
FT                   COG0304 3-oxoacyl-(acyl-carrier-protein) synthase; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00592"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66018"
FT                   /inference="protein motif:HMMPanther:IPR000794"
FT                   /inference="protein motif:HMMPfam:IPR000794"
FT                   /inference="protein motif:ScanRegExp:IPR000794"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149800.1"
FT                   /protein_id="ABX66018.1"
FT                   /translation="MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMR
FT                   SQVWGNVKLDTTGLIDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAG
FT                   SGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSAC
FT                   ATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTY
FT                   DAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM
FT                   QMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGV
FT                   QEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTERELTTVMSNSFGFGGTNATL
FT                   VMRKL"
FT   gene            557207..557863
FT                   /locus_tag="SPAB_00593"
FT   CDS_pept        557207..557863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00593"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1266 Predicted metal-dependent membrane
FT                   protease; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00593"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66019"
FT                   /inference="protein motif:HMMPfam:IPR003675"
FT                   /inference="similar to AA sequence:INSD:AAL21278.1"
FT                   /protein_id="ABX66019.1"
FT                   /translation="MPTNTLDKIRHSLSCVAVLFGLFGIFVFASFSPSYAWLYLGGLAA
FT                   PFIYSIVFVYAIAAWSIYSKYYPFLSLGRLSFVECFVPALALVCLTVLYNAFSGPEPWM
FT                   AELSRQFFLHKFLNTLAMCFLAPVAEEIIFRGFLLNSSIGWGRYSRASGIIITSLAFAF
FT                   MHTQYLFAVTFVYLFVFSSILCVVRMRSRGLMIPITLHILNNAWVVFGLLFSATE"
FT   gene            complement(557930..558448)
FT                   /locus_tag="SPAB_00594"
FT   CDS_pept        complement(557930..558448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00594"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG26784 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66020"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217365.1"
FT                   /protein_id="ABX66020.1"
FT                   /translation="MKTFSLVALILLLCSCSTPHHDSTQAVKQFYTSWMTTFTNDVNPP
FT                   DDTTALMQRYVAKEVILRLALIQSLYEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFL
FT                   GGEKVDVLLGTESTPIHLEVYTRWEEGRWKIYRVRDADRGYEQPIYDAGAITQAEAWSA
FT                   KVAPEYKKH"
FT   gene            complement(558448..558816)
FT                   /locus_tag="SPAB_00595"
FT   CDS_pept        complement(558448..558816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00595"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG18512 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66021"
FT                   /inference="similar to AA sequence:INSD:CAD07607.1"
FT                   /protein_id="ABX66021.1"
FT                   /translation="MSWDKRVAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHA
FT                   KDYGPMLRSAGFTAIGTYKMPREGDVIIIQPYAGGNPSGHMAIYDGAEWYSDFKQRDMW
FT                   AGPGYRAARPSYTIYRKN"
FT   gene            complement(558985..559233)
FT                   /locus_tag="SPAB_00596"
FT   CDS_pept        complement(558985..559233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00596"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3423 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66022"
FT                   /inference="protein motif:HMMPfam:IPR001387"
FT                   /inference="protein motif:HMMSmart:IPR001387"
FT                   /inference="protein motif:superfamily:IPR010982"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149804.1"
FT                   /protein_id="ABX66022.1"
FT                   /translation="MEPKSQDWHRADIKSALEKRGITLRDLSRQAGLSPDSLRNVFTRS
FT                   WPRAERIIADALGITPQEIWPSRYDDMQIKNDADTAE"
FT   gene            559406..559780
FT                   /locus_tag="SPAB_00597"
FT   CDS_pept        559406..559780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00597"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG28278 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00597"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66023"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:superfamily:IPR009061"
FT                   /inference="similar to AA sequence:INSD:AAV76493.1"
FT                   /protein_id="ABX66023.1"
FT                   /translation="MAKEWFTVKECLGLPGFLGSEPAVRERLYKYSEGKAGVRRKRVKS
FT                   KAEEFHISVFPLYVHRYLDDSGEEPTPEPISLQEAEPEDIWEMMFRLLTPEQRKQVTGR
FT                   FKVRGMKAVFPFLFDDTPPR"
FT   gene            559960..561138
FT                   /locus_tag="SPAB_00598"
FT   CDS_pept        559960..561138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00598"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C5041 1.2e-05 yjiJ; hypothetical
FT                   protein YjiJ K00403; COG: COG0477 Permeases of the major
FT                   facilitator superfamily; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00598"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66024"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZNB8"
FT                   /protein_id="ABX66024.1"
FT                   /translation="MTAVSQKTTTPSADFSLFRIAFAVFLTYMTVGLPLPVIPLFVHHE
FT                   LGYSNTMVGIAVGIQFFATVLTRGYAGRLADQYGAKRSALQGMFACGLAGAAWLLAALL
FT                   PVSAPIKFALLIVGRLILGFGESQLLTGTLTWGLGLVGPTRSGKVMSWNGMAIYGALAA
FT                   GAPLGLLIHSHFGFAALAGTTMVLPLLAWAFNGTVRKVPAYTGERPSLWSVVGLIWKPG
FT                   LGLALQGVGFAVIGTFISLYFVSNGWTMAGFTLTAFGGAFVLMRILFGWMPDRFGGVKV
FT                   AVVSLLVETAGLLLLWLAPTAWIALVGAALTGAGCSLIFPALGVEVVKRVPAQVRGTAL
FT                   GGYAAFQDISYGVTGPLAGMLATSYGYPSVFLAGAISAVVGILVTILSFRRG"
FT   gene            complement(561135..562136)
FT                   /locus_tag="SPAB_00599"
FT   CDS_pept        complement(561135..562136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00599"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06277 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00599"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66025"
FT                   /inference="similar to AA sequence:INSD:AAV76495.1"
FT                   /protein_id="ABX66025.1"
FT                   /translation="MHPISGAPAQPPGEGRNPLSAASEQPLSMQQRTVLERLITRLISL
FT                   TQQQSAEVWAGMKHDLGIKNDAPLLSRHFPAAEQNLTQRLGVAQQNHANRQVLSQLTEL
FT                   LGVGNNRQAVSDFIRQQYGQTALSQLTPDQLKNVLTLLQQGQLSIPQPQQRPATDRPLL
FT                   PAEHNTLNQLVTKLAAATGESNKLIWQSMLELSGVKSGELIPAKQFTHLATWLQARQTL
FT                   SLQHAPTLHTLQAALKQPLEPDELTAIKEYAQHTYQIQPQTVLTTAQVQDLLNHIFLRR
FT                   VEREADELEPLSIQPIYRPFAPMIETVKNLSARPGLLFIALIIVLALFWLVS"
FT   gene            562240..563376
FT                   /locus_tag="SPAB_00600"
FT   CDS_pept        562240..563376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00600"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2372 5.0e-201 pdxB;
FT                   erythronate-4-phosphate dehyrogenase K03473; COG: COG0111
FT                   Phosphoglycerate dehydrogenase and related dehydrogenases;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66026"
FT                   /db_xref="GOA:A9N474"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR020921"
FT                   /db_xref="InterPro:IPR024531"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038251"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N474"
FT                   /inference="protein motif:HMMPfam:IPR006139"
FT                   /inference="protein motif:HMMPfam:IPR006140"
FT                   /inference="protein motif:ScanRegExp:IPR006140"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217359.1"
