(data stored in ACNUC7421 zone)

EMBL: CP000895

ID   CP000895; SV 1; circular; genomic DNA; STD; PRO; 23317 BP.
XX
AC   CP000895;
XX
PR   Project:PRJNA16725;
XX
DT   20-APR-2008 (Rel. 95, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Mycobacterium marinum M plasmid pMM23, complete sequence.
XX
KW   .
XX
OS   Mycobacterium marinum M
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium.
OG   Plasmid pMM23
XX
RN   [1]
RP   1-23317
RX   DOI; 10.1101/gr.075069.107.
RX   PUBMED; 18403782.
RA   Stinear T.P., Seemann T., Harrison P.F., Jenkin G.A., Davies J.K.,
RA   Johnson P.D., Abdellah Z., Arrowsmith C., Chillingworth T., Churcher C.,
RA   Clarke K., Cronin A., Davis P., Goodhead I., Holroyd N., Jagels K.,
RA   Lord A., Moule S., Mungall K., Norbertczak H., Quail M.A.,
RA   Rabbinowitsch E., Walker D., White B., Whitehead S., Small P.L., Brosch R.,
RA   Ramakrishnan L., Fischbach M.A., Parkhill J., Cole S.T.;
RT   "Insights from the complete genome sequence of Mycobacterium marinum on the
RT   evolution of Mycobacterium tuberculosis";
RL   Genome Res. 18(5):729-741(2008).
XX
RN   [2]
RP   1-23317
RA   Stinear T.P., Seemann T., Harrison P.F., Jenkin G.A., Pidot S.J.,
RA   Davies J.K., Small P.L.C., Johnson P.D.R., Brosch R., Cole S.T.,
RA   Ramakrishnan L., Parkhill J.;
RT   ;
RL   Submitted (19-NOV-2007) to the INSDC.
RL   Pathogen Sequencing Unit, Wellcome Trust Sanger Institute, Wellcome Trust
RL   Genome Campus, Hinxton, Cambridge CB10 1SA, United Kingdom
XX
DR   MD5; 0ca116f793a135de37bd1db4323ebc7e.
DR   BioSample; SAMN02604327.
DR   EuropePMC; PMC2336800; 18403782.
DR   EuropePMC; PMC2600814; 19104652.
DR   EuropePMC; PMC2737907; 19592526.
DR   StrainInfo; 352440; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..23317
FT                   /organism="Mycobacterium marinum M"
FT                   /plasmid="pMM23"
FT                   /strain="M"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:216594"
FT   gene            241..1317
FT                   /gene="repA"
FT                   /locus_tag="MMAR_p01"
FT   CDS_pept        241..1317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="MMAR_p01"
FT                   /product="replication protein, repA"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p01"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43895"
FT                   /db_xref="UniProtKB/TrEMBL:B2I410"
FT                   /protein_id="ACC43895.1"
FT                   /translation="MWTSRAGWLDGLSRWVHSPAFGALCAEARVSITTATLLSIAAVMA
FT                   EHADHGTGRHVAVTRATIADRVGCDVRTVTAAWRVLRVSRWAVEAQRGHGSTSTPSVGR
FT                   RPSVYHLVPRREVRPVTPPLVHDFHLPPSGGVGCSSPVGNYSPSGRASAPAIRSCDKTR
FT                   QARPRRATARPLATQKLAAGLVALTHGLDRAHIGAICDALTSVGIDPAVWSARAVNDAL
FT                   NADMRARGTTWPDHIANPGAFLASRLRRLSWTSPDTAPTKAGSIDQTPRPVVLTDAARA
FT                   RITAAREEIRRVLTERAQLSREDQTSSTPAASSRRDIRLAVQTRHGGAMNRLAEDHRAV
FT                   RGDAMERAPLNVPVRRRT"
FT   gene            1634..4966
FT                   /locus_tag="MMAR_p03"
FT   CDS_pept        1634..4966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p03"
FT                   /product="ATP-dependent exodnase (exonuclease V)"
FT                   /function="probably involved in DNA helix relaxation."
FT                   /note="similar to AA sequence INSD:AY056023"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p03"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43896"
FT                   /db_xref="GOA:B2I411"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2I411"
FT                   /protein_id="ACC43896.1"
FT                   /translation="MLTIAKLGAWSVAYYVDTARSAAAAALESRAAGGGLGEYYSESET
FT                   RLPVWFSAGRDTTAARGLTGAGRAGENADLDAVTRWLDDGESPCGASGRAFQKRAGVHG
FT                   YDLTFCAPKSVSLMRGLGNDVTVKAVADAHAFAITEAMEYLAEHGGYTRVHNPRTGEKD
FT                   LVRLPGIVAAGFQHETSRAGDPHLHTHVLVPNRQARADGRLVSLDGTSLYHEAKAAGII
FT                   YQATLRRELTRSIGVEWNDVDPHTGMADIAGADRGDLRSWSTRSTQLREWASGHLRVEC
FT                   DELSAAQLATAQKATRPRKPEGVAWASLRVAWADDTRTFRVDETVQQAARDARRAAGVD
FT                   YAEVVRRAVSHGLRKAAFTRADLIEAIGARMPVDDADGPSPREVIERLADGVALRIGDE
FT                   RAAHQREGSIRYTAADLVAEERAIIEVMGRRHSAAVLPSVDTAGLSPDQARAVTAIATS
FT                   ERLVQPLSAPAGAGKTHSLRALRAAAHDAGKRVLVAAPTGRAVDVAVREQAGDHGATLD
FT                   ALLGRLERGQEVLDADTVVVVDEAGMVGTQHLRRLLERATAAGTKVVLVGDEHQLAPVA
FT                   QRGGTFAQLVTDLPWAQRLSQVWRMHDHDERNASLAVRDGGPAALRRAVGWYRRHDRLH
FT                   IGDQVTMADDAVAAWTADVAAGRDGLLIADRWEMADALNIRIHSERISDDAPTVAAARG
FT                   HRVAAGDVVITRQNTTDIPTRTDRGADADPIRNGQRWEVLAVDPDAGRIAARRLDDRAV
FT                   AVLSGDYLRQYTHLGYAVTVHAAQGVTADTCHTLLSAEAATRSIAYVGLTRGRHTNTVR
FT                   LYDTRAGEADHEHADPIATGVHTARRGTPAQAATALRSVLGRDDRAATITAAAADEDRL
FT                   PDQVADLRRHHRTVTARLRREHRIDRHAAHDRSAHASDRALVEVLAATHRYGTPLPSSQ
FT                   QRSDPVAVALSAPYVVTTLAADRYTPDLADTVRQAAAGTDRRYVQIAAAPSRPDQRRLD
FT                   QFAERLTAHPPSPREVVVVEDAAAADPAHLAAVATALVPARGRLLLIDSGEPGPGRRLL
FT                   DGLALPWSENARPTPDVADPALAALADSHRAAADRSWRILNPPHRDRGRERTRDQGYGL
FT                   ELD"
FT   gene            complement(4978..5739)
FT                   /locus_tag="MMAR_p04"
FT   CDS_pept        complement(4978..5739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p04"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p04"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43897"
FT                   /db_xref="UniProtKB/TrEMBL:B2I412"
FT                   /protein_id="ACC43897.1"
FT                   /translation="MTTPEGADGAAWRVELERWHAELANTIYQASLWAREFHVRTGDRL
FT                   RGDSSAPPSYPLLGYAERLETIGATLKMVCANASLNPPIPRWDRATLSAPSPIRVPGRD
FT                   PDWRDADYFEGGRYLLLIRPSAPTSDIVTAQQHWRTALGFAAPSVLESHLGIPQLAVYA
FT                   EQAQGLFDIAHDTIRAAFRDSVAATYGRIWATWPTSEDSERPLLMWLRELAQFGCPVDE
FT                   CEAVLRDIEAVDPQAVARCREAGAWWRLDAG"
FT   gene            complement(5736..8180)
FT                   /locus_tag="MMAR_p05"
FT   CDS_pept        complement(5736..8180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p05"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p05"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43898"
FT                   /db_xref="UniProtKB/TrEMBL:B2I413"
FT                   /protein_id="ACC43898.1"
FT                   /translation="MAAVGSSAGSYGRLIVTPDMEPPDASHWDAQEQAYRASATAWDGI
FT                   HQKIVTDNAAFRDAADSRGFDEAHRAGAVLAEEAKTIAEWHDKVANKCADIATVLRDTR
FT                   AGQEQLIREADPKIAAAKLPGEAEALVAQYHGMARYQTEAGVTAAMAAHTSFKKSSENV
FT                   RALDLLTKWGDVPAAPPAQPLDNPSPGIEQDEDPRRYTEKPKAGADAPEPVADAPTDKA
FT                   GTSVTQPGVSPGADAGTGKADVGDEGLATSSPVTQPGMTPAPRPAAASPLGGGAPSMSG
FT                   LGSGGGGMGSGGGIPKMPGGLGSGGMPGTGSNPLSGVGQMPGAGSGLPNAGGLPTASNA
FT                   GGASPLSAFNQGAAATAGMGGGIPPAPPPAPASPSPAPSAGGHAAPAAAAPGGGVSPAA
FT                   AQPGVVAPAAPASAPTGVGVGAGGGAPMMLPPGSMGPPAAAIPPPAATVPAGTVGSTNT
FT                   APAAPTSAAAGAAAGPTLIPASVVAAGQTAAAQERRESADAAAARELVSKLQHAAYLAG
FT                   SPMTGWAVGVFRSPSGTEIVITTNDGAGYIPAGVFVPRSVRVLATDPLVDNDFRQLWFG
FT                   WADPAQILVEYAQLRAQWGWRLVAAASTLPTPALRDAGVEHPPACTRETNPLLQPGVQV
FT                   PAPVLDDMHAHRLALLWPEMYPRLLRIMDADPIYQDRIVSAVTAALIRAATSQAQPVDI
FT                   PDAVRHIWEIRGGDREPTTQQWAKYNAEAQIFNGTTAMTRPAFMTGGAGHPRDYSEDLA
FT                   VYRAHWLVARTAEHIGGWAARPLPLPDMCYGAVLSGDTELSDMIVRALVSVEEDLHYEA
FT                   PR"
FT   gene            complement(8180..8707)
FT                   /locus_tag="MMAR_p06"
FT   CDS_pept        complement(8180..8707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p06"
FT                   /product="conserved hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p06"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43899"
FT                   /db_xref="UniProtKB/TrEMBL:B2I414"
FT                   /protein_id="ACC43899.1"
FT                   /translation="MTMGYRRPHRTGVAVAATALVIAAGAAVTSGLALVRPIAPAQHTV
FT                   NVVAPPPAAHSSSETQAAKATACAAWDRAARSTALASKSSAEALEQSWTSPKSLAALAT
FT                   EKRTGVAAVSYLRTQLSDATPASTAIPLHEWMSANIDMLHALNMRHWDDADRQLKRGND
FT                   LTDVLTSECGLR"
FT   gene            complement(8874..9464)
FT                   /locus_tag="MMAR_p07"
FT   CDS_pept        complement(8874..9464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p07"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p07"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43900"
FT                   /db_xref="UniProtKB/TrEMBL:B2I415"
FT                   /protein_id="ACC43900.1"
FT                   /translation="MTSKIGPWEEAITLAADWIWERSREEDLAPLLVSNAQNAASFGYA
FT                   DLDEIIRAGGHATPQSRSRPDRGPVLTFVPDERSLHFAMGLARGYSLAVVEGSTSLAEW
FT                   AAGAAAINLLTGQVTTSQVDDDVRKDLDSVIFYGGRNGWTGADEKAQVRRFLSDHIGGG
FT                   RLTPDQAAAYALSSQSVSDRGAKRLRELLSRNR"
FT   gene            complement(9522..10106)
FT                   /locus_tag="MMAR_p08"
FT   CDS_pept        complement(9522..10106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p08"
FT                   /product="site-specific DNA recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p08"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43901"
FT                   /db_xref="GOA:B2I416"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B2I416"
FT                   /protein_id="ACC43901.1"
FT                   /translation="MTAILGYARVSTLGQDLDAQLAALAAQGVESGRIFTDKLSGTVNT
FT                   VRPGLAALLHYAREGDTVVVTAIDRLGRSVAEVTRTIADLGERRILLRALRESVDTGTP
FT                   TGRAVATIMATLAELELELGRERRAASRDSRRARQLPATKPAKLTPERQEQLRRLAGTG
FT                   EPVPELAQAFGISRATAYRYLAKLSSQSGVA"
FT   gene            complement(10305..11657)
FT                   /locus_tag="MMAR_p09"
FT   CDS_pept        complement(10305..11657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p09"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p09"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43902"
FT                   /db_xref="GOA:B2I417"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2I417"
FT                   /protein_id="ACC43902.1"
FT                   /translation="MTARFDVIVIGAGMAGIAAANKCGAQGWRVAIVDSLPYGGTCALR
FT                   GCDPKKILRRGAEIIDASRLMRGKGIDEGQIRINWTDLMRHKRGFTDPAPANMENDLRR
FT                   HGVQTLHGQARFVDAHQISVGDDVHHTERFLVATGARPRPLQFDGHEHLIDSTQFLDLE
FT                   DLPPRIVFVGGGYISFEFAHIAARAGSHPIILDHGPRPLKGFDPDLVDLLIGRGVAAGV
FT                   DVRASTTVTAVRATATGYQVQVNQDGTDATIDADVVVHGAGRLPELADLDLDRAGIAWS
FT                   ERGIRVQPHLQSTTQPGVYAAGDAADTAGPPLTPVAVIEGKVAASNMLKAASTVPDYTG
FT                   IPSAVFTIPELARVGLLEAEARDQGLNIDVRYSDASTWYSSYRIGEGTAAAKILVNKDD
FT                   DRIVGAHLLGPDYTEHANTIAVAIKLGLTTRQLKTTTAAYPTLGSDLGSML"
FT   gene            complement(11654..12310)
FT                   /gene="merB"
FT                   /locus_tag="MMAR_p10"
FT   CDS_pept        complement(11654..12310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merB"
FT                   /locus_tag="MMAR_p10"
FT                   /product="Alkylmercury lyase, MerB"
FT                   /function="Alkylmercury lyase cleaves the carbon-mercury
FT                   bond of organomercurials such as phenylmercuric acetate"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p10"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43903"
FT                   /db_xref="GOA:B2I418"
FT                   /db_xref="InterPro:IPR004927"
FT                   /db_xref="InterPro:IPR024259"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2I418"
FT                   /protein_id="ACC43903.1"
FT                   /translation="MNPDIAQLAHRLNDSLGGDNPGSTPWMLRPLLDLLAHGAPVTIDQ
FT                   LADATATTVEQVRHALTAMSDTEYDEHGRIIGSGLTLRPTPHRFDIDGRQLYTWCALDT
FT                   LIFPGILGRTAHVTSPCHSTGQPVHLTIDTHGITNVEPTTAVVSIVIPDHPASIRTAFC
FT                   HHVHFFATREAAEPWLAENPAATVVSVADAYQLGRPLTQSLLKGTSPSRCTQVGR"
FT   gene            complement(12357..12872)
FT                   /gene="merH"
FT                   /locus_tag="MMAR_p11"
FT   CDS_pept        complement(12357..12872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merH"
FT                   /locus_tag="MMAR_p11"
FT                   /product="Mercuric ion transport protein, MerH"
FT                   /function="transports mercuric ions across the inner-
FT                   membrane via a pair of cysteine residues located in the
FT                   first transmembrane region but only when co-expressed with
FT                   the mercuric reductase"
FT                   /note="Contains four transmembrane domains."
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p11"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43904"
FT                   /db_xref="GOA:B2I419"
FT                   /db_xref="InterPro:IPR004891"
FT                   /db_xref="UniProtKB/TrEMBL:B2I419"
FT                   /protein_id="ACC43904.1"
FT                   /translation="MTVPPTPAIDHATTALPPRWQRWLPRAAALMAGFATLCCLGVTAL
FT                   VSLLTAIGATFLTTDAALRPLLIVSLVITIAGSAATWHRHRNPLPLLLTVVAAVIIFLS
FT                   LNGNALFGHASAGHGGDPMGDGMGGHTAGAGMPGGVGVWIGLALLIIAQVWDIWRLRQL
FT                   KRQNACAA"
FT   gene            complement(12901..14319)
FT                   /gene="merA"
FT                   /locus_tag="MMAR_p12"
FT   CDS_pept        complement(12901..14319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merA"
FT                   /locus_tag="MMAR_p12"
FT                   /product="mercuric reductase, MerA"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p12"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43905"
FT                   /db_xref="GOA:B2I420"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR021179"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2I420"
FT                   /protein_id="ACC43905.1"
FT                   /translation="MGYDLAIIGSGGAAFAAAIAATTAGRRVVMIERATIGGTCVNVGC
FT                   VPSKALLAAADALHGASTAARFPGIAASAAPVDGPALMTGKDALVQTLRGEKYVDLAAH
FT                   YGWDVVEGDAQFVGDAGGPCLTVETPGGATLHVEAEHYLIATGSAPWAPPVDGLADTGS
FT                   LTSTTAMDLDRLPESMIVLGGGYVGLEQAQLFARLGTVVTVVTRSPLLSAEEPEVSAVL
FT                   ADVFGDEDIRVHTHTTVTGVRRDEHGYSLTAERGTQRLALHAEQLLVATGRRPVTAGLN
FT                   LDAVGVKTGPRGEVLVDDHLRSTTARIWAAGDVTGGPQFVYVAAAQGTLVADNAFGRAA
FT                   RTLDYTALPRVVFTSPAVASVGMTDAQATAAGIQCDCRTIPLQYVTRAIVNRDTRGLVK
FT                   LVAAADTGRLLGVHVVAENAGDVITAATYALTAGMTVEQLAHTWAPYLTMAESLKLAAQ
FT                   AYTTDVATLSCCAS"
FT   gene            14458..14841
FT                   /locus_tag="MMAR_p13"
FT   CDS_pept        14458..14841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p13"
FT                   /product="transcriptional repressor protein, MerR"
FT                   /function="Transcriptional repression of the mer operon in
FT                   the absence of mercuric ions"
FT                   /note="Proposed that MerR binds to inverted repeat and
FT                   represses transcription of merA in the absence of mercuric
FT                   ions and negatively regulates its own expression in the
FT                   presence of mercuric ions."