FT                   /protein_id="ABX66026.1"
FT                   /translation="MKILVDENMPYARELFSRLGEVKAVPGRPIPVEELNHADALMVRS
FT                   VTKVNESLLSGTPINFVGTATAGTDHVDEAWLKQAGIGFSAAPGCNAIAVVEYVFSALL
FT                   MLAERDGFSLRDRTIGIVGVGNVGSRLQTRLEALGIRTLLCDPPRAARGDEGDFRTLDE
FT                   LVQEADVLTFHTPLYKDGPYKTLHLADETLIRRLKPGAILINACRGPVVDNAALLARLN
FT                   AGQPLSVVLDVWEGEPDLNVALLEAVDIGTSHIAGYTLEGKARGTTQVFEAYSAFIGRE
FT                   QRVALETLLPAPEFGRITLHGPLDQPTLKRLAHLVYDVRRDDAPLRKVAGIPGEFDKLR
FT                   KNYLERREWSSLYVMCDDETAAALLCKLGFNAVHHPAH"
FT   gene            563444..564457
FT                   /locus_tag="SPAB_00601"
FT   CDS_pept        563444..564457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00601"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2604 1.4e-159 usg; USG-1 protein
FT                   K00133; COG: COG0136 Aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66027"
FT                   /inference="protein motif:HMMPfam:IPR000534"
FT                   /inference="protein motif:HMMPfam:IPR012280"
FT                   /inference="protein motif:HMMPIR:IPR012080"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456911.1"
FT                   /protein_id="ABX66027.1"
FT                   /translation="MSEGWNIAILGATGAVGEALLETLAERQFPVGEIYALARHESAGE
FT                   HLRFGGKSVIVQDAADFDWTQAQLAFFVAGAEASAAWIDDATNAGCLVIDSSGLFALEP
FT                   DVPLVVPEVNPYVLADYRNRNVIAVADSLTSQLLAALKPLIDQGGLSRIAVTSMLSASA
FT                   QGKKAVDALAGQSAKLLNGIPIDEDDFFGRQLAFNMLPLLPDREGSVRQERRIVDEVRK
FT                   ILQDDGVMISASVVQSPVFYGHAQMVSFEALRPLAAEEAREAFSRGEDIVLSEETDYPT
FT                   QVGDASGNPQLSIGCVHNDYGMPEQIQFWSVADNVRFGGALMAVKIAEKLVQEYLY"
FT   gene            564457..565269
FT                   /locus_tag="SPAB_00602"
FT   CDS_pept        564457..565269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00602"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0496 2.4e-146 truA; tRNA pseudouridine
FT                   synthase A K06173; COG: COG0101 Pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00602"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66028"
FT                   /db_xref="GOA:A9N476"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N476"
FT                   /inference="protein motif:Gene3D:IPR001406"
FT                   /inference="protein motif:HMMPanther:IPR001406"
FT                   /inference="protein motif:HMMPfam:IPR001406"
FT                   /inference="protein motif:HMMTigr:IPR001406"
FT                   /inference="similar to AA sequence:INSD:AAV76498.1"
FT                   /protein_id="ABX66028.1"
FT                   /translation="MSGQQSSPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ
FT                   VANEPINVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVP
FT                   DDFHARFSATARRYRYIIYNHRLRPAVLAKGVTHYYEPLDAERMHRAAQCLLGENDFTS
FT                   FRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLLEVGAHNQPES
FT                   WIAELLAARDRTLAAATAKAEGLYLVAVDYPDRFDLPKPPMGPLFLAD"
FT   gene            565318..565977
FT                   /locus_tag="SPAB_00603"
FT   CDS_pept        565318..565977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00603"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsl:LSL_1322 1.2e-14 alkaline phosphatase
FT                   K01077; COG: COG0586 Uncharacterized membrane-associated
FT                   protein; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00603"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66029"
FT                   /inference="similar to AA sequence:INSD:AAO68203.1"
FT                   /protein_id="ABX66029.1"
FT                   /translation="MDLIYFIIDFILHIDVHLAELVAEYGVWVYAILFLILFCETGLVV
FT                   TPFLPGDSLLFVAGALASLETNDLNVHVMVALMLIAAIVGDAVNYTIGRLFGEKLFSNP
FT                   NSKIFRRSYLDKTHQFYEKHGGKTIILARFVPIVRTFAPFVAGMGHMSYRHFAAYNVIG
FT                   ALLWVLLFTYAGYFFGTIPLIQDNLKLLIVGIIVVSILPGVIEIVRHKRAASRAAK"
FT   gene            566337..567041
FT                   /locus_tag="SPAB_00604"
FT   CDS_pept        566337..567041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00604"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2597 1.1e-118 accD; acetyl-CoA
FT                   carboxylase beta subunit K01963; COG: COG0777 Acetyl-CoA
FT                   carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00604"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66030"
FT                   /db_xref="GOA:A9N478"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N478"
FT                   /inference="protein motif:HMMPfam:IPR000022"
FT                   /inference="protein motif:HMMTigr:IPR000438"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804355.1"
FT                   /protein_id="ABX66030.1"
FT                   /translation="MELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTL
FT                   HGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSL
FT                   MQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVI
FT                   EQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNPDAPREGV
FT                   VVPPAPDQESEA"
FT   gene            567109..568377
FT                   /locus_tag="SPAB_00605"
FT   CDS_pept        567109..568377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00605"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2365 6.4e-224 folC; multifunctional
FT                   folylpolyglutamate synthase K01927:K01930; COG: COG0285
FT                   Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66031"
FT                   /inference="protein motif:HMMPanther:IPR001645"
FT                   /inference="protein motif:HMMPfam:IPR004101"
FT                   /inference="protein motif:HMMPfam:IPR013221"
FT                   /inference="protein motif:HMMTigr:IPR001645"
FT                   /inference="protein motif:ScanRegExp:IPR001645"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461307.1"
FT                   /protein_id="ABX66031.1"
FT                   /translation="MKNKSIPQAASPLASWLSYLENLHSKSIDLGLERVSQVAARLDIL
FT                   KPAPFVFTVAGTNGKGTTCRTLESVLIAAGYRVGVYSSPHLVRYTERVRVQGKELAESA
FT                   HTASFAEIEAARGDISLTYFEYGTLSALWLFKQANLDVVILEVGLGGRLDATNIVDADV
FT                   AVITSIALDHTDWLGPDRESIGREKAGIFRAEKPAIVGEPEMPATIADVAQETGALLRR
FT                   RGVDWRYEVTATHWAFTDGDGTLAGLPLPQVPQPNAATALAALRASRLNIDEQAIRDGI
FT                   AQATLPGRFQIVSESPRVIFDVAHNPHAAEYLTGRLKMLPKRGRVLAVIGMLHDKDIAG
FT                   TLAWLKSVVDDWYCAPLEGPRGATAEQLLEHLGKGNVYDSVAQAWQAAIDAAQPEDTVL
FT                   VCGSFHTVAHVMEVIDAGRIGGE"
FT   gene            568367..569041
FT                   /locus_tag="SPAB_00606"
FT   CDS_pept        568367..569041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00606"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_1900 2.3e-13 argininosuccinate
FT                   synthase K03749; COG: COG3147 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00606"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66032"
FT                   /inference="protein motif:HMMPfam:IPR007730"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217353.1"
FT                   /protein_id="ABX66032.1"
FT                   /translation="MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVP
FT                   KPGDRDEPDMMPAATQALPTQPPEGAAEEVRAGDAAAPSLDPSRMASNNVELDPIPVET
FT                   PKPKPVEKPKPQPKPQQPVVAASTPTPAPQPATDDKPAPTGKAYVVQLGALKNADKVNE
FT                   IVGKLRSAGFRVYTSPSTPVQGKITRILVGPDASKDKMKGSLGELKQISGLSGVVMGYS
FT                   PN"
FT   gene            569182..569337
FT                   /locus_tag="SPAB_00607"
FT   CDS_pept        569182..569337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00607"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66033"
FT                   /protein_id="ABX66033.1"
FT                   /translation="MAALLVVPEEIKSVMALNIFSAPFLFTRGKEIPTQTFSFSVRMRP
FT                   EQDDRA"
FT   gene            569353..569841
FT                   /locus_tag="SPAB_00608"