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p13"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43906"
FT                   /db_xref="GOA:B2I421"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2I421"
FT                   /protein_id="ACC43906.1"
FT                   /translation="MTCRTDPRLAFLPETDTGVEMVAKFFRALGDPGRLRLLEFLVSTE
FT                   HTVTECVTHLGLAQSRVSSHLACLSDCGYVQVRREGRFAHYKVADPRVADLVMLARSLA
FT                   ADNAAALADCVRITAAEAPQVPA"
FT   gene            14841..15275
FT                   /gene="merT"
FT                   /locus_tag="MMAR_p14"
FT   CDS_pept        14841..15275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merT"
FT                   /locus_tag="MMAR_p14"
FT                   /product="mercuric transport protein, MerT"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p14"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43907"
FT                   /db_xref="GOA:B2I422"
FT                   /db_xref="UniProtKB/TrEMBL:B2I422"
FT                   /protein_id="ACC43907.1"
FT                   /translation="MATKRTSPSVAGILGLVGIGVLPLLCCAGPALIAGGALGALGGVL
FT                   GNPWLIGATAVLVIAAVGYALRRHRRQDCHTASTDRKSYIMTAVVATSADAPVRCPRIL
FT                   SQTGGNGDTLKDTDGSRPGPQAALVGPEKTVPPERVRTCR"
FT   gene            15272..15868
FT                   /locus_tag="MMAR_p15"
FT   CDS_pept        15272..15868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p15"
FT                   /product="site-specific DNA recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p15"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43908"
FT                   /db_xref="GOA:B2I423"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B2I423"
FT                   /protein_id="ACC43908.1"
FT                   /translation="MTLLGYARVSTLHQSPDMQTKALTEAGAERIWTERMSGARDDDRP
FT                   ELAALLDYARRGDVLMVWRLDSLGRSLPHLLTVASDLQARGIELRSLTEAIDTSTAGGR
FT                   LIFHVFGAVAEFERAVAAERTAAGVAAARAAGRHPGRPGLTADTIAAVQALDEAGTPRA
FT                   QNRAHPRHIPLQRLPLPRPTAAVSLRQAGDLILRR"
FT   gene            15865..16044
FT                   /locus_tag="MMAR_p16"
FT   CDS_pept        15865..16044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p16"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p16"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43909"
FT                   /db_xref="UniProtKB/TrEMBL:B2I424"
FT                   /protein_id="ACC43909.1"
FT                   /translation="MTEENGDTQGCSSAPGELDDWPIDVADVRESLREAEADIAAGRTF
FT                   GEDEIRARYGVPRK"
FT   gene            16052..16195
FT                   /locus_tag="MMAR_p17"
FT   CDS_pept        16052..16195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p17"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p17"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43910"
FT                   /db_xref="UniProtKB/TrEMBL:B2I425"
FT                   /protein_id="ACC43910.1"
FT                   /translation="MIHAEAEPDPDDLDAGYAQLASEFNSETADVERRAARDRYAGRTG
FT                   EA"
FT   gene            complement(16219..16515)
FT                   /locus_tag="MMAR_p18"
FT   CDS_pept        complement(16219..16515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p18"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p18"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43911"
FT                   /db_xref="UniProtKB/TrEMBL:B2I426"
FT                   /protein_id="ACC43911.1"
FT                   /translation="MAGEGHHVLTDDDVQALDRRAREVGDVIGWDLQFVVAPNAEYVGL
FT                   AAGGGAEHADEIIVLGPSRITDLAVHEIDLALDALQRGERHIILDEDGDPRLI"
FT   gene            complement(16515..16748)
FT                   /locus_tag="MMAR_p19"
FT   CDS_pept        complement(16515..16748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p19"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p19"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43912"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B2I427"
FT                   /protein_id="ACC43912.1"
FT                   /translation="MIRTTVEALGGAQAVPSELIPVRELHQRLIDQVTTSGGNVVLADT
FT                   AGKPAAVVMSLQRYEQLLDELNTLRRRTADNA"
FT   gene            complement(16837..17277)
FT                   /locus_tag="MMAR_p20"
FT   CDS_pept        complement(16837..17277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p20"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p20"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43913"
FT                   /db_xref="UniProtKB/TrEMBL:B2I428"
FT                   /protein_id="ACC43913.1"
FT                   /translation="MTTIKHLTALINASSLGTRTGRVARRSVTAAEGDALARRAAESGQ
FT                   GHDDSEKFRGRADERTYRPVSGSTPGRTNRKDKTMAKGHHRSATTGRYVKASTAARNPK
FT                   TTVTERGSNRSSGTHHRSAITGKFVKGSTAARHPNTTVTERG"
FT   gene            complement(17274..18095)
FT                   /locus_tag="MMAR_p21"
FT   CDS_pept        complement(17274..18095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p21"
FT                   /product="transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p21"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43914"
FT                   /db_xref="UniProtKB/TrEMBL:B2I429"
FT                   /protein_id="ACC43914.1"
FT                   /translation="MDRPARRPGPPVDAARLQPDNQGDIQGVDEGLVGTWLDDPDLAAE
FT                   LADELERLRRLQADEELLLTLQLEQFTGRLWERFSRELTRYGLGVLRAWIRHGTIYGKA
FT                   KALTGYGLGRIEGWPDDQTIDDIATDTVVAALIYFRDKVLKTHRWQSSGGASLGTFFIG
FT                   QCLYQFANIYRSALRAEKERIREATTPTDELPEDRFDVIKGIEETIVANDTVAEAMALL
FT                   TTDRARRALFLQEHGFTQREIADKLGLRDAKSVENLLGHQLRQLRNRKRTS"
FT   gene            18462..19307
FT                   /locus_tag="MMAR_p22"
FT   CDS_pept        18462..19307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p22"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p22"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43915"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:B2I430"
FT                   /protein_id="ACC43915.1"
FT                   /translation="MAPGQRGGVRGLLPVMLPRTTKRSPVVETPQQAEARRAAALDRAI
FT                   STPRYASYLNAAGQDADRARKLYVWDRDLSTAVLADLAIVEVALRNALHNALTSTYGPE
FT                   WYQNIALDDRSMKQVERAWGYLRNPRQGHPSTPGRVIAQCTFGMWVNLLDAGGYAGREP
FT                   RRVHADYEQLWRSTLRSAFPGGRIEARNDPSPHASFTRTWVHSVAKTVNVLRNRVAHHE
FT                   PLHNGFPLPGQRSGQQQPNRLTAAEGVEAYMKLTRMIDRNLAEWIVNNTKVTTLLATRP
FT                   "
FT   gene            19405..20235
FT                   /gene="parA"
FT                   /locus_tag="MMAR_p23"
FT   CDS_pept        19405..20235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="MMAR_p23"
FT                   /product="chromosome partitioning protein, ParA"
FT                   /function="involved in chromosome partition. Localize to
FT                   both poles of the predivisional cell following completion
FT                   of DNA replication (by similarity)."
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p23"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43916"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2I431"
FT                   /protein_id="ACC43916.1"
FT                   /translation="MQIDRLPVMTVSADKQCEILAVALQKGGVGKTTTTINLGANLAAM
FT                   GLRILVIDMDQQAHSTKGLGIELDAEDASMYEVLHPDRAMRVPLAKVIVPTQFGIDVAP
FT                   GHLALKELERTGLGSGGQLRLARQLDDIEGYDFVLLDCPPALGELTTAALAAADYVLAV
FT                   LKAGPDEVDGLVELGNSILDVQETLNPDVEIRYVLLADFDGNPKASKDVRRQLRADWGE
FT                   WSDGGAYLGEIPHTVRVVEAKGKRVPVNVHAPTSTAAVAYREVAERIAARRHAA"
FT   gene            20232..20624
FT                   /locus_tag="MMAR_p24"
FT   CDS_pept        20232..20624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p24"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p24"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43917"
FT                   /db_xref="UniProtKB/TrEMBL:B2I432"
FT                   /protein_id="ACC43917.1"
FT                   /translation="MNAASKPAGLQVGSTRPLSRAERRAQAARVTADETAPAAPEPQNT
FT                   DIPPAPVATPPDGEQEARQAEPVRLKARLRKVKSPFATQLHAGTLARLEWIKARGYVIT
FT                   DTVDEAINRYLDNAGIPKPDRNDRMP"
FT   gene            21101..21307
FT                   /locus_tag="MMAR_p25"
FT   CDS_pept        21101..21307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p25"
FT                   /product="hypothetical membrane protein"
FT                   /note="contains two transmembrane domains and a potential
FT                   signal peptide sequence"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p25"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43918"
FT                   /db_xref="GOA:B2I433"
FT                   /db_xref="UniProtKB/TrEMBL:B2I433"
FT                   /protein_id="ACC43918.1"
FT                   /translation="MSESILIAVAIIVVAITVLGLAICVLAGYLARIPDCKVTIGEVGR
FT                   AIGAIVGVGIEAVATIITSARRP"
FT   gene            complement(21510..21737)
FT                   /locus_tag="MMAR_p27"
FT   CDS_pept        complement(21510..21737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p27"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p27"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43919"
FT                   /db_xref="UniProtKB/TrEMBL:B2I434"
FT                   /protein_id="ACC43919.1"
FT                   /translation="MPDSAGDALDGGAPDAGGSALPLRKRQQKVPLNTYVRPGTQQRVE
FT                   VLKDRGYAVTDIVDAALNEFLDRAGVPPSE"
FT   gene            21820..22098
FT                   /locus_tag="MMAR_p30"
FT   CDS_pept        21820..22098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p30"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p30"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43920"
FT                   /db_xref="UniProtKB/TrEMBL:B2I435"
FT                   /protein_id="ACC43920.1"
FT                   /translation="MDTLGTVQDDVSAVRDFASQVRALCAQLTANPFNTPAAEKLLDLL
FT                   LEDAPAVDLAFQRVLRSVIYEPASTGAPILDMLGGPRCTALVVGAAA"
FT   gene            22110..22430
FT                   /locus_tag="MMAR_p31"
FT   CDS_pept        22110..22430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p31"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p31"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43921"
FT                   /db_xref="UniProtKB/TrEMBL:B2I436"
FT                   /protein_id="ACC43921.1"
FT                   /translation="MSTPSPPPKPGSTEHWQAWLQRYGGDYTDDAERRAAYRDFTTNLD
FT                   TIQAVFSQSDDMHVAGYLEAHERVASGDADSPDAAETWVPGHLTGHARADWLEGFRSHF
FT                   EP"
FT   gene            complement(22453..22839)
FT                   /locus_tag="MMAR_p32"
FT   CDS_pept        complement(22453..22839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p32"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p32"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43922"
FT                   /db_xref="UniProtKB/TrEMBL:B2I437"
FT                   /protein_id="ACC43922.1"
FT                   /translation="MVIDSLELEAAIATVYAAQLPIPVWWPAEARAAFIEEYASEAACL
FT                   VLSELDAINDRMSDWTARSQVSGADESTMIASAQQVLLDEACSEVQYDLTEMIASRSAQ
FT                   LMAEAVFDHSPPRAQHHVVWPVQR"
FT   gene            complement(22833..23135)
FT                   /locus_tag="MMAR_p33"
FT   CDS_pept        complement(22833..23135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_p33"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_p33"
FT                   /db_xref="EnsemblGenomes-Tr:ACC43923"
FT                   /db_xref="UniProtKB/TrEMBL:B2I438"
FT                   /protein_id="ACC43923.1"
FT                   /translation="MAGESHRQRQNLLVEFANSLGPPDRDSEQVGRKLADACAAFGGHF
FT                   TKPGVDGCVSANLDLLTRTFVRLGHGPDPYAKRSMYLVPTRAHPVPPFTRLPFEW"
XX
SQ   Sequence 23317 BP; 3711 A; 7898 C; 7925 G; 3783 T; 0 other;
     ttgataggca agtctcacgg tagcgcacgc ctcgaagctg caccagattc ggcgcgcgat        60
     cggtgcgcaa accgtgacct tttgaacgcc cgcgtacgtc gggcggacag tgcttggccg       120
     acgccgctcg gcgctgctgt agcccctgct gctcccagcc ctcatgtggt gcgggcactg       180
     gcgcatgagc gtcgccgtga gtgggtgacg cgcgcgggct cttgcgcacc gtctgcgccg       240
     atgtggacca gtcgcgcggg ctggctcgac gggttgtcgc ggtgggtgca ctccccggcg       300
     ttcggcgcgc tgtgcgctga ggcgcgggtg tcgatcacca cggccacgtt gttgtcgatc       360
     gccgctgtga tggccgagca cgccgatcac ggcaccggcc gccacgtcgc ggtcacccgc       420
     gcgacaatcg ccgacagggt ggggtgtgac gtgcgcaccg tgaccgccgc gtggcgcgtg       480
     ctgagggtct ccagatgggc cgtggaggcg cagcggggcc acggttcgac aagcactccc       540
     agcgtcggcc gcagaccctc ggtgtaccac ctggtgccgc gtcgcgaagt acgtccagtg       600
     acgccaccgc ttgtgcatga tttccaccta ccgccgtcag gcggtgttgg ttgttcttct       660
     cccgtaggga attactcacc aagcgggcgc gcgagcgcgc ccgccatccg aagctgcgac       720
     aaaacgcgac aagcacggcc gcggcgcgct accgcgcgac cgctggccac ccagaaactg       780
     gccgctggac tggtcgcgct cacccacggt ctcgaccgcg cccacatcgg tgccatctgc       840
     gatgcactca ccagcgtcgg catcgacccc gcggtgtggt ccgcgcgtgc ggtcaacgac       900
     gccctcaacg ccgacatgcg cgcccgagga acgacctggc ccgaccacat cgccaacccc       960
     ggcgcgttcc tcgccagccg gttgcgacgg ctgtcctgga catcccccga cacggccccg      1020
     acaaaggccg gcagcatcga ccagacgccg cgcccagtgg tgctcaccga cgcagcgcga      1080
     gcccggatca ccgccgcccg agaagagatc cgccgagtgc tcaccgagcg cgcccaactc      1140
     agccgtgagg accagaccag cagcacgccc gccgcgtcgt cgcggcgcga catccggctg      1200
     gcggtccaga cacggcacgg cggcgcgatg aaccgactcg cagaagacca ccgcgccgtc      1260
     cgcggagacg cgatggagcg cgcaccgttg aacgttccgg ttcgacgacg cacctagtgg      1320
     ttgcgaaccg gcgcgctgac gttgcggcca gacgcgactc tcagcacccg caccagcgcc      1380
     ctcttcgtcg cttctcactc acgtcttccg cactgcctcc cgcttctctc cccaccctct      1440
     cgctgttcca tcttcgcccg ctcatcgcat ctccgctgcg ctctcacaac ccacccctga      1500
     ccctcagtac tgctctacca ccgtaacgat atggcacatt tgcacaatgt gtgcgaggct      1560
     gggcgggagc gcgccgtggg cgcgctcccg cgaggtcggt ggtggtcgcg ttggcgggag      1620
     gcgtgagggt tcggtgttga cgatcgccaa gctcggggcg tggtcggtgg cgtactacgt      1680
     cgacaccgcg cgttcggcgg ccgcggcggc actcgaatcg cgggctgccg gtgggggttt      1740
     gggcgagtac tacagcgagt ccgagacgcg gcttccggtg tggttttccg ccggccggga      1800
     cacgaccgcg gcgaggggtt tgacgggcgc cggccgcgcc ggtgagaacg ccgatttgga      1860
     cgccgtgacg cgttggttgg acgacgggga atcgccgtgc ggagccagtg gtcgggcgtt      1920
     ccaaaagcgg gccggtgtgc acggctatga cttgacgttc tgtgccccga aaagcgtgtc      1980