FT   CDS_pept        569353..569841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00608"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:CaalfMp14 0.0078 NAD4; NADH dehydrogenase
FT                   subunit 4 K03881; COG: COG1286 Uncharacterized membrane
FT                   protein, required for colicin V production; Psort location:
FT                   CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00608"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66034"
FT                   /inference="protein motif:HMMPfam:IPR003825"
FT                   /inference="similar to AA sequence:INSD:ABI37070.1"
FT                   /protein_id="ABX66034.1"
FT                   /translation="MVWIDYAIIAVIAFSCLVSLIRGFVREALSLVSWGCAFFVASHYY
FT                   TYLSVWFTGFEDELVRNGIAIAVLFIATLIVGAIVNFVIGQLVEKTGLSGTDRVLGICF
FT                   GALRGALIVAAILFFLDTFTGLSKSEDWSKSQLIPQFSFIIRWFFDYLQSSSSFLPRT"
FT   gene            569879..571396
FT                   /locus_tag="SPAB_00609"
FT   CDS_pept        569879..571396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00609"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0502 7.3e-271 purF;
FT                   amidophosphoribosyltransferase K00764; COG: COG0034
FT                   Glutamine phosphoribosylpyrophosphate amidotransferase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00609"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66035"
FT                   /inference="protein motif:HMMPanther:IPR005854"
FT                   /inference="protein motif:HMMPfam:IPR000583"
FT                   /inference="protein motif:HMMPfam:IPR000836"
FT                   /inference="protein motif:HMMTigr:IPR005854"
FT                   /inference="protein motif:ScanRegExp:IPR000583"
FT                   /inference="protein motif:ScanRegExp:IPR002375"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149816.1"
FT                   /protein_id="ABX66035.1"
FT                   /translation="MCGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGIITIDANNCFRL
FT                   RKANGLVNDIFEARHMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGN
FT                   LTNAHELRKKLFEEKRRHINTTSDSEILLNIFASELDNFRHYPLEADNIFAAIAATNRQ
FT                   IRGAYACVAMIIGHGMVAFRDPHGIRPLVLGKRDVGDGRTEYMVASESVALDTLGFEFL
FT                   RDVAPGEAIYITEKGQLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGT
FT                   KLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMPGQ
FT                   QLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPE
FT                   IRFPNVYGIDMPTANELIAHGREVDEIRQIIGADGLIFQDLNDLIEAVRAENPDIQQFE
FT                   CSVFNGVYVTKDVDQQYLDFLDSLRNDDAKAVLFQNEMENLEMHNEG"
FT   gene            complement(571432..572859)
FT                   /locus_tag="SPAB_00610"
FT   CDS_pept        complement(571432..572859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00610"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2502 1.9e-59 atoC; acetoacetate
FT                   metabolism regulatory protein AtoC K07714; COG: COG3829
FT                   Transcriptional regulator containing PAS, AAA-type ATPase,
FT                   and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66036"
FT                   /inference="protein motif:FPrintScan:IPR002197"
FT                   /inference="protein motif:HMMPfam:IPR002078"
FT                   /inference="protein motif:HMMPfam:IPR002197"
FT                   /inference="protein motif:HMMPfam:IPR013656"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR000014"
FT                   /inference="protein motif:ScanRegExp:IPR002078"
FT                   /inference="protein motif:superfamily:IPR008931"
FT                   /inference="similar to AA sequence:INSD:AAL21262.1"
FT                   /protein_id="ABX66036.1"
FT                   /translation="MASTNQELASALRMFSRFFDLIHQPLAVINERGEYVYYNQESADL
FT                   DGYSIERAMGKHMLDVYPGMKETQSTMLSSLKKGVEYIGHYQIYYNARGQAVDYQHTTA
FT                   PLYASDGGMVGVIEIGRNMSGVRRLQEQVVELNQLLYADHHEKHHAIITENPEMLSNIA
FT                   KAKRLAASNIPVTIVGETGTGKELFSRLIHQCSKRANKPFIALNCGALPPTLIESTLFG
FT                   TVRGAYTGAENSQGYLELANGGTLFLDELNAMPIEMQSKLLRFLQDKTFWRLGGQQQLH
FT                   SDVRIVAAMNEAPVKLIQQERLRADLFYRLSVGMLTLPPLRARPEDIPLLANYFIDKYR
FT                   NDVPQDIHGLSETARADLLNHAWPGNVRMLENAIVRSMIMQEKDGLLKHIIFEQDELNL
FT                   GVPETAPENPLPSSPDPQYEGSLEVRVANYERHLIETALDTHQGNIAAAARSLNVSRTT
FT                   LQYKVQKYAIRFGVVRN"
FT   gene            573070..574467
FT                   /locus_tag="SPAB_00611"
FT   CDS_pept        573070..574467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00611"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0504 3.5e-255 putative amino acid
FT                   decarboxylase K01586; COG: COG0019 Diaminopimelate
FT                   decarboxylase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66037"
FT                   /inference="protein motif:HMMPfam:IPR000183"
FT                   /inference="protein motif:superfamily:IPR009006"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456902.1"
FT                   /protein_id="ABX66037.1"
FT                   /translation="MTDSIMQNYNQLREQVINGDRRFQHKDGHLCFEGVDLDALARQYP
FT                   TPFYVFSEPEIIRNIHEIQQAFAAHKNTKTFFASKTCSVMGVLKAIRDAGICAEANSQY
FT                   EVRKCLEIGFRGDQIVFNGVVKKPADLEYAIANDLYLINVDSLYELEHIDAISRKLKKV
FT                   ANVCVRVEPNVPSATHAELVTAFHAKSGLDLEQAEETCRRILAMPYVHLRGLHMHVGDQ
FT                   VPESEPFAKATKVLVDESRRLEEVLGIKFDLINVGGGIPVPYKYDDENGDPLKDNMYAG
FT                   ITAQDFADAVIREVHKWRTDVEICIEPGRKVTGSAAVLLTEVSCEKRKTNYDLNGNVEC
FT                   HVEWKFVDAGYSVLSDSQHFDWFFYVYNASRMTAAHDAWVKLAGPLCDGGDYFHMGVKG
FT                   EEFLLPKETHVGDIVAFLDAGAYTIESQTVYNNRPRTGVVMIDKNGETRLIRREDSYED
FT                   MVKYDIY"
FT   gene            574558..575979
FT                   /locus_tag="SPAB_00612"
FT   CDS_pept        574558..575979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00612"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0120 9.7e-06 aroP; aromatic amino
FT                   acid transport protein AroP K03293; COG: COG0531 Amino acid
FT                   transporters; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00612"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66038"
FT                   /inference="protein motif:HMMPanther:IPR002293"
FT                   /inference="protein motif:HMMPfam:IPR004841"
FT                   /inference="similar to AA sequence:INSD:AAL21260.1"
FT                   /protein_id="ABX66038.1"
FT                   /translation="MSNTNSGLLGIKDIVFMNVIAILSLRQIPNVAPYGASAMLLWVIA
FT                   AFCLFFPLAMVCGELSTGWPKDGGIFVWIKEAFGKRIAWIVVVCFLFSCVLFFPLMLQF
FT                   GFTALGYMIGGGLAENKAFIGIGSAVIFWLLTLMNIRGMEWTKIINSISAWCGVFIPSA
FT                   ILILLAVVWLCTGHQMQTDYTTAKNWIPDLGHWDTIVFLSSMMFAFAGLEVAPMIAGRT
FT                   RNPQRDFPRAMAVSAAVIVGIYMVGTWALNTLLPAGKTDIVAGVMQAMHAAADTLHMPW
FT                   LIPVMAICMFFGALGQINSWLVGPIYMLQEASREDNLLGDRIGKLHPVWKTPAFALTVQ
FT                   AIIVTVLCFSTFISPSVAAAYWMLTALTTITYFIPYLVMFPAFWRLRKTQPDTPRSFKI
FT                   PGKVLPAILPALGFLSIAFAVALLFIPPSQIDMGGYFQYAGKIIGGAVLAVVVAEYIYH
FT                   RAQKRNARLSMAGGK"
FT   gene            575981..577084
FT                   /locus_tag="SPAB_00613"
FT   CDS_pept        575981..577084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00613"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plt:Plut_0280 3.4e-05 alanine racemase region
FT                   K01775; COG: COG3457 Predicted amino acid racemase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00613"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66039"
FT                   /inference="protein motif:HMMPfam:IPR001608"
FT                   /inference="similar to AA sequence:INSD:AAV76508.1"
FT                   /protein_id="ABX66039.1"
FT                   /translation="MYMPVLEINLRKLEENARTEKALLASSGIDVMAVNKVFDGCVETA
FT                   QAVFNGGITVIAESRTYNLKKIRETGCTTCLLRSPCLSEIEDVVRYADISLNSEPAVLR