     gttgatgcgt ggtttgggca acgacgtgac cgttaaagcg gtcgcggatg cgcacgcctt      2040
     cgcgatcacc gaggcgatgg agtatctggc cgaacacggg ggctacaccc gtgtgcacaa      2100
     tccgcgcacg ggtgagaagg atctggtgcg gttgccgggg atcgtggcgg cgggttttca      2160
     gcacgaaacc tcgcgggccg gggacccgca tctgcacacc cacgtgttgg tcccgaaccg      2220
     gcaggcccgc gcggatgggc ggctggtgtc tctggacggc acgagtctct atcacgaagc      2280
     gaaggccgcc gggatcatct atcaggccac actgcggcgg gagctgacgc gttcgatcgg      2340
     cgtggagtgg aacgacgtcg atccgcacac cgggatggcc gacatcgccg gggccgatcg      2400
     cggggatctg cggtcgtggt cgacacgctc cacacagctg cgcgagtggg ccagcgggca      2460
     tctgcgggtg gagtgcgacg agctttcggc tgcgcagctg gcgaccgcgc agaaggccac      2520
     acggccacgg aaacccgaag gtgtcgcatg ggcgtcgctg cgtgtcgcat gggccgatga      2580
     cacccgcaca tttcgggtcg acgagaccgt ccagcaggct gcgcgagatg cgcgtcgggc      2640
     tgccggtgtg gactacgcgg aggtggtgcg tcgcgcggtg tcgcacggcc tgagaaaggc      2700
     ggcgttcaca cgcgcggatc tcatcgaggc gatcggcgcg cggatgccgg tcgacgacgc      2760
     cgatggaccg tcgccacgag aggtcatcga gcgcctcgcc gatggtgtgg cactgcgcat      2820
     cggagacgag cgggccgccc accaacggga ggggtcgatc cgctacaccg ccgccgatct      2880
     ggtcgccgaa gaacgcgcca tcatcgaggt gatgggccgc cgccacagcg ccgcggttct      2940
     gccgtctgtg gacaccgctg ggctgtcgcc ggatcaggcc cgcgccgtca cagccatcgc      3000
     gacctcagaa cggctcgtac agcccctcag cgcccccgca ggggccggaa aaacccactc      3060
     actgcgagcg ctgcgcgccg ccgcacacga cgccgggaaa cgcgttctgg tggccgctcc      3120
     caccgggcgt gcggtcgacg tggcggtgcg cgagcaggcg ggcgatcacg gggccaccct      3180
     ggacgcgttg ttgggccgcc tcgagcgcgg ccaagaggtc ctcgacgccg acaccgtggt      3240
     cgtcgtcgac gaggccggca tggtcggcac ccaacacctg cgccggttgc tggagagggc      3300
     caccgccgcc ggaacgaagg tcgtgttggt cggtgacgag caccagctcg caccggtcgc      3360
     gcaacgcggc ggcaccttcg cccaactggt caccgatctg ccgtgggcgc aacgcctgtc      3420
     gcaggtgtgg cggatgcacg accacgacga gcgcaacgcc tcactggcgg tccgcgacgg      3480
     tgggccggcg gcgttgcgcc gcgcggtggg ctggtaccgc cgccacgatc ggctgcacat      3540
     cggggatcag gtcaccatgg ccgatgacgc cgtagcggcc tggacggccg acgtcgccgc      3600
     cggccgtgac ggtctgctca tcgccgatcg gtgggagatg gccgatgccc tcaacatccg      3660
     catccactcc gaacggatca gcgacgatgc gcccaccgtg gccgccgcgc gcgggcaccg      3720
     cgtcgcggcc ggcgacgtgg tgatcacccg ccagaacacc accgacatcc ccacccgcac      3780
     cgaccgtggt gccgacgccg atccgattcg caacggccaa cgctgggagg tcctcgccgt      3840
     cgaccccgac gcggggcgga tcgcggcgcg gcgtctcgac gacagggcgg tcgcggtcct      3900
     atccggggac tacctgcgcc agtacaccca tctggggtac gcggtgaccg tgcacgccgc      3960
     ccagggcgtc accgccgaca cctgccacac cctgctctcg gccgaggccg cgacccgctc      4020
     gatcgcctac gtcggtctga cccgcggccg gcacaccaac accgtgcgcc tctacgacac      4080
     ccgagccggg gaagccgacc acgaacacgc cgaccccatc gccacgggtg tccacaccgc      4140
     acgccgcggc accccggcgc aggccgcgac cgcactgcgc agcgtcctgg gccgcgacga      4200
     ccgcgccgcc accatcaccg ccgccgcggc cgacgaggac cgacttcccg accaggtggc      4260
     cgacctgcgc cgccaccacc gcaccgtgac cgcgcggctg cgccgcgagc accgcatcga      4320
     ccgccacgcc gcccacgacc gcagcgcgca cgcctcggac cgggcgctcg tcgaggtcct      4380
     ggccgccacc caccgctacg gcacccccct gccctcctcg cagcagcgca gcgacccggt      4440
     ggccgtggcg ctctcggctc cctacgtcgt gaccacactg gccgccgacc gctacacccc      4500
     cgacctcgcc gacaccgtgc gccaggccgc cgccggcacc gaccggcgct acgtccagat      4560
     cgccgccgca ccctcccgtc ccgaccaacg tcgcctcgac cagttcgccg aacgcctgac      4620
     cgcccatccc ccatcgccga gggaggtcgt cgtcgtcgag gacgccgcgg ccgccgaccc      4680
     ggcgcatctc gcggcggtgg ccaccgccct ggtccccgcc cgcggccggc tcctgctcat      4740
     cgacagcggc gagcccggcc ccggccgccg gctcctcgac ggactcgccc taccctggtc      4800
     tgaaaacgcc cgccccacac cggatgtcgc cgaccccgca ctagcggcac tcgcggacag      4860
     tcaccgcgcc gccgccgatc gcagctggcg catcctcaac ccaccccacc gcgaccgtgg      4920
     acgagaacga accagagacc agggatacgg cctcgaactc gactgaggcg gcggcggtca      4980
     gcctgcgtcc agtcgccacc atgcgccggc ctcgcggcag cgcgccacgg cctgaggatc      5040
     gaccgcctcg atatcgcgga gaaccgcttc gcattcgtcg accggacagc cgaactgcgc      5100
     aagctctctc aaccacatca gcagaggccg ctcgctgtct tccgaagtgg gccacgtcgc      5160
     ccatatccgg ccgtaggtgg cggccacgct gtcccggaaa gccgcacgaa tcgtgtcatg      5220
     ggcgatgtcg aacagtccct gcgcctgctc cgcgtacacg gcgagctgcg gtatccccag      5280
     atggctttcg agcaccgacg gtgcggcgaa tccgagtgca gtgcgccaat gctgttgcgc      5340
     ggtaacaata tcggaagtcg gagcgcttgg gcggatgagg agaagatatc ggccgccctc      5400
     gaagtagtcg gcgtctcgcc aatcggggtc gcggcccggt acccggatcg gcgacggtgc      5460
     gctcagcgtc gcgcgatccc acctcggtat cggagggttc aaagatgcgt tcgcgcacac      5520
     catcttcagc gttgcgccga tcgtctccag ccgttcggcg tacccgagca gcggatagct      5580
     cggtggtgcc gagctatcgc cccggagtcg atccccggta cgcacgtgga actcccgcgc      5640
     ccacagggag gcttggtaga tggtgttggc caactcggcg tgccagcgtt ccagctcgac      5700
     cctccaggct gcgccgtccg cgccctccgg tgtggtcacc gaggagcctc gtagtggagg      5760
     tcctcttcga cgctcaccaa ggccctgacg atcatgtcgg acaactcagt atcgccggaa      5820
     agaactgcgc cataacacat gtcgggtagc ggcagcggac gggccgccca gccgccgatg      5880
     tgttcggcgg tacgcgcaac cagccagtgc gcccggtaga cagccagatc ttcgctgtaa      5940
     tcgcggggat ggccggcccc gccggtcatg aacgcgggcc gggtcatggc agtggtgccg      6000
     ttgaagatct gggcttccgc gttgtactta gcccattgct gcgtggtggg ctcgcggtca      6060
     ccgccgcgaa tctcccagat gtggcgcacc gcgtcgggaa tatcgacagg ctgggcctgc      6120
     gacgttgccg cacggatcag cgccgcggtc accgcggaga cgatccggtc ctgataaatc      6180
     gggtcggcgt ccatgatgcg cagcagccgc gggtacatct cgggccacag cagcgccagc      6240
     cgatgcgcgt gcatgtcgtc gagcaccggg gcgggtacct ggacaccggg ctgcagcagc      6300
     gggttggttt cccgtgtgca tgcaggcgga tgctcgaccc ccgcgtccct cagtgcgggc      6360
     gtcgggagcg tgctcgcagc ggcgaccagt cgccagcccc actgggcgcg cagctgggcg      6420
     tactcgacga ggatctgggc gggatcggcc caaccgaacc acaactgccg gaagtcgttg      6480
     tctaccagag gatctgtggc caacacccgc acggagcgcg gaacgaacac gcccgccggg      6540
     atgtaaccgg ctccgtcgtt ggtggtgatc acgatctcgg tgccgctcgg ggagcggaac      6600
     accccgaccg cccaccccgt catggggctg cccgccaggt aagcggcgtg ctgaagcttc      6660
     gagaccaact ccctggccgc cgcggcgtcg gcggactcgc ggcgctcctg ggcggccgcg      6720
     gtctggcccg cagcgaccac gctggccggg atcagtgtcg ggccggcggc cgcgcccgct      6780
     gcggccgacg tgggcgccgc cggggctgtg ttcgtcgaac cgaccgtgcc cgcgggcacg      6840
     gtcgccgcag ggggtggaat ggctgcggct ggcggtccca tcgaaccggg cggcagcatc      6900
     atcggcgcac ccccaccggc ccccacacct acaccggtag gtgcggaggc aggggcggcg      6960
     ggggccacca caccgggctg cgccgcggcc ggcgacacac ccccgccggg ggcggctgcg      7020
     gccggtgccg catgcccacc ggccgacgga gccggcgacg ggctcgccgg tgccggcggc      7080
     ggcgcaggtg gtatcccgcc gcccatgccc gccgtcgctg ctgctccctg attgaatgcc      7140
     gacaacggcg acgcgccccc cgcgttcgat gccgtaggga ggccaccagc attcggcaat      7200
     ccgcttcccg cgccgggcat ttggcctacg ccgctcagag gattagagcc cgtccccggc      7260
     atgccgccgc ttcccagacc gccgggcatc ttcggaatcc cgccaccgga acccatccca      7320
     ccgccaccac tgcccaatcc gctcatcgac ggcgcaccgc cgccgagcgg cgacgccgcc      7380
     gccggccgcg gcgcaggagt catccccggc tgagtgaccg gactcgacgt cgcgagtccc      7440
     tcatcgccaa catccgcttt gcccgtcccc gcgtcggcgc caggggacac ccccggttgc      7500
     gtgacggagg taccggcttt gtctgttggt gcgtctgcca caggctcggg tgcgtcggcc      7560
     ccagctttcg gcttctcggt atagcggcga gggtcttcgt cctgttcgat accgggcgat      7620
     gggttgtcga ggggctgcgc gggaggtgca gcgggtacat cgccccactt ggtcaaaagg      7680
     tctagcgctc tgacgttttc gctgctcttc ttgaacgagg tgtgcgcggc catcgcggcc      7740
     gtaacgcctg cctcggtctg atacctggcc atgccgtgat actgagctac gagcgcttcg      7800
     gcttcgccgg gcagcttcgc ggcggcgatc ttgggatcgg cctcgcggat cagctgctcc      7860
     tgaccggcgc gcgtgtcacg caacacggtg gcgatgtcgg cgcacttgtt ggccactttg      7920
     tcgtgccact cggcgatcgt cttggcctcc tcggccaaca ccgcacccgc ccggtgcgcc      7980
     tcgtcgaagc cccgagagtc agcggcatct cggaacgctg cgttgtcggt gacgatcttc      8040
     tggtggatgc cgtcccatgc cgtcgcgctg gcccggtagg cctgctcctg ggcgtcccag      8100
     tgcgaggcgt cgggcggttc catgtccggt gtgacgatca gccgcccata cgaaccggca      8160
     gaactcccga cggccgccat cagcgcaacc cgcactcaga cgtgaggaca tccgtcagat      8220
     cgttgccgcg ttttagttgg cgatcggcgt cgtcccaatg ccgcatgttc agcgcgtgga      8280
     gcatgtcgat gttggccgac atccactcat gcagcggtat cgccgttgaa gctggtgtgg      8340
     cgtcagacag ctgcgtacgc agatacgaga ccgcagccac accagtgcgt ttctccgtgg      8400
     ccaatgcggc gagactcttt gggcttgtcc agctctgctc cagcgcctcg gcgctggact      8460
     tgctcgccaa cgccgtcgac cgtgcggccc gatcccacgc agcacatgcc gtagccttcg      8520
     cggcttgcgt ctcgctgctg ctgtgagcgg ctggcggggg tgcaaccacg ttgaccgtgt      8580
     gctgagccgg ggcgatgggg cgcaccagcg ccaggccgct ggtcaccgct gcaccagcgg      8640
     cgatcactag cgcggtcgct gcgacggcca ccccggtgcg gtggggccgc cgatacccca      8700
     tcgtcatgaa acgaccgtat cgcgatcgac agacatccag ccacagccac agccacattc      8760
     aaacccgcga gtttccgcag ctcatgtcgc ctataggcaa catcgagcaa ttcagcgaac      8820
     gtcacgtggt gtgtgtataa aatgacggtt ttagacgcac ttaagcatgg tgatcaccga      8880
     ttgcggctga gcagctcgcg caggcgcttg gctccgcggt cggacaccga ctgcgacgac      8940
     aaggcatacg cagcggcctg atcgggagtc agtcggccgc cgccgatgtg atcgctcaga      9000
     aaccgtcgca cctgcgcctt ttcatctgcc cctgtccagc cgttacgacc gccgtagaag      9060
     atgacggagt caaggtcttt gcggacatca tcgtcgactt gggacgttgt gacctgtccg      9120
     gtcagcaggt tgattgcggc cgcgccagca gcccattcgg ctaaggacgt ggagccctcg      9180
     acgacagcaa gcgaatagcc ccgagccaag cccatcgcga agtgcaacga ccgttcgtct      9240
     ggcacgaacg tcagtaccgg accgcgatcg ggtcggctac ggctctgcgg tgtggcgtga      9300
     ccccccgctc ggatgatctc gtcgaggtcg gcataaccaa agctcgccgc gttctgcgcg      9360
     ttgctcacca gcagcggcgc tagatcctcc tcgcgactgc gttcccaaat ccagtcggcg      9420
     gccagggtga tggcttcttc ccacggcccg atcttcgacg tcatcgggga cccacgctgc      9480
     ggcccgcagg tgagtggagg ggtgcaaatc gtcggcggtc atcacgcgac tcctgactgg      9540
     gaactgagtt tggccaggta gcggtaggcc gtcgcccggc tgattccgaa cgcttgggca      9600
     agttcgggta cgggttcgcc cgtgccggcg aggcggcgca gctgttcttg acgttcaggg      9660
     gtcagtttgg ccggcttggt agccggcagt tggcgggctc gccgggagtc gcgcgaggcg      9720
     gcgcggcgct cacgccccag ttcgagttcg agctcagcca gcgtcgccat gatggtggcc      9780
     accgcacgcc ctgttggtgt gccggtgtcc acactttcac gtaaggcgcg caacagaatt      9840
     cggcgctcac ccaaatccgc gatggtgcgg gttacttccg cgacggatcg acccagccga      9900
     tcgatggcgg tgaccaccac agtgtcgccc tcgcgggcgt aatgcagcag ggccgccagg      9960
     cccggccgaa cggtgttcac cgtacccgac agcttgtcgg taaaaattcg gccggattcg     10020
     acgccttggg cggcgagcgc ggcgagctgc gcatcgaggt cctgacccag cgtgctgacc     10080
     cgcgcgtacc cgagaatcgc tgtcacaccg ctaccgtctc attgccctcc gacatcgagg     10140
     atgtgagaca cgccgtgtga gacaagaaag gagacgccgc gacctggcgt tatcccaccg     10200
     cagcgtggac cacgtagggc cgtctcgttt ctctagaatc gagactgcac tgaggtattg     10260
     cgcgttgtct tcggttccgg catggggtcg acgaggtggc gtccttagag catggagccg     10320
     agatcggatc ccaaagtggg gtaggccgcg gtggtggtct tgagctggcg tgtggttaga     10380
     ccgagcttga tggccacggc aatggtgttg gcgtgttcgg tgtagtccgg tccgagcagg     10440
     tgggcgccca cgatgcggtc gtcgtccttg ttgaccagga tcttggcagc ggcggtccct     10500
     tctccgatgc ggtagctcga ataccaggtg ctggcgtcgc tgtagcggac gtcgatgttc     10560
     aatccttggt cacgtgcttc tgcctcgagc aacccgacgc gtgctagttc ggggatggtg     10620
     aacaccgcgg aggggatacc cgtgtagtcc gggacggtgc tggcagcctt gagcatgttg     10680
     gaggcggcca ccttgccttc gatcacggcc accggcgtca acggcgggcc ggcggtgtct     10740
     gcggcgtcac cggcggcgta gacaccgggc tgggtggtgc tctgcaggtg cggctgcaca     10800
     cggattcctc gctcggacca tgcgatgccg gcacggtcga ggtcgaggtc ggccagctcg     10860
     ggaagtcgcc cggcgccgtg aaccaccacg tcggcatcga tggtggcgtc ggtcccgtcc     10920
     tggttgacct gaacctggta tccggtggcc gtcgcgcgta cggcggtgac cgtcgtagag     10980
     gcgcgcacgt ccacgccggc cgccacgccg cgcccgatca gcaggtcgac cagatcgggg     11040
     tcgaatccct tgagtgggcg cggaccgtga tcgaggatga tcgggtggct acccgcgcgg     11100
     gcggcgatgt gggcgaactc gaaggaaatg tatccgccgc ccacgaacac gattcgcggt     11160
     ggcaagtcct ccagatcgag gaactgggtg ctgtcgatga ggtgttcgtg accgtcgaac     11220
     tgcagcggcc ggggtcgcgc tccggtcgcc accaagaacc gctctgtgtg atggacgtcg     11280
     tctccgacgc tgatctgatg ggcatcgacg aaccgggcct gaccatgcag tgtctggacg     11340
     ccgtggcggc gcaggtcgtt ttccatgttc gctggtgcgg gatcggtgaa gccccgtttg     11400
     tggcgcatca gatcagtcca gttgatgcgg atctggcctt cgtcgatccc cttgccgcgc     11460
     atcaagcggg acgcgtcgat gatttcggca ccacgacgca agatcttctt cgggtcgcat     11520
     ccacgcaacg cgcaggtgcc gccgtatggc aacgaatcca cgatcgccac gcgccagccc     11580
     tgggctccgc acttgttggc cgcagcgatt ccggccatgc cggcgccgat cacgatcaca     11640
     tcgaaccggg cagtcatcgt cccacctggg tgcagcgtga cggggaggtg cctttcagga     11700
     gggactgggt cagggggcgg ccgagttggt aagcgtcagc cacggaaacg acggtggccg     11760
     cggggttctc ggccagccat ggctcagcgg cctcccgggt ggcgaagaag tgcacgtggt     11820
     ggcaaaacgc ggtccgaata gaggcgggat ggtccgggat gacgatcgag accacggcgg     11880
     tcgtgggttc gacgttggtg attccgtggg tgtcgatggt gaggtgcacg ggttgcccag     11940
     tgctgtgaca tggcgaggtg acgtgggcgg ttcggccgag gatgccgggg aagatgagcg     12000
     tgtccagcgc gcaccaggtg tagagctgcc gtccgtcgat gtcgaagcgg tgcggggtgg     12060
     ggcgcagtgt gaggccgctg ccgatgatgc ggccgtgttc gtcgtattcg gtgtcggaca     12120
     tggcggtcaa ggcgtggcgc acctgctcga cggtggtggc ggtggcgtca gcgagttggt     12180
     cgatggtgac cggcgctccg tgggcgagga ggtcgagcag cgggcgcaac atccagggcg     12240
     tcgagccggg gttgtcgccg ccgagtgagt cgttgagccg gtgggcgagt tgggcgatgt     12300
     cggggttcat gtcgcttggt ccttccaggt cgatagcgga aactagggat gcgatatcaa     12360
     gcggcgcagg cattctggcg tttgagttgg cgtagccgcc agatgtccca cacctgggcg     12420
     atgatcagca gtgccaaccc gatccacacc cccaccccgc cgggcatgcc ggcgccggcg     12480
     gtgtggcctc ccatgccgtc gcccatggga tcgccgccgt gcccggcgct ggcgtggccg     12540
     aacagggcgt tgccgttgag ggacaagaag atgatcaccg cggcgaccac ggtcagtagc     12600
     agcggcagcg ggttgcggtg ccgatgccag gtggccgcgc taccggcgat ggtgatcacc     12660
     aagctgacga tcagcagcgg ccgcagggcg gcgtcggtag tcaggaacgt ggcgccgatg     12720
     gcggtgagca gcgacaccag cgccgtcaca ccgaggcaac acaaagtggc gaaacccgcc     12780
     atcagggcgg cggcgcgggg cagccagcgc tgccacctgg gcggcaacgc ggtagttgcg     12840
     tggtcgatgg cgggggtggg gggcacagtc atcagggttc tccttgcggg tgggggttgg     12900
     tcagctggcg cagcaggaca gggtggcgac gtcggtggtg taggcctggg cggcgagttt     12960
     gagtgattcg gccatggtca gatacggggc ccaggtgtgg gcgagctgct cgacggtcat     13020
     ccccgcggtc agcgcgtagg tggcggcggt gatgacgtct ccggcgttct cggcgacgac     13080
     gtgcaccccc agtaaccgac cggtgtcggc ggcggcgacg agtttgacca acccgcgggt     13140
     gtcgcggttg acgattgccc gcgtcacgta ctgcaaaggt attgtgcggc agtcgcattg     13200
     gatgccggcg gcggtggcct gggcgtcggt catgccgact gaggcgacgg cggggctggt     13260
     gaacacgacc cgcggcaggg cggtgtagtc cagggtgcgg gcggccctgc cgaacgcgtt     13320
     gtcggcgacc agggtgccct gggccgcggc gacgtagacg aactgcggtc ctccggtcac     13380
     gtcgccggca gcccagatcc gtgcggtggt ggagcgcaga tggtcgtcga cgaggacttc     13440
     tccgcgcgga ccggtcttga ccccgaccgc gtcgaggttc agaccggcgg tgaccgggcg     13500
     gcgcccggtg gccaccagca gctgttcggc atgcagcgcc aaccgttgcg ttccgcgttc     13560
     ggcggtgagg ctgtagccgt gttcgtcgcg gcgcacaccg gtcacggtgg tgtgggtgtg     13620
     cacccggatg tcctcgtcac cgaagacgtc cgccagcacc gcggagacct cgggttcttc     13680
     ggcggacagc agcggtgatc gcgtcaccac ggtgaccacg gtgcccaggc gggcgaagag     13740
     ctgcgcctgt tccaggccca cgtagccgcc gccgagcacg atcatggatt cgggcagccg     13800
     gtctaggtcc atcgcggtgg tcgacgtcag agagccggtg tcggccaatc cgtcgacggg     13860
     tggcgcccag ggcgccgaac cggtggcgat caaataatgc tcggcctcga cgtgcagcgt     13920
     tgcgccgccg ggcgtttcga cggtgaggca cggtccgccg gcatcgccga cgaactgggc     13980
     gtcgccctcg acgacgtccc agccgtagtg ggcggcgagg tcgacgtact tctcgccgcg     14040
     cagggtctgg accagtgcgt cctttccggt catcaaggcc gggccgtcga cgggtgcggc     14100
     gctggcggcg atgcctggaa accgggccgc ggtcgacgcg ccgtggaggg cgtcggcggc     14160
     ggcgagcagc gccttcgacg gcacgcatcc gacgttgacg cacgtgccgc cgatggtggc     14220
     ccgttcgatc atcaccacac ggcgtccggc cgtggtggcg gcgatggcgg cggcgaacgc     14280
     cgcaccgccg gagccgatga tcgccaagtc atagcccatg gggcgtctcg cctttcgtcg     14340
     gcggtcctgc gggacgggcc ccgccgaccg ttgctctcgg gtagtcgaat gtgactatac     14400
     ttcctcatat ccgctaatac ggatacgcta attttctagg atgtgaaggg agaccgcgtg     14460
     acctgccgca ccgatccccg gctggcgttc ctgcccgaaa ccgacaccgg ggtggagatg     14520
     gtggccaagt tcttccgcgc gctcggtgat cccggccgac tgcggcttct ggagttcctg     14580
     gtgagcaccg agcacaccgt gaccgagtgc gtcacccatc tcgggctggc gcagagccgg     14640
     gtttccagtc acctggcgtg cctgtcggac tgcggctacg tccaggtccg ccgagagggc     14700
     cggttcgctc attacaaggt ggccgacccg cgggtggccg atctggtgat gctggcgcgt     14760
     tcgttggccg ccgacaacgc cgccgccctg gccgactgcg tacgcatcac cgccgccgag     14820
     gccccgcagg tgccggcctg atggcgacca agcgcacgag cccgtccgtg gccgggatcc     14880
     tcggcctggt gggcatcggg gtgctgccgc tgctgtgctg cgccggaccg gcgctcatcg     14940
     ccggcggagc gctcggagcc cttggtggcg tcctgggcaa tccgtggctg atcggtgcca     15000
     ccgcggtgct ggtgatcgcc gccgttggct acgccctgcg ccgccaccgt cgccaggact     15060
     gccatacggc ctctaccgac cgaaaaagct acataatgac cgctgtagtt gcgaccagcg     15120
     ccgatgcgcc ggtgcggtgt cccagaatcc tgtcccagac cggcgggaac ggggacaccc     15180
     ttaaagacac agacggctcc cgcccaggtc cgcaagcggc cctggttggg cctgagaaga     15240
     ccgtgccccc tgaacgagtg aggacctgcc ggtgacgctg ctgggatacg cgcgagtctc     15300
     gacgttgcac cagtcccccg acatgcagac gaaggcgttg acggaggccg gggccgaacg     15360
     gatctggacc gagcgcatgt ccggcgctcg cgatgatgat cgccccgagc tggccgcgct     15420
     gctcgactac gcccgccgcg gtgacgtgct catggtctgg cggctcgaca gtctcggccg     15480
     ctcactcccc cacctgctca ccgtggccag cgacctccag gcccgcggca tcgaactgcg     15540
     ctctctcacc gaagccatcg acaccagcac tgccggcggc cggctgatct tccacgtctt     15600
     cggggccgtc gccgagttcg agcgtgccgt cgccgccgaa cgcaccgccg ccggagtcgc     15660
     ggcagcccgc gcggccggtc gacaccccgg ccgccccggc ctcaccgctg acaccatcgc     15720
     cgcggtccaa gccctcgacg aggccgggac ccctcgcgcc cagaatcgcg cgcaccctcg     15780
     acatatcccg ctccagcgtc taccgctgcc tcgaccaacc gcagccgtca gcctgaggca     15840
     ggcaggcgac cttatccttc gaaggtgacg gaagaaaacg gcgataccca gggctgcagc     15900
     agtgcacctg gggaactcga cgactggccg atcgacgtgg cggacgttcg tgaatcgcta     15960
     cgagaagcag aagccgacat cgccgccggc cgtacgttcg gcgaagacga gatccgcgcc     16020
     cgctacggcg ttccccggaa atgaggtcga agtgattcac gcggaagccg agcccgaccc     16080
     ggatgacctc gatgccggct acgcccagct ggcgtcggag ttcaacagcg agaccgccga     16140
     tgttgaacgt cgggctgcgc gggaccgcta tgcgggtcgg actggagagg cgtagagaag     16200
     aactcgccgg ccgtgtgttc agatcagccg ggggtcgccg tcttcgtcga ggatgatgtg     16260
     ccgttcgccg cgctggagtg cgtcgagtgc gaggtctatc tcgtggacgg cgagatcggt     16320
     gatccggctg gggccgagga cgatgatctc gtcagcgtgt tcagcgccgc cgccggccgc     16380
     cagaccgacg tactccgcgt tgggggcgac gacgaactgc agatcccagc cgatgacgtc     16440
     tcccacctcg cgtgcgcgtc ggtcgagagc ttgcacgtcg tcgtcggtca gcacgtgatg     16500
     cccctccccc gccatcaggc gttgtcggcg gttctgcggc gcagcgtgtt cagctcgtcg     16560
     agcagctgct cgtagcgctg aagggacatg accacggcgg cgggcttgcc ggcggtgtcg     16620
     gccaggacga cgttgccgcc actggtggtc acctgatcga tcaggcgctg atgcagttcg     16680
     cggaccggga tcagctcact gggaacggcc tgcgcgccgc cgagggcttc aacggtggta     16740
     cggatcatgg gatttcgcct ttcggaagtg atttggtctg gtgtcccctc ggcccgtctg     16800
     tcgagccgag gggacaccgc cgaatccggt tgatgctcaa ccgcgttcgg taactgtggt     16860
     gttggggtga cgtgcggccg tggagccctt cacgaacttg ccggtgatgg cactgcggtg     16920
     atgggttccg ctgctgcggt tggagccccg ttcggtgacc gtggtcttgg ggttgcgcgc     16980
     cgcggtggac gccttgacgt agcgaccggt ggtcgcgctg cggtgatgtc ccttggccat     17040
     tgtcttgtcc tttcggtttg tccggcccgg tgttgagccg gataccggtc tataagtgcg     17100
     ctcgtcggct cgacccctga atttctcgga atcgtcgtgc ccctggccgc tctcggcggc     17160
     gcggcgggcc agggcgtcgc cttcggcggc ggtcaccgac cggcgggcta ctcgcccggt     17220
     gcgggtgccc aacgagctgg cgttgatgag tgcggtgagg tgcttgatgg tggtcacgac     17280
     gtcctctttc ggtttcggag ttggcggagt tggtggccga ggaggttctc cacgctcttg     17340
     gcgtcgcgca accccagctt gtcggcgatc tcccgctggg tgaagccgtg ttcctgcagg     17400
     aacagtgctc ggcgcgcccg gtcggtggtc agcagcgcca tcgcttcggc caccgtgtcg     17460
     ttggcgacga tggtctcctc gatgcccttg atgacgtcga accggtcttc ggggagttcg     17520
     tccgtcggcg tggtggcctc ccggatgcgc tccttctcgg cccgcagtgc gctgcggtag     17580
     atgttggcga actgatagag gcactggccg atgaagaagg tgcccagtga cgccccaccc     17640
     gaggattgcc agcggtgggt cttgagcacc ttgtcgcgga agtagatcag ggcggcgacc     17700
     acggtgtcgg tggcgatgtc gtcgatggtc tggtcgtcgg gccagccctc gatgcggccc     17760
     agaccgtagc cggtcagcgc cttggccttg ccgtagatgg tgccgtggcg gatccaggcg     17820
     cgcagcacgc cgaggccgta gcgggtcagc tcgcgggaga accgctccca cagccggccg     17880
     gtgaactgct ccaactgcag cgtcagcagc agttcctcat cggcttgaag gcgccggagt     17940
     cgttccagtt cgtcggcaag ttcggcggcc aggtcagggt catcgagcca ggtgccgacc     18000
     aagccctcgt cgacgccctg gatgtcgccc tggttgtccg gttgtaagcg cgcggcatca     18060
     acgggcgggc cgggacggcg tgccggtcga tccatggcta catctccagg aggcgagaaa     18120
     gagacaaccg atccctacgg ttgtcgcttc ctcttaagtc cgcgcgtacc gcgaacccct     18180
     gaaacctgga gaaagttttt tccaggcaag cggtagcggg ccgtgctgtc accattgtcc     18240
     caggtcgagc cgacaatccc ccgcatacac aagagggctg gtgacggccc ctgggtccgc     18300
     gagtggtccc agttggcggg ccgctggacc gccaatgtgc ggcgctcccc tcgcgtgatg     18360
     aggtcggttc gcccgtgtcc ggcatgaaag agcccccgcg ggtgaatcga cagaagcgtg     18420
     aggcgcgggt ggggggccca atgaaaaacc ccggccgcgt catggctcca ggccagagag     18480
     gcggtgtccg gggacttctg ccagttatgt tacctcggac cacgaaaagg agtccagtgg     18540
     tagaaacccc ccagcaagca gaagcgcgtc gcgccgctgc gctcgatcga gccatatcga     18600
     ccccgcgcta cgcgtcctat ctgaacgccg ccggccaaga cgccgaccgt gcccgcaagc     18660
     tctacgtctg ggaccgtgac ctttcgacag ccgtcctcgc ggacctggcc atcgtcgaag     18720
     tggcgttacg caacgcccta cacaacgcgt tgaccagcac ctatggaccc gagtggtacc     18780
     agaacatcgc cctcgatgac cgctcgatga agcaggtcga acgagcgtgg ggctacctcc     18840
     gtaatcctcg gcaaggccac ccatcgacac ctggacgagt gattgcgcag tgcaccttcg     18900
     gaatgtgggt caaccttctc gatgccggcg gctacgccgg ccgggagccc cgccgcgtcc     18960
     acgccgacta cgagcagcta tggcgatcga cgctgcgctc cgcattcccc ggcggccgca     19020
     tcgaagcacg aaacgacccg agcccccatg cgagcttcac caggacgtgg gttcactccg     19080
     tcgccaagac cgtcaacgtc ctacgcaacc gggtcgccca ccacgaaccc ctgcacaacg     19140
     gattcccgtt gcctggccaa cggtcgggtc aacagcagcc gaaccgtctc accgccgccg     19200
     agggcgtcga ggcctacatg aagctcactc gcatgatcga ccgcaacctc gcagagtgga     19260
     tcgtcaacaa caccaaggtc accaccctgc tggccacacg tccgtgagtc tcccctgggg     19320
     caacaccacc gcaggttccg agaccacagc acatgcatac atacatgctt tcttacatgt     19380
     aagtatgcat gtagacatgt ttgcatgcag attgatagac ttcctgtcat gaccgtttcg     19440
     gcagataagc agtgcgaaat cctggccgtg gcgctgcaga agggtggcgt cggcaagacc     19500
     accaccacga tcaacctcgg cgcgaacctg gccgcgatgg gtctgcgcat cctcgtgatc     19560
     gacatggatc agcaggcgca cagcaccaag gggttgggca tcgaactcga cgccgaggac     19620
     gcgtccatgt acgaggttct gcacccggac cgggcgatgc gcgtcccgct ggccaaggtc     19680
     atcgttccga cgcagttcgg tatcgacgtc gcgcccggtc atctcgcgct caaggagctc     19740
     gagcgaaccg ggctcggatc gggcggccag ttgcggctag cgcgccagct cgacgacatc     19800
     gagggctacg acttcgtgct tctggattgc ccgccggcat tgggggagct gaccaccgcg     19860
     gcgctcgcgg cggccgacta cgtgttggcc gtcctcaagg ccggccccga cgaggttgac     19920
     ggcctggtgg agctgggcaa ctcgatcctc gacgttcaag agacgctcaa cccagacgtg     19980
     gagatccggt acgtgctgct ggccgacttc gacggcaacc cgaaggcgag caaggacgta     20040
     cgtcgtcaac tgcgtgccga ctggggggag tggtctgacg gcggggccta tctgggcgag     20100
     atcccgcaca cggtgcgggt ggtggaggcc aagggcaaac gcgtgccggt caatgtgcac     20160
     gccccgacca gcacggcggc ggtggcctac cgcgaggtcg cagagcgtat cgcggcaagg     20220
     cggcacgcag catgaacgcc gcatccaaac ccgccggatt gcaggtcggc tccacccggc     20280
     cgttgtcgcg cgcagagcga cgcgcccaag ccgcacgggt caccgccgac gaaaccgcgc     20340
     cggccgcgcc ggagccgcag aacaccgata tcccgcccgc gcccgtggcg acgccacccg     20400
     atggtgagca ggaggcccgg caggccgagc cggttcggtt gaaagcccgt ctccgcaagg     20460
     tgaagagtcc gttcgccaca cagctgcacg cgggaaccct cgcgcggctc gaatggatca     20520
     aggcccgcgg atacgtcatc accgacaccg tcgacgaggc catcaaccgc tacctcgaca     20580
     acgccggcat tccaaagccg gaccgcaacg accgcatgcc ttgagggcgg gcgcgcgccg     20640
     cccccctcta agggctgacg caaagttgtc ttgattctct cgttcgacga cgctccagct     20700
     catccgctga ggcccgcccc cgcgcgggaa cgtgcttcag cctgcgtttt tcttgttgtg     20760
     atctgaccgt aaccacacga gttgtcggga ttccggcccc caaggggtca ttagaggccg     20820
     tgacaccaac ccctgacaac ccgtttctcg cggtgccgtg cattcggcaa tcggccgctg     20880
     caccccgcag gtctatacct gctcaggcga gacctagaac tgccgccacg ccacacgacg     20940
     gaaaccagct ctagggccgg tacttcccgt gtaccggaac cacgacgaga aaggtgcggc     21000
     cagtgccctg taaagcacgc tgtgccagcg cacaagaaga gagcgggacg acagccagct     21060
     ccaggagcca tctcctgacc accgaaccag gagacgccca atgagcgaat ccatcctgat     21120
     cgcagtggcg atcatcgtcg tggccatcac ggtgctgggt ctggcgatct gcgtgctcgc     21180
     cggctacctg gcccgcattc ccgactgcaa ggtcaccatc ggcgaagtcg gccgagcgat     21240
     cggcgccatc gtcggcgtgg gcatcgaagc ggtagccacg atcatcacgt ccgcgcgacg     21300
     accgtgagcg cccaccgccg catacgggga ggggagcggg cttcctcggc ctcgattgtg     21360
     gcgaaacggt gggtggtggt cgtcaaggcc ggtaaccgcc gctgcgcggt cgacctgcgg     21420
     tcgagcctgg acagccgcca cccaccgcgc aaacgggcca gtacgaggaa gccgggcggg     21480
     gaacgtgctg gccaggctcc gggggcgagc tactcggacg ggggcacccc ggcacggtcc     21540
     aagaactcgt tgagcgccgc atccacgatg tcggtgaccg cgtacccgcg gtccttcaac     21600
     acctccacgc gctgctgggt gcctggccgc acataggtgt tcaacggcac cttctgctgt     21660
     cgcttacgca agggcagcgc gctaccgcca gcgtcgggcg caccgccgtc gagcgcatcc     21720
     ccagccgaat cgggcatgca tgcatcctac atgcacgtct aaaagtagtt tacatgcaag     21780
     ttgcttgcat gtatgcacgc acgctcttac agtggtggca tggataccct cggcacggtc     21840
     caagacgacg tgagtgcggt ccgggacttc gcgtcccagg tccgtgcgct gtgcgcgcag     21900
     ctgacagcca atccgttcaa cacccccgcc gcagaaaagc tcctcgatct gctcctggaa     21960
     gacgccccgg cagtggatct cgccttccaa cgggtgttgc ggtcggtgat ctacgagccc     22020
     gcatcgaccg gcgccccgat cctggacatg ctcggcggcc cacgctgtac cgcgctggtc     22080
     gtcggcgcgg cggcctaaag tcggccctga tgagcacacc ctcgccgccg ccgaagccag     22140
     gctccaccga gcactggcag gcatggctgc agcggtacgg cggtgactac accgatgacg     22200
     ccgagcgccg cgccgcctac cgggacttca cgacgaacct ggacaccatc caagccgtct     22260
     tctcccagtc cgatgacatg cacgtcgccg gctacctcga agcccacgaa cgggtggcca     22320
     gcggcgacgc agacagcccc gacgccgccg agacatgggt tccaggccat ctcaccggcc     22380
     acgcgcgggc ggactggctc gaaggcttcc gctcccactt cgagccgtag gcccggtctg     22440
     gggctggctc gttcagcgct ggaccggcca caccacgtgg tgctgcgcgc gaggcgggct     22500
     gtggtcgaag acagcttcag ccatcaactg tgcgctcctg ctggcgatca tctcggtcag     22560
     gtcgtactgc acttcgctgc aggcctcatc gagcagaacc tgttgcgccg aggcgatcat     22620
     cgtggactcg tccgcgccgc tgacttgtga tcgggccgtc cagtcgctca tccggtcgtt     22680
     gatcgcgtcc aactctgaga gcaccaggca cgccgcctcg ctggcgtact cctcgatgaa     22740
     cgccgcccgc gcttcggccg gccaccagac cgggatcggc agctgggccg cgtacaccgt     22800
     cgcgatggcc gcctccagtt ccagtgagtc gatcaccact cgaacggtag ccgtgtgaaa     22860
     ggagggacgg gatgtgcgcg tgtcggtacc aggtacatgg acctttttgc gtaaggatca     22920
     gggccatggc ccaaccgcac aaaggtccgc gtgagcagat caaggttcgc gctgacgcat     22980
     ccgtctacgc ccggcttcgt gaaatggccg ccgaacgcgg cacaagcgtc agccagcttt     23040
     cggccgacct gctcgctatc gcggtcgggc ggcccgaggc tgttcgcgaa ctcgacaagg     23100
     aggttctgcc gctggcgatg tgattcaccc gccaaaggcc tcagaccttg ctggacgagc     23160
     tagggggtct tggcatacgt gacatctgaa tagctggtgt gcggattacc ccgctgacat     23220
     gacgaaggcc ccgcgttagc ggggcccctg tcgggggttc gaaccgagtt ggcgctcggt     23280
     tccgggtccg cacccgatat ccccgaaggg actttgc                              23317
//

If you have problems or comments...

PBIL Back to PBIL home page