FT                   ALSQEAQRQGKTHQVLLMVDMGDLREGIWFGEYQRILETVTLITGLPGLELYGLGTNFN
FT                   CYGTVLPTVKNGEDFLALAARLEADSGIPVRRLSAGNCTSYHLLDKGIWPQGLNHLRIG
FT                   GLHEFGIEYVDMKYLNEFHHSAKPVDKACSDMYILEAEIIELNSKPTVPVGELGVDAFL
FT                   QSKTFVDRGIRRRALLAFGRQDVPSDNCVPCDDAITILGQTSDHTLVDIEDCRQSLKVG
FT                   DVVRFELDYTGLLMACQTKGVAWRFTR"
FT   gene            577148..578554
FT                   /locus_tag="SPAB_00614"
FT   CDS_pept        577148..578554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00614"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0120 1.3e-60 aroP; aromatic amino
FT                   acid transport protein AroP K03293; COG: COG0833 Amino acid
FT                   transporters; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66040"
FT                   /inference="protein motif:HMMPanther:IPR002293"
FT                   /inference="protein motif:HMMPfam:IPR004841"
FT                   /inference="similar to AA sequence:INSD:AAL21258.1"
FT                   /protein_id="ABX66040.1"
FT                   /translation="MDTLQQSPPAEPEGGLRRNLKKRHLLMMSLGGTIGTGLFIGIAEP
FT                   LSSVGPAGTLLAYLFAGTIMLATMMCLGELSCAFPHSGSFQHYALMFMPSPCWSYTIGW
FT                   LYWFSWVFSLAADLTAAGFIAHQFFPAVPVYMFCLAILLILTAINLTSAKSFGECEYWL
FT                   SAIKVFAIVLFICAGGVMIYSLMGHSDWHPTLKTDGMWFPHGWEQIVVCMTIVIYSFQG
FT                   VELVGNAAGETESPHIILPKVILGIGLRIILFYGLAIAVLALVYPHELTPNGQSPFVWV
FT                   FSHAGIPGADTLMTLVIFSAAVSAANSAIYASSRMLWSMAGDRFAPACFGKTNGGGVPV
FT                   YAILITALLALVSLLTRYIPAQQFYLYLIASTGQVGCLAWITIGWCQYRFRQSVRNGTY
FT                   ASDLLRYRSPLFPWTARFVIITNFAIMVGTWFSEQGVVIMLVELAFMIGILLSWYLFRP
FT                   TLSRLRNTVG"
FT   gene            578581..579150
FT                   /locus_tag="SPAB_00615"
FT   CDS_pept        578581..579150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00615"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0508 3.6e-95 ubiX; putative decarboxylase
FT                   K03186; COG: COG0163 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66041"
FT                   /inference="protein motif:Gene3D:IPR003382"
FT                   /inference="protein motif:HMMPfam:IPR003382"
FT                   /inference="protein motif:HMMTigr:IPR004507"
FT                   /inference="protein motif:superfamily:IPR003382"
FT                   /inference="similar to AA sequence:INSD:AAX66264.1"
FT                   /protein_id="ABX66041.1"
FT                   /translation="MKRLIVGISGASGAIYGVRLLQILRDVDSVETHLVMSQAARQTLA
FT                   LETHFSLREVQALADVTHDARDIAASISSGSYPTAGMVILPCSIKTLSGIVHSYTDGLL
FT                   TRAADVILKERRPLVLCVRETPLHIGHLRLMTQAAEIGAVIMPPVPAFYHLPQTLDDVI
FT                   NQTVNRVLDQFGIPLPHDLFVRWQGA"
FT   gene            complement(579239..579409)
FT                   /locus_tag="SPAB_00616"
FT   CDS_pept        complement(579239..579409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00616"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66042"
FT                   /protein_id="ABX66042.1"
FT                   /translation="MFYVALCVCRLFHAGLMPFSRQQNDSTLNLLIKRCNIVLMLKIAG
FT                   MTVEPQRFGGF"
FT   gene            579439..580221
FT                   /locus_tag="SPAB_00617"
FT   CDS_pept        579439..580221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00617"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4695 2.1e-28 ABC polar amino
FT                   acid transporter, periplasmic ligand binding protein
FT                   K01713; COG: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain; Psort
FT                   location: Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00617"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66043"
FT                   /inference="protein motif:HMMPfam:IPR001638"
FT                   /inference="protein motif:HMMSmart:IPR001638"
FT                   /inference="protein motif:HMMTigr:IPR005768"
FT                   /inference="protein motif:ScanRegExp:IPR001638"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461297.1"
FT                   /protein_id="ABX66043.1"
FT                   /translation="MKKTVLALSLLIGLGATAASYAALPQTVRIGTDTTYAPFSSKDAK
FT                   GEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIA
FT                   FSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYA
FT                   NQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLR
FT                   KDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGD"
FT   gene            580459..581241
FT                   /locus_tag="SPAB_00618"
FT   CDS_pept        580459..581241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00618"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4695 1.1e-29 ABC polar amino
FT                   acid transporter, periplasmic ligand binding protein
FT                   K01713; COG: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain; Psort
FT                   location: Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00618"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66044"
FT                   /inference="protein motif:HMMPfam:IPR001638"
FT                   /inference="protein motif:HMMSmart:IPR001638"
FT                   /inference="protein motif:HMMTigr:IPR005768"
FT                   /inference="protein motif:ScanRegExp:IPR001638"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX66044.1"
FT                   /translation="MKKLALSLSLVLAFSSATAAFAAIPQKIRIGTDPTYAPFESKNAQ
FT                   GELVGFDIDLVKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIA
FT                   FTDKLYAADSRLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQ
FT                   GQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPAVKDEKLFGVGTGMGLR
FT                   KEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG"
FT   gene            complement(581242..581373)
FT                   /locus_tag="SPAB_00619"
FT   CDS_pept        complement(581242..581373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00619"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66045"
FT                   /protein_id="ABX66045.1"
FT                   /translation="MPHITPDGGCALPGLRCSVGRARHSAIRQCRQSTFFGLYLHRR"
FT   gene            581423..582109
FT                   /locus_tag="SPAB_00620"
FT   CDS_pept        581423..582109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00620"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV6546 2.1e-21 putative ABC transporter
FT                   permease K02028; COG: COG4215 ABC-type arginine transport
FT                   system, permease component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66046"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR010065"
FT                   /inference="similar to AA sequence:INSD:AAL21254.1"
FT                   /protein_id="ABX66046.1"
FT                   /translation="MLYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRVT
FT                   GLIFEGYTTLIRGVPDLVLMLLIFYGLQIALNVVTDSLGIDQIDIDPMVAGIITLGFIY
FT                   GAYFTETFRGAFMAVPKGHIEAATAFGFTHGQTFRRIMFPAMMRYALPGIGNNWQVILK
FT                   ATALVSLLGLEDVVKATQLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVG
FT                   VKRADL"
FT   gene            582106..582813
FT                   /locus_tag="SPAB_00621"
FT   CDS_pept        582106..582813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00621"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV6546 5.1e-25 putative ABC transporter
FT                   permease K02028; COG: COG4160 ABC-type arginine/histidine
FT                   transport system, permease component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66047"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR010065"
FT                   /inference="similar to AA sequence:INSD:AAO68218.1"
FT                   /protein_id="ABX66047.1"
FT                   /translation="MIEIIQEYWKSLLWTDGYRFTGVAITLWLLISSVVMGGLLAVILA
FT                   VGRVSSNKFIRFPIWLFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTDLLNAFFRSGLNC
FT                   TVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFKMYRCIILPSALRIALPAY
FT                   SNEVILMLHSTALAFTATVPDLLKIARDINSATYQPFTAFGIAAVLYLLISYVLISLFR
FT                   RAERRWLQHVSSK"
FT   gene            582827..583600
FT                   /locus_tag="SPAB_00622"
FT   CDS_pept        582827..583600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00622"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2351 4.2e-133 hisP; ABC superfamily
FT                   (atp_bind), histidine and lysine/arginine/ornithine
FT                   transport protein K02028; COG: COG4598 ABC-type histidine
FT                   transport system, ATPase component; Psort location:
FT                   CytoplasmicMembrane, score:7.88"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00622"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66048"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="similar to AA sequence:INSD:AAL21252.1"
FT                   /protein_id="ABX66048.1"
FT                   /translation="MSENKLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKS
FT                   TFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLW
FT                   SHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSI
FT                   ARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHV
FT                   IFLHQGKIEEEGDPEQVFGNPQSPRLQQFLKGSLK"
FT   gene            complement(583652..584545)
FT                   /locus_tag="SPAB_00623"
FT   CDS_pept        complement(583652..584545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00623"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_0206 1.7e-56 hypothetical protein;
FT                   COG: COG1090 Predicted nucleoside-diphosphate sugar
FT                   epimerase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00623"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66049"
FT                   /inference="protein motif:HMMPanther:IPR010099"
FT                   /inference="protein motif:HMMPfam:IPR001509"
FT                   /inference="protein motif:HMMPfam:IPR013549"
FT                   /inference="protein motif:HMMTigr:IPR010099"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461292.1"
FT                   /protein_id="ABX66049.1"
FT                   /translation="MQILITGGTGLIGRHLIPRLLTLGHQVTVVTRNPDNARQILDSRV
FT                   TLWKGLAEREHLNEIDAIINLAGEPIADKRWTSQQKERLCQSRWAITQKLVDLIHASAT
FT                   PPSVLISGSATGYYGDLGDVVVTEDEPPHNEFTHKLCARWEQIACRAQSDQTRVCLLRT
FT                   GVVLAPQGGILGKMVPPFRLGLGGPVGNGRQYLAWIHIDDMVNGILWLLDNDLRGPFNM
FT                   VSPYPVHNEHFAHALGRALRRPAIIRIPATAIRLLMGESSVLVLGGQRALPKRLEAAGF
FT                   AFRWYDLEEALADVIR"
FT   gene            complement(584671..585318)
FT                   /locus_tag="SPAB_00624"
FT   CDS_pept        complement(584671..585318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00624"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2586 1.5e-91 yfcG; putative
FT                   S-transferase K00799; COG: COG0625 Glutathione
FT                   S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66050"
FT                   /inference="protein motif:HMMPfam:IPR004045"
FT                   /inference="protein motif:HMMPfam:IPR004046"
FT                   /inference="protein motif:superfamily:IPR010987"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461291.1"
FT                   /protein_id="ABX66050.1"
FT                   /translation="MIDLYYAPTPNGHKITLFLEEAELAYRLLKVDISKGNQFRPDFLA
FT                   ISPNNKIPAIVDHAPADGGQPLSLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQ
FT                   VGGLGPMLGQNHHFNHFAPQAIPYAIERYQVETQRLYNVLNKRLETSPWLGGDHYSIAD
FT                   IASWPWVNAHQRQRIDLDTYPAVYNWFERIRTRPATARALLQAQLHCNSTKA"
FT   gene            585461..586105
FT                   /locus_tag="SPAB_00625"
FT   CDS_pept        585461..586105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00625"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2585 4.4e-90 yfcF; hypothetical
FT                   protein K00799; COG: COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66051"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR004045"
FT                   /inference="protein motif:superfamily:IPR010987"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461290.1"
FT                   /protein_id="ABX66051.1"
FT                   /translation="MSKPVIVLWSDANFFSPYVLSAWVALQEKGLSFTLKTRDLDQGEH
FT                   LQPGWRGYALTQRVPVLEADNFELSESSAIAEYLEERFAPPQWERIYPHDLQKRARARQ
FT                   IQAWLRSDLLPLREERPTDVVFAGAKKAPLSEAGKACAAKLFATAEALLGQGTQNLFGE
FT                   WCIADTDLALMINRLALHGDDVPASLAAYATFQWQRASVQRFIALSSKRSG"
FT   gene            586161..586712
FT                   /locus_tag="SPAB_00626"
FT   CDS_pept        586161..586712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00626"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2584 4.5e-81 yfcE; hypothetical
FT                   protein; COG: COG0622 Predicted phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00626"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66052"
FT                   /inference="protein motif:HMMPfam:IPR004843"
FT                   /inference="protein motif:HMMPIR:IPR000979"
FT                   /inference="protein motif:HMMTigr:IPR000979"
FT                   /inference="protein motif:ScanRegExp:IPR000979"
FT                   /inference="similar to AA sequence:INSD:AAV76519.1"
FT                   /protein_id="ABX66052.1"
FT                   /translation="MKLMFASDIHGSLPATERVLERFAQSGARWLVILGDVLNHGPRNA
FT                   LPEGYAPAQVAERLNAVATQIIAVRGNCDSEVDQMLLHFPITAPWQQILTQERRLFLTH
FT                   GHLFGPTNLPALHTGDVLVYGHTHLPVAQQQEGLYHFNPGSVSIPKGGYAASYGILDDN
FT                   VLSVIALNDQSIIAQVAINS"
FT   gene            586769..587323
FT                   /locus_tag="SPAB_00627"
FT   CDS_pept        586769..587323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00627"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssn:SSO_2356 8.5e-87 putative regulator; COG:
FT                   COG0494 NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00627"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66053"
FT                   /inference="protein motif:BlastProDom:IPR002667"
FT                   /inference="protein motif:Gene3D:IPR000086"
FT                   /inference="protein motif:HMMPfam:IPR000086"
FT                   /inference="protein motif:superfamily:IPR000086"
FT                   /inference="similar to AA sequence:INSD:AAL21247.1"
FT                   /protein_id="ABX66053.1"
FT                   /translation="MVEQRRLASTEWVDIVNEDNEVIAQSSREQMRAQRLRHRATYIVV
FT                   HDGMGKILVQRRTETKDFLPGMLDATAGGVVQADEQLLESARREAEEELGIAGVPFAEH
FT                   GLFYFEDQHCRVWGALFSCVSHGPFALQEDEVSEVCWLTPEEITARCDEFTPDSLKALA
FT                   LWMTRNAKNEAALQEKPEETE"
FT   gene            complement(587329..588348)
FT                   /locus_tag="SPAB_00628"
FT   CDS_pept        complement(587329..588348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00628"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EF1922 1.4e-05 transcriptional regulator,
FT                   LacI family/carbohydrate kinase, PfkB family protein
FT                   K00852; COG: COG1609 Transcriptional regulators; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00628"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66054"
FT                   /inference="protein motif:HMMPfam:IPR000843"
FT                   /inference="protein motif:HMMPfam:IPR001761"
FT                   /inference="protein motif:HMMSmart:IPR000843"
FT                   /inference="protein motif:ScanRegExp:IPR000843"
FT                   /inference="protein motif:superfamily:IPR010982"
FT                   /inference="similar to AA sequence:INSD:AAL21246.1"
FT                   /protein_id="ABX66054.1"
FT                   /translation="MSIPRKRRSTGKVTIADVAQLAGVGTMTVSRALRTPEQVSDKLRE
FT                   KIEAAVHELGYMPNLAASALASASSHTIAMVVPNLAEAGCSEMFAGLQQILQPAGYQIM
FT                   LAESQHRVEQEEKLLETLLASNIAAAILLSVEHSTTVRQWLKNASIPVMEMGAIRSDPI
FT                   DMNIGIDNVAAMYELTEMLIQRGYQNIGLLCANQEQWIFQQHLHGWYKAMLRHHMSPNR
FT                   VINAALPPNFSTGASQLPEFLLAWPELDALVCVSDELACGALYECQRRRIKVPDDLAVV
FT                   GFGDSDVSRVCQPPLTTMAVPHRKIGSEAGRALLERLNQGNWSDRKSIASSLCMRESC"
FT   gene            complement(588429..588602)
FT                   /locus_tag="SPAB_00630"
FT   CDS_pept        complement(588429..588602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66056"
FT                   /protein_id="ABX66056.1"
FT                   /translation="MLFAPTVYEIMNKLYSSHSILAAIVITKIALPATITQNCDSAIKL
FT                   KSWCEITAKKRI"
FT   gene            588601..589044
FT                   /locus_tag="SPAB_00629"
FT   CDS_pept        588601..589044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00629"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2344 4.9e-75 putative
FT                   phosphotransferase system K02821; COG: COG1762
FT                   Phosphotransferase system mannitol/fructose-specific IIA
FT                   domain (Ntr-type); Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00629"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66055"
FT                   /inference="protein motif:BlastProDom:IPR002178"
FT                   /inference="protein motif:Gene3D:IPR002178"
FT                   /inference="protein motif:HMMPfam:IPR002178"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461286.1"
FT                   /protein_id="ABX66055.1"
FT                   /translation="MLGTWLSDATITLQESVETWPQALEICGKPLLDAGVIAPEYLTAI
FT                   VQQHQKLGPYYVLAPGLAMPHARPEEGAKGLGLSLLKLQHGVSFGADEFDPVDIIIMLA
FT                   APDKHSHIEMISALAELFSSDVDMEKLHQAKNLEDIKTIIDRF"
FT   gene            589125..589397
FT                   /locus_tag="SPAB_00631"
FT   CDS_pept        589125..589397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00631"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0521 1.5e-41 putative sugar
FT                   phosphotransferase component II B K02822; COG: COG3414
FT                   Phosphotransferase system, galactitol-specific IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66057"
FT                   /inference="protein motif:HMMPfam:IPR003501"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABX66057.1"
FT                   /translation="MKIMAICGSGLGSSFMVEMNIKKVLKKLNIDAEVEHSDLSSATPG
FT                   AADLFVMAKDIAASASVPESQLVVINNIIDINELETQLRAWFAKQ"
FT   gene            589418..590809
FT                   /locus_tag="SPAB_00632"
FT   CDS_pept        589418..590809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00632"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mcp:MCAP_0590 3.0e-91 PTS system, IIBC
FT                   component, putative K02822:K03475; COG: COG3037
FT                   Uncharacterized protein conserved in bacteria; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00632"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66058"
FT                   /inference="protein motif:HMMPfam:IPR007333"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461284.1"
FT                   /protein_id="ABX66058.1"
FT                   /translation="MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIK
FT                   TILGFIVLGGGATVLVGSLNPLGGMFEHAFNIQGIIPNNEAIVSIALEKYGASTALIMA
FT                   FGMVANIVVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVGLVFTGSLILGLVMA
FT                   FFPALAQRYMRRITGTDDIAFGHFGTLGYVLSGWIGSLCGKGSRSTEEMNLPKNLSFLR
FT                   DSSISISLTMIIIYLIMAVSAGREYVEATFSGGQNYLVYAIIMAITFAAGVFIILQGVR
FT                   LILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVLIGFLFSFLGGLVGLFLLGQM
FT                   KLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGF
FT                   ANTTFSDADFGVIGILLGNLARYLSPMAITGLVVALFALLVAYNVLAKNKKATAEVQEN
FT                   SGAKE"
FT   gene            590806..591636
FT                   /locus_tag="SPAB_00633"
FT   CDS_pept        590806..591636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00633"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2341 7.0e-147 putative transketolase
FT                   K00615; COG: COG3959 Transketolase, N-terminal subunit;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00633"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66059"
FT                   /inference="protein motif:HMMPfam:IPR005474"
FT                   /inference="protein motif:HMMPIR:IPR012058"
FT                   /inference="similar to AA sequence:INSD:AAL21242.1"
FT                   /protein_id="ABX66059.1"
FT                   /translation="MNVTEITQLARDIRVATLKSLNHLGFGHYGGSMSVVETLAVLYGA
FT                   VMKIDPADPDWPERDYFVLSKGHAGPALYSTLAIKGYFPREELNTLNQNGTRLPSHPDR
FT                   LKTRGVDATTGSLGQGISIAGGMALSHKLARRPNRVFCIVGDGELNEGQCWEAFQFIAH
FT                   HRLNNLTVFIDWNKQQLDGELEEIINPFDLEGKFRAFGFDVVTVKGDDISGLLAVVQPV
FT                   LPADARPRVVILDSIKGQGVPCLEQLTNSHHLRLTDGMKQTLNEAIHQLEVMHD"
FT   gene            591629..592582
FT                   /locus_tag="SPAB_00634"
FT   CDS_pept        591629..592582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00634"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2341 8.7e-165 tktC; putative
FT                   transketolase K00615; COG: COG3958 Transketolase,
FT                   C-terminal subunit; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00634"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66060"
FT                   /inference="protein motif:Gene3D:IPR009014"
FT                   /inference="protein motif:HMMPfam:IPR005475"
FT                   /inference="protein motif:HMMPfam:IPR005476"
FT                   /inference="protein motif:HMMPIR:IPR012068"
FT                   /inference="protein motif:superfamily:IPR009014"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217328.1"
FT                   /protein_id="ABX66060.1"
FT                   /translation="MIKLAPAGLKDDIEMRKVYAGFVAGQIEAGSPIIALEADLMSSMA
FT                   MDSVARDYPQHVINCGIMEANVIGTAAGLALTGRKPFVHTFTAFASRRCFDQLFMALDY
FT                   QRNNVKVIASDAGVTACHNGGTHMSFEDMGIVRGLAHSVVLEVTDAVMFADILRQLMDL
FT                   DGFYWLRTIRKQATSIYAPGSTFTIGKGNVLREGDDITLIANGIMVAEALEAARQLEQE
FT                   GVSAAVIDMFTLKPIDRMLVKNYAEKTRRIVTCENHSIHNGLGSAVAEVLVENCPVPMR
FT                   RVGVKERYGQVGTQDFLQQEYGLTAEAIVEAAKSLL"
FT   gene            complement(592631..594151)
FT                   /locus_tag="SPAB_00635"
FT   CDS_pept        complement(592631..594151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00635"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1288 Predicted membrane protein; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66061"
FT                   /inference="protein motif:HMMPfam:IPR004669"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804382.1"
FT                   /protein_id="ABX66061.1"
FT                   /translation="MSVVTESKTARKWAMPDTLVIIFFVAILTSIATWVVPVGMFDSQE
FT                   VQYQVDGQTKTRKVVDPHSFRIVTNEAGEAQYHRVQFFTTGDERPGLMNFPFEGLTSGS
FT                   KFGTAVGIIMFMLVIGGAFGIVMRTGTVDNGILALIRHTRGNEVLFIPVLFVLFSLGGA
FT                   VFGMGEEAVAFAIIIAPLMVRLGYDSITTVLVTYIATQIGFASSWMNPFCVVVAQGIAG
FT                   VPVLSGSGLRIVVWIVATLIGLVFTLVYASRVKKNPLLSRVHESDRYFREQQDEVVQRP
FT                   FTFGDWLVLLVLTGVMIWVVWGVIVHAWFIPEIASQFFTMGVVIGLIGVIFRLNGMTVN
FT                   VMASSFTEGARMMIAPALLVGFAKGILLLVGNGEAGEPSVLNTLLNSIAHGISGLNNAI
FT                   AAWFMLLFQAVFNFFVTSGSGQAALTMPLLAPLGDLVGVNRQVTVLAFQFGDGFSHIIY
FT                   PTSASLMATLGVCRVDFRNWLKVGASLLGLLFIMSSVVVIGAQMMGYH"
FT   gene            complement(594369..596513)
FT                   /locus_tag="SPAB_00636"
FT   CDS_pept        complement(594369..596513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00636"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2339 0. pta; phosphotransacetylase
FT                   K00625; COG: COG0857 BioD-like N-terminal domain of
FT                   phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00636"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66062"
FT                   /inference="protein motif:HMMPfam:IPR002505"
FT                   /inference="protein motif:HMMPfam:IPR010766"
FT                   /inference="protein motif:HMMTigr:IPR004614"
FT                   /protein_id="ABX66062.1"
FT                   /translation="MSRIIMLIPTGTSVGLTSVSLGVIRAMERKGVRLSVFKPIAQPRA
FT                   GGDAPDQTTTIVRANSTLPAAEPLKMSHVESLLSSNQKDVLMEEIIANYHANTKDAEVV
FT                   LVEGLVPTRKHQFAQSLNYEIAKTLNAEIVFVMSQGTDTPEQLNERIELTRSSFGGAKN
FT                   TNITGVIINKLNAPVDEQGRTRPDLSEIFDDSSKAQVIKIDPAKLQESSPLPVLGAVPW
FT                   SFDLIATRAIDMARHLNATIINEGDIKTRRVKSVTFCARSIPHMLEHFRAGSLLVTSAD
FT                   RPDVLVAACLAAMNGVEIGALLLTGGYEMDARISKLCERAFATGLPVFMVNTNTWQTSL
FT                   SLQSFNLEVPVDDHERIEKVQEYVANYVNAEWIESLTATSERSRRLSPPAFRYQLTELA
FT                   RKAGKRVVLPEGDEPRTVKAAAICAERGIATCVLLGNPDEINRVAASQGVELGAGIEIV
FT                   DPEVVRESYVARLVELRKSKGMTEPVAREQLEDNVVLGTLMLEQDEVDGLVSGAVHTTA
FT                   NTIRPPLQLIKTAPGSSLVSSVFFMLLPEQVYVYGDCAINPDPTAEQLAEIAIQSADSA
FT                   IAFGIEPRVAMLSYSTGTSGAGSDVEKVREATRLAQEKRPDLMIDGPLQYDAAVMADVA
FT                   KSKAPNSPVAGRATVFIFPDLNTGNTTYKAVQRSADLISIGPMLQGMRKPVNDLSRGAL
FT                   VDDIVYTIALTAIQASQQQQ"
FT   gene            complement(596590..597792)
FT                   /locus_tag="SPAB_00637"
FT   CDS_pept        complement(596590..597792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00637"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2337 6.1e-212 ackA; acetate/propionate
FT                   kinase K00925; COG: COG0282 Acetate kinase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00637"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66063"
FT                   /inference="protein motif:HMMPanther:IPR000890"
FT                   /inference="protein motif:HMMPfam:IPR000890"
FT                   /inference="protein motif:HMMPIR:IPR004372"
FT                   /inference="protein motif:HMMTigr:IPR004372"
FT                   /inference="protein motif:ScanRegExp:IPR000890"
FT                   /inference="similar to AA sequence:INSD:CAD07569.1"
FT                   /protein_id="ABX66063.1"
FT                   /translation="MSSKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIK
FT                   WKMDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVV
FT                   IDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYL
FT                   YALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRN
FT                   GKCVDTSMGLTPLEGLVMGTRSGDIDPAIIFHLHDTLGMSVDQINKMLTKESGLLGLTE
FT                   VTSDCRYVEDNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAM
FT                   VRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLT
FT                   A"
FT   gene            complement(597829..597963)
FT                   /locus_tag="SPAB_00638"
FT   CDS_pept        complement(597829..597963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00638"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66064"
FT                   /protein_id="ABX66064.1"
FT                   /translation="MPLAEKYAKWHRLKGISSIMPKKTPAHDVNHKCQGYHALRSMAH"
FT   gene            complement(597965..598141)
FT                   /locus_tag="SPAB_00640"
FT   CDS_pept        complement(597965..598141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66066"
FT                   /protein_id="ABX66066.1"
FT                   /translation="MSTWPTSTSHIKFKKFVQNNNCEGQRSKHFVFDTHYQVSCVGLSK
FT                   AGSLKSLSRQYYT"
FT   gene            598132..598587
FT                   /locus_tag="SPAB_00639"
FT   CDS_pept        598132..598587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00639"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3092 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00639"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66065"
FT                   /db_xref="GOA:A9N4B4"
FT                   /db_xref="InterPro:IPR007334"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N4B4"
FT                   /inference="protein motif:HMMPfam:IPR007334"
FT                   /inference="similar to AA sequence:INSD:AAV76530.1"
FT                   /protein_id="ABX66065.1"
FT                   /translation="MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTR
FT                   YAIRFMPPVAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILN
FT                   WFYEVRGKLQEAGQALAPVEGKPDYQALADTLKRAFKQLDKTFLDDL"
FT   gene            598625..599164
FT                   /locus_tag="SPAB_00641"
FT   CDS_pept        598625..599164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00641"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3013 Uncharacterized conserved protein;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66067"
FT                   /inference="protein motif:BlastProDom:IPR005587"
FT                   /inference="protein motif:HMMPfam:IPR005587"
FT                   /inference="protein motif:HMMPIR:IPR005587"
FT                   /inference="similar to AA sequence:INSD:AAN81289.1"
FT                   /protein_id="ABX66067.1"
FT                   /translation="MPSFFHRHSVIQEFKMEMTNAQRLILSNQYKMMTMLDPTNAERYR
FT                   RLQTIIERGYGLQMRELDREFGELTEETCRTIIDIMEMYHALHVSWTNLKDTQAIDERR
FT                   VTFLGFDAATEARYLGYVRFMVNIEGRYTHFDAGTHGFNAQTPMWEKYQRMLNVWHACP
FT                   RQYHLSANEINQIINA"
FT   gene            599175..599834
FT                   /locus_tag="SPAB_00642"
FT   CDS_pept        599175..599834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00642"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2575 2.2e-97 yfbT; protein YfbT
FT                   K01112; COG: COG0637 Predicted
FT                   phosphatase/phosphohexomutase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00642"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66068"
FT                   /inference="protein motif:HMMPfam:IPR005834"
FT                   /inference="protein motif:HMMTigr:IPR006402"
FT                   /inference="protein motif:HMMTigr:IPR006439"
FT                   /inference="similar to AA sequence:INSD:CAD07566.1"
FT                   /protein_id="ABX66068.1"
FT                   /translation="MQCKGFLFDLDGTLVDSLPAVERAWCSWADRFNLAHDEVLGFIHG
FT                   KQAITSLRHFMAGKSEAEIAAEFTRLEQIEATETAGITALPGAVDLLNHLNKAGIPWAI
FT                   VTSGSMPVARARHQVAGLPAPEVFVTAERVKRGKPEPDAYLLGAQLLGLAPQECVVVED
FT                   APAGVLSGLAAGCHVIAVNAPADTPRLADVDFALDSLTQLSVAKQPNGDVVVLRKT"
FT   gene            599911..601737
FT                   /locus_tag="SPAB_00643"
FT   CDS_pept        599911..601737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00643"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_1626 0.0062 proton-translocating
FT                   NADH-quinone oxidoreductase, chain M K05903; COG: COG0471
FT                   Di- and tricarboxylate transporters; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00643"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66069"
FT                   /inference="protein motif:HMMPfam:IPR004680"
FT                   /inference="protein motif:HMMPfam:IPR006037"
FT                   /inference="protein motif:ScanRegExp:IPR001898"
FT                   /protein_id="ABX66069.1"
FT                   /translation="MNGELIWVLSLLAIAVVLFATGKVRMDAVALFVIVAFVLSGTLTL
FT                   PEAFSGFSDPNVILIAALFIIGDGLVRTGVATVVGTWLVKMAGSSEIKMLVLLMITVAG
FT                   LGAFMSSTGVVAIFIPVVLSVSMHMQTSPSRLMMPLSFAGLISGMMTLVATPPNLVVNS
FT                   ELLREGLHGFNFFSVTPLGIVVLALGIVYMLVMRFMLKGDAPGQQAGKRRTFRDLIREY
FT                   RLTGRARRLAIRPGSPMVGQRLDDLKLRERYGANVIGVERWRRFRRVIVNVNGVSEFRA
FT                   RDVLLIDMSAAEVDLREFCAEQLLEPMVLRGEYFSDQALDVGMAEISLIPESELIGKSV
FT                   REIAFRTRYGLNVVGLKRDGVALEGSLADEPLLMGDIILVVGNWKLISLLGQKGRDFVV
FT                   LNMPVEVSEASPAHSQAPHAIFCLVLMVALMLTDEIPNPIAAIIACLLMGKFRCIDAES
FT                   AYKAIHWPSIILIVGMMPFALALQKTGGVSLVVQGLMDIGGGYGPYMMLGCLFVLCAVI
FT                   GLFISNTATAVLMAPIALAAAKSMGVSPYPFAMAVAMAASAAFMTPVSSPVNTLVLGPG
FT                   NYSFSDFVKLGVPFTLIVMAVCIVMIPMLFPF"
FT   gene            complement(601829..602428)
FT                   /locus_tag="SPAB_00644"
FT   CDS_pept        complement(601829..602428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00644"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2332 6.0e-102 putative hydrolase of HD
FT                   superfamily K08722; COG: COG1896 Predicted hydrolases of HD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00644"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66070"
FT                   /db_xref="GOA:A9N4B8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR022971"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N4B8"
FT                   /inference="protein motif:HMMPfam:IPR006674"
FT                   /inference="protein motif:HMMSmart:IPR003607"
FT                   /inference="similar to AA sequence:INSD:AAV76534.1"
FT                   /protein_id="ABX66070.1"
FT                   /translation="MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALA
FT                   AIKNRKFGGQLNAERIALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKL
FT                   VDMAPDELRDIFAPLIDENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRL
FT                   EKTLELRRSQEMDYFMAVFVPSFHLSLDEISQDSPL"
FT   gene            complement(602522..603736)
FT                   /locus_tag="SPAB_00645"
FT   CDS_pept        complement(602522..603736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00645"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2332 8.7e-220 yfbQ; putative
FT                   aminotransferase (ortho), paral putative regulator K00812;
FT                   COG: COG0436 Aspartate/tyrosine/aromatic aminotransferase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66071"
FT                   /inference="protein motif:FPrintScan:IPR001176"
FT                   /inference="protein motif:HMMPfam:IPR004839"
FT                   /inference="similar to AA sequence:INSD:AAL21232.1"
FT                   /protein_id="ABX66071.1"
FT                   /translation="MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAP
FT                   FGFEAPDEILVDVIRNLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGV
FT                   SELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRA
FT                   KITPRTRGIVIINPNNPTGAVYSKELLMEIVNIAREHNLIIFADEIYDKILYDDAEHHS
FT                   IAALAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVP
FT                   AQHAIQTALGGYQSISEFILPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPRIDA
FT                   KRFNIHDDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPREDDLEMAINRFGRFL
FT                   SGYHQ"
FT   gene            604669..605607
FT                   /locus_tag="SPAB_00646"
FT   CDS_pept        604669..605607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00646"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 3.3e-05 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00646"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66072"
FT                   /inference="protein motif:FPrintScan:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461272.1"
FT                   /protein_id="ABX66072.1"
FT                   /translation="MINANRPIINLDLDLLRTFVAVADLNTFAAAAAAVCRTQSAVSQQ
FT                   MQRLEQLVGKELFARHGRNKLLTEHGIQLLGYARKILRFNDEACSSLMFSNLQGVLTIG
FT                   ASDESADTILPFLLSRISSVYPKLALDVRVKRNAYMVDMVKSQEVDLVVTTNQPHSLDC
FT                   LNLRTSPTHWYCAAEYVLQRGEPVPLVLLDDPSPFRDMVLETLNAAGIPWRLAYVASTL
FT                   PAVRAAVKAGLGVTARPVEMMSPDLRVLGAADGLPPLPDTEYLLCRDPNSQNELAMVIF
FT                   HAMESYQNPWHYNQFSAEGGDDPLMVEGGFE"
FT   gene            605687..605839
FT                   /locus_tag="SPAB_00647"
FT   CDS_pept        605687..605839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00647"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG34329 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00647"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66073"
FT                   /inference="similar to AA sequence:INSD:AAL21230.1"
FT                   /protein_id="ABX66073.1"
FT                   /translation="MPICTRLTAQIVKVAVNQPVAIRSSMWAKNNQNIHFMNLHVKKLE
FT                   KLLLF"
FT   gene            605927..606043
FT                   /locus_tag="SPAB_00648"
FT   CDS_pept        605927..606043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00648"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66074"
FT                   /protein_id="ABX66074.1"
FT                   /translation="MCYFFCFTTDTIQQHKIPPGRRVIFSRMALNVNGDELM"
FT   gene            complement(606131..606253)
FT                   /locus_tag="SPAB_00650"
FT   CDS_pept        complement(606131..606253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66076"
FT                   /protein_id="ABX66076.1"
FT                   /translation="MDVDILIAYSSKVAPVSLLFTADGRHIDSWGGIKKTLQLL"
FT   gene            606234..606677
FT                   /locus_tag="SPAB_00649"
FT   CDS_pept        606234..606677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00649"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0536 3.9e-75 nuoA; NADH dehydrogenase I
FT                   chain A K00330; COG: COG0838 NADH:ubiquinone oxidoreductase
FT                   subunit 3 (chain A); Psort location: CytoplasmicMembrane,
FT                   score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00649"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66075"
FT                   /db_xref="GOA:A9N4C4"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N4C4"
FT                   /inference="protein motif:HMMPanther:IPR000440"
FT                   /inference="protein motif:HMMPfam:IPR000440"
FT                   /inference="similar to AA sequence:INSD:AAV76538.1"
FT                   /protein_id="ABX66075.1"
FT                   /translation="MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARH
FT                   KNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAA
FT                   IFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR"
FT   gene            606693..607355
FT                   /locus_tag="SPAB_00651"
FT   CDS_pept        606693..607355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00651"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0537 2.0e-119 nuoB; NADH dehydrogenase I
FT                   chain B K00331; COG: COG0377 NADH:ubiquinone oxidoreductase
FT                   20 kD subunit and related Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00651"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66077"
FT                   /db_xref="GOA:A9N581"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9N581"
FT                   /inference="protein motif:HMMPfam:IPR006137"
FT                   /inference="protein motif:HMMTigr:IPR006138"
FT                   /inference="protein motif:ScanRegExp:IPR006138"
FT                   /inference="similar to AA sequence:INSD:AAV76539.1"
FT                   /protein_id="ABX66077.1"
FT                   /translation="MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDM
FT                   VNWGRKNSIWPYNFGLSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFT
FT                   KMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPE
FT                   AYMQALMLLQESIGKERRPLSWVVGDQGVYRANMQPERERKRGERIAVTNLRTPDEI"
FT   gene            607442..609244
FT                   /locus_tag="SPAB_00652"
FT   CDS_pept        607442..609244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAB_00652"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0538 0. nuoC; NADH dehydrogenase I
FT                   chain C; chain D K00332:K00333; COG: COG0649
FT                   NADH:ubiquinone oxidoreductase 49 kD subunit 7; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SPAB_00652"
FT                   /db_xref="EnsemblGenomes-Tr:ABX66078"
FT                   /db_xref="GOA:A9N582"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT