(data stored in ACNUC7421 zone)

EMBL: CP000901

ID   CP000901; SV 1; circular; genomic DNA; STD; PRO; 4504254 BP.
XX
AC   CP000901; AAKS01000000-AAKS01000121;
XX
PR   Project:PRJNA16067;
XX
DT   14-DEC-2007 (Rel. 94, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Yersinia pestis Angola, complete genome.
XX
KW   .
XX
OS   Yersinia pestis Angola
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
XX
RN   [1]
RP   1-4504254
RX   DOI; 10.1128/JB.01518-09.
RX   PUBMED; 20061468.
RA   Eppinger M., Worsham P.L., Nikolich M.P., Riley D.R., Sebastian Y., Mou S.,
RA   Achtman M., Lindler L.E., Ravel J.;
RT   "Genome sequence of the deep-rooted Yersinia pestis strain Angola reveals
RT   new insights into the evolution and pangenome of the plague bacterium";
RL   J. Bacteriol. 192(6):1685-1699(2010).
XX
RN   [2]
RP   1-4504254
RA   Worsham P.L., Rosovitz M.J., Rasko D.A., Lindler L., Ravel J.;
RT   ;
RL   Submitted (29-NOV-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Drive, Rockville,
RL   MD 20850, USA
XX
DR   MD5; 0b2ec9d301634d6324c83b32b6b0bcb4.
DR   BioSample; SAMN02604042.
DR   EnsemblGenomes-Gn; EBG00001456892.
DR   EnsemblGenomes-Gn; EBG00001456893.
DR   EnsemblGenomes-Gn; EBG00001456894.
DR   EnsemblGenomes-Gn; EBG00001456895.
DR   EnsemblGenomes-Gn; EBG00001456896.
DR   EnsemblGenomes-Gn; EBG00001456897.
DR   EnsemblGenomes-Gn; EBG00001456898.
DR   EnsemblGenomes-Gn; EBG00001456899.
DR   EnsemblGenomes-Gn; EBG00001456900.
DR   EnsemblGenomes-Gn; EBG00001456901.
DR   EnsemblGenomes-Gn; EBG00001456902.
DR   EnsemblGenomes-Gn; EBG00001456903.
DR   EnsemblGenomes-Gn; EBG00001456904.
DR   EnsemblGenomes-Gn; EBG00001456905.
DR   EnsemblGenomes-Gn; EBG00001456906.
DR   EnsemblGenomes-Gn; EBG00001456907.
DR   EnsemblGenomes-Gn; EBG00001456908.
DR   EnsemblGenomes-Gn; EBG00001456909.
DR   EnsemblGenomes-Gn; EBG00001456910.
DR   EnsemblGenomes-Gn; EBG00001456911.
DR   EnsemblGenomes-Gn; EBG00001456912.
DR   EnsemblGenomes-Gn; EBG00001456913.
DR   EnsemblGenomes-Gn; EBG00001456914.
DR   EnsemblGenomes-Gn; EBG00001456915.
DR   EnsemblGenomes-Gn; EBG00001456916.
DR   EnsemblGenomes-Gn; EBG00001456917.
DR   EnsemblGenomes-Gn; EBG00001456918.
DR   EnsemblGenomes-Gn; EBG00001456919.
DR   EnsemblGenomes-Gn; EBG00001456920.
DR   EnsemblGenomes-Gn; EBG00001456921.
DR   EnsemblGenomes-Gn; EBG00001456922.
DR   EnsemblGenomes-Gn; EBG00001456923.
DR   EnsemblGenomes-Gn; EBG00001456924.
DR   EnsemblGenomes-Gn; EBG00001456925.
DR   EnsemblGenomes-Gn; EBG00001456926.
DR   EnsemblGenomes-Gn; EBG00001456927.
DR   EnsemblGenomes-Gn; EBG00001456928.
DR   EnsemblGenomes-Gn; EBG00001456929.
DR   EnsemblGenomes-Gn; EBG00001456930.
DR   EnsemblGenomes-Gn; EBG00001456931.
DR   EnsemblGenomes-Gn; EBG00001456932.
DR   EnsemblGenomes-Gn; EBG00001456933.
DR   EnsemblGenomes-Gn; EBG00001456934.
DR   EnsemblGenomes-Gn; EBG00001456935.
DR   EnsemblGenomes-Gn; EBG00001456936.
DR   EnsemblGenomes-Gn; EBG00001456937.
DR   EnsemblGenomes-Gn; EBG00001456938.
DR   EnsemblGenomes-Gn; EBG00001456939.
DR   EnsemblGenomes-Gn; EBG00001456940.
DR   EnsemblGenomes-Gn; EBG00001456941.
DR   EnsemblGenomes-Gn; EBG00001456942.
DR   EnsemblGenomes-Gn; EBG00001456943.
DR   EnsemblGenomes-Gn; EBG00001456944.
DR   EnsemblGenomes-Gn; EBG00001456945.
DR   EnsemblGenomes-Gn; EBG00001456946.
DR   EnsemblGenomes-Gn; EBG00001456947.
DR   EnsemblGenomes-Gn; EBG00001456948.
DR   EnsemblGenomes-Gn; EBG00001456949.
DR   EnsemblGenomes-Gn; EBG00001456950.
DR   EnsemblGenomes-Gn; EBG00001456951.
DR   EnsemblGenomes-Gn; EBG00001456952.
DR   EnsemblGenomes-Gn; EBG00001456953.
DR   EnsemblGenomes-Gn; EBG00001456954.
DR   EnsemblGenomes-Gn; EBG00001456955.
DR   EnsemblGenomes-Gn; EBG00001456956.
DR   EnsemblGenomes-Gn; EBG00001456957.
DR   EnsemblGenomes-Gn; EBG00001456958.
DR   EnsemblGenomes-Gn; EBG00001456959.
DR   EnsemblGenomes-Gn; EBG00001456960.
DR   EnsemblGenomes-Gn; EBG00001456961.
DR   EnsemblGenomes-Gn; EBG00001456962.
DR   EnsemblGenomes-Gn; EBG00001456963.
DR   EnsemblGenomes-Gn; EBG00001456964.
DR   EnsemblGenomes-Gn; EBG00001456965.
DR   EnsemblGenomes-Gn; EBG00001456966.
DR   EnsemblGenomes-Gn; EBG00001456967.
DR   EnsemblGenomes-Gn; EBG00001456968.
DR   EnsemblGenomes-Gn; EBG00001456969.
DR   EnsemblGenomes-Gn; EBG00001456970.
DR   EnsemblGenomes-Gn; EBG00001456971.
DR   EnsemblGenomes-Gn; EBG00001456972.
DR   EnsemblGenomes-Gn; EBG00001456973.
DR   EnsemblGenomes-Gn; EBG00001456974.
DR   EnsemblGenomes-Gn; EBG00001456975.
DR   EnsemblGenomes-Gn; EBG00001456976.
DR   EnsemblGenomes-Gn; EBG00001456977.
DR   EnsemblGenomes-Gn; EBG00001456978.
DR   EnsemblGenomes-Gn; EBG00001456979.
DR   EnsemblGenomes-Gn; EBG00001456980.
DR   EnsemblGenomes-Gn; EBG00001456981.
DR   EnsemblGenomes-Gn; EBG00001456982.
DR   EnsemblGenomes-Gn; EBG00001456983.
DR   EnsemblGenomes-Gn; EBG00001456984.
DR   EnsemblGenomes-Gn; EBG00001456985.
DR   EnsemblGenomes-Gn; EBG00001456986.
DR   EnsemblGenomes-Gn; EBG00001456987.
DR   EnsemblGenomes-Gn; EBG00001456988.
DR   EnsemblGenomes-Gn; EBG00001456989.
DR   EnsemblGenomes-Gn; EBG00001456990.
DR   EnsemblGenomes-Gn; EBG00001456991.
DR   EnsemblGenomes-Gn; EBG00001456992.
DR   EnsemblGenomes-Gn; EBG00001456993.
DR   EnsemblGenomes-Gn; EBG00001456994.
DR   EnsemblGenomes-Gn; EBG00001456995.
DR   EnsemblGenomes-Gn; EBG00001456996.
DR   EnsemblGenomes-Gn; EBG00001456997.
DR   EnsemblGenomes-Gn; EBG00001456998.
DR   EnsemblGenomes-Gn; EBG00001456999.
DR   EnsemblGenomes-Gn; EBG00001457000.
DR   EnsemblGenomes-Gn; EBG00001457001.
DR   EnsemblGenomes-Gn; EBG00001457002.
DR   EnsemblGenomes-Gn; EBG00001457003.
DR   EnsemblGenomes-Gn; EBG00001457004.
DR   EnsemblGenomes-Gn; EBG00001457005.
DR   EnsemblGenomes-Gn; EBG00001457006.
DR   EnsemblGenomes-Gn; EBG00001457007.
DR   EnsemblGenomes-Gn; EBG00001457008.
DR   EnsemblGenomes-Gn; EBG00001457009.
DR   EnsemblGenomes-Gn; EBG00001457010.
DR   EnsemblGenomes-Gn; EBG00001457011.
DR   EnsemblGenomes-Gn; EBG00001457012.
DR   EnsemblGenomes-Gn; EBG00001457013.
DR   EnsemblGenomes-Gn; EBG00001457014.
DR   EnsemblGenomes-Gn; EBG00001457015.
DR   EnsemblGenomes-Gn; EBG00001457016.
DR   EnsemblGenomes-Gn; EBG00001457017.
DR   EnsemblGenomes-Gn; EBG00001457018.
DR   EnsemblGenomes-Gn; EBG00001457019.
DR   EnsemblGenomes-Gn; EBG00001457020.
DR   EnsemblGenomes-Gn; EBG00001457021.
DR   EnsemblGenomes-Gn; EBG00001457022.
DR   EnsemblGenomes-Gn; EBG00001457023.
DR   EnsemblGenomes-Gn; EBG00001457024.
DR   EnsemblGenomes-Gn; EBG00001457025.
DR   EnsemblGenomes-Gn; EBG00001457026.
DR   EnsemblGenomes-Gn; EBG00001457027.
DR   EnsemblGenomes-Gn; EBG00001457028.
DR   EnsemblGenomes-Gn; EBG00001457029.
DR   EnsemblGenomes-Gn; EBG00001457030.
DR   EnsemblGenomes-Gn; EBG00001457031.
DR   EnsemblGenomes-Gn; EBG00001457032.
DR   EnsemblGenomes-Gn; EBG00001457033.
DR   EnsemblGenomes-Gn; EBG00001457034.
DR   EnsemblGenomes-Gn; EBG00001457035.
DR   EnsemblGenomes-Gn; EBG00001457036.
DR   EnsemblGenomes-Gn; EBG00001457037.
DR   EnsemblGenomes-Gn; EBG00001457038.
DR   EnsemblGenomes-Gn; EBG00001457039.
DR   EnsemblGenomes-Gn; EBG00001457040.
DR   EnsemblGenomes-Gn; EBG00001457041.
DR   EnsemblGenomes-Gn; EBG00001457042.
DR   EnsemblGenomes-Gn; EBG00001457043.
DR   EnsemblGenomes-Gn; EBG00001457044.
DR   EnsemblGenomes-Gn; EBG00001457045.
DR   EnsemblGenomes-Gn; EBG00001457046.
DR   EnsemblGenomes-Gn; EBG00001457047.
DR   EnsemblGenomes-Gn; EBG00001457048.
DR   EnsemblGenomes-Gn; EBG00001457049.
DR   EnsemblGenomes-Gn; EBG00001457050.
DR   EnsemblGenomes-Gn; EBG00001457051.
DR   EnsemblGenomes-Gn; EBG00001457052.
DR   EnsemblGenomes-Gn; EBG00001457053.
DR   EnsemblGenomes-Gn; EBG00001457054.
DR   EnsemblGenomes-Gn; EBG00001457055.
DR   EnsemblGenomes-Gn; EBG00001457056.
DR   EnsemblGenomes-Gn; EBG00001457057.
DR   EnsemblGenomes-Gn; EBG00001457058.
DR   EnsemblGenomes-Gn; EBG00001457059.
DR   EnsemblGenomes-Gn; EBG00001457060.
DR   EnsemblGenomes-Gn; EBG00001457061.
DR   EnsemblGenomes-Gn; EBG00001457062.
DR   EnsemblGenomes-Gn; EBG00001457063.
DR   EnsemblGenomes-Gn; EBG00001457064.
DR   EnsemblGenomes-Gn; EBG00001457065.
DR   EnsemblGenomes-Gn; EBG00001457066.
DR   EnsemblGenomes-Gn; EBG00001457067.
DR   EnsemblGenomes-Gn; EBG00001457068.
DR   EnsemblGenomes-Gn; EBG00001457069.
DR   EnsemblGenomes-Gn; EBG00001457070.
DR   EnsemblGenomes-Gn; EBG00001457071.
DR   EnsemblGenomes-Gn; EBG00001457072.
DR   EnsemblGenomes-Gn; EBG00001457073.
DR   EnsemblGenomes-Gn; EBG00001457074.
DR   EnsemblGenomes-Gn; EBG00001457075.
DR   EnsemblGenomes-Gn; EBG00001457076.
DR   EnsemblGenomes-Gn; EBG00001457077.
DR   EnsemblGenomes-Gn; EBG00001457078.
DR   EnsemblGenomes-Gn; EBG00001457079.
DR   EnsemblGenomes-Gn; EBG00001457080.
DR   EnsemblGenomes-Gn; EBG00001457081.
DR   EnsemblGenomes-Gn; EBG00001457082.
DR   EnsemblGenomes-Gn; EBG00001457083.
DR   EnsemblGenomes-Gn; EBG00001457084.
DR   EnsemblGenomes-Gn; EBG00001457085.
DR   EnsemblGenomes-Gn; EBG00001457086.
DR   EnsemblGenomes-Gn; EBG00001457087.
DR   EnsemblGenomes-Gn; EBG00001457088.
DR   EnsemblGenomes-Gn; EBG00001457089.
DR   EnsemblGenomes-Gn; EBG00001457090.
DR   EnsemblGenomes-Gn; EBG00001457091.
DR   EnsemblGenomes-Gn; EBG00001457092.
DR   EnsemblGenomes-Gn; EBG00001457093.
DR   EnsemblGenomes-Gn; EBG00001457094.
DR   EnsemblGenomes-Gn; EBG00001457095.
DR   EnsemblGenomes-Gn; EBG00001457096.
DR   EnsemblGenomes-Gn; EBG00001457097.
DR   EnsemblGenomes-Gn; EBG00001457098.
DR   EnsemblGenomes-Gn; EBG00001457099.
DR   EnsemblGenomes-Gn; EBG00001457100.
DR   EnsemblGenomes-Gn; EBG00001457101.
DR   EnsemblGenomes-Gn; EBG00001457102.
DR   EnsemblGenomes-Gn; EBG00001457103.
DR   EnsemblGenomes-Gn; EBG00001457104.
DR   EnsemblGenomes-Gn; EBG00001457105.
DR   EnsemblGenomes-Gn; EBG00001457106.
DR   EnsemblGenomes-Gn; EBG00001457107.
DR   EnsemblGenomes-Gn; EBG00001457108.
DR   EnsemblGenomes-Gn; EBG00001457109.
DR   EnsemblGenomes-Gn; EBG00001457110.
DR   EnsemblGenomes-Gn; EBG00001457111.
DR   EnsemblGenomes-Gn; EBG00001457112.
DR   EnsemblGenomes-Gn; EBG00001457113.
DR   EnsemblGenomes-Gn; EBG00001457114.
DR   EnsemblGenomes-Gn; EBG00001457115.
DR   EnsemblGenomes-Gn; EBG00001457116.
DR   EnsemblGenomes-Gn; EBG00001457117.
DR   EnsemblGenomes-Gn; EBG00001457118.
DR   EnsemblGenomes-Gn; EBG00001457119.
DR   EnsemblGenomes-Gn; EBG00001457120.
DR   EnsemblGenomes-Gn; EBG00001457121.
DR   EnsemblGenomes-Gn; EBG00001457122.
DR   EnsemblGenomes-Gn; EBG00001457123.
DR   EnsemblGenomes-Gn; EBG00001457124.
DR   EnsemblGenomes-Gn; EBG00001457125.
DR   EnsemblGenomes-Gn; EBG00001457126.
DR   EnsemblGenomes-Gn; EBG00001457127.
DR   EnsemblGenomes-Gn; EBG00001457128.
DR   EnsemblGenomes-Gn; EBG00001457129.
DR   EnsemblGenomes-Gn; EBG00001457130.
DR   EnsemblGenomes-Gn; EBG00001457131.
DR   EnsemblGenomes-Gn; EBG00001457132.
DR   EnsemblGenomes-Gn; EBG00001457133.
DR   EnsemblGenomes-Gn; EBG00001457134.
DR   EnsemblGenomes-Gn; EBG00001457135.
DR   EnsemblGenomes-Gn; EBG00001457136.
DR   EnsemblGenomes-Gn; EBG00001457137.
DR   EnsemblGenomes-Gn; EBG00001457138.
DR   EnsemblGenomes-Gn; EBG00001457139.
DR   EnsemblGenomes-Gn; EBG00001457140.
DR   EnsemblGenomes-Gn; EBG00001457141.
DR   EnsemblGenomes-Gn; EBG00001457142.
DR   EnsemblGenomes-Gn; EBG00001457143.
DR   EnsemblGenomes-Gn; EBG00001457144.
DR   EnsemblGenomes-Gn; EBG00001457145.
DR   EnsemblGenomes-Gn; EBG00001457146.
DR   EnsemblGenomes-Gn; YpAngola_A0013.
DR   EnsemblGenomes-Gn; YpAngola_A0014.
DR   EnsemblGenomes-Gn; YpAngola_A0016.
DR   EnsemblGenomes-Gn; YpAngola_A0126.
DR   EnsemblGenomes-Gn; YpAngola_A0127.
DR   EnsemblGenomes-Gn; YpAngola_A0128.
DR   EnsemblGenomes-Gn; YpAngola_A0130.
DR   EnsemblGenomes-Gn; YpAngola_A0131.
DR   EnsemblGenomes-Gn; YpAngola_A0161.
DR   EnsemblGenomes-Gn; YpAngola_A0304.
DR   EnsemblGenomes-Gn; YpAngola_A0328.
DR   EnsemblGenomes-Gn; YpAngola_A0329.
DR   EnsemblGenomes-Gn; YpAngola_A0330.
DR   EnsemblGenomes-Gn; YpAngola_A0331.
DR   EnsemblGenomes-Gn; YpAngola_A0332.
DR   EnsemblGenomes-Gn; YpAngola_A0397.
DR   EnsemblGenomes-Gn; YpAngola_A0467.
DR   EnsemblGenomes-Gn; YpAngola_A0468.
DR   EnsemblGenomes-Gn; YpAngola_A0469.
DR   EnsemblGenomes-Gn; YpAngola_A0471.
DR   EnsemblGenomes-Gn; YpAngola_A0472.
DR   EnsemblGenomes-Gn; YpAngola_A0473.
DR   EnsemblGenomes-Gn; YpAngola_A0474.
DR   EnsemblGenomes-Gn; YpAngola_A0525.
DR   EnsemblGenomes-Gn; YpAngola_A0526.
DR   EnsemblGenomes-Gn; YpAngola_A0527.
DR   EnsemblGenomes-Gn; YpAngola_A0528.
DR   EnsemblGenomes-Gn; YpAngola_A0625.
DR   EnsemblGenomes-Gn; YpAngola_A0626.
DR   EnsemblGenomes-Gn; YpAngola_A0627.
DR   EnsemblGenomes-Gn; YpAngola_A0629.
DR   EnsemblGenomes-Gn; YpAngola_A0630.
DR   EnsemblGenomes-Gn; YpAngola_A0631.
DR   EnsemblGenomes-Gn; YpAngola_A0632.
DR   EnsemblGenomes-Gn; YpAngola_A0706.
DR   EnsemblGenomes-Gn; YpAngola_A0707.
DR   EnsemblGenomes-Gn; YpAngola_A0733.
DR   EnsemblGenomes-Gn; YpAngola_A0841.
DR   EnsemblGenomes-Gn; YpAngola_A0894.
DR   EnsemblGenomes-Gn; YpAngola_A0895.
DR   EnsemblGenomes-Gn; YpAngola_A0896.
DR   EnsemblGenomes-Gn; YpAngola_A0897.
DR   EnsemblGenomes-Gn; YpAngola_A1282.
DR   EnsemblGenomes-Gn; YpAngola_A1400.
DR   EnsemblGenomes-Gn; YpAngola_A1401.
DR   EnsemblGenomes-Gn; YpAngola_A1402.
DR   EnsemblGenomes-Gn; YpAngola_A1445.
DR   EnsemblGenomes-Gn; YpAngola_A1446.
DR   EnsemblGenomes-Gn; YpAngola_A1483.
DR   EnsemblGenomes-Gn; YpAngola_A1678.
DR   EnsemblGenomes-Gn; YpAngola_A1689.
DR   EnsemblGenomes-Gn; YpAngola_A1918.
DR   EnsemblGenomes-Gn; YpAngola_A1919.
DR   EnsemblGenomes-Gn; YpAngola_A1922.
DR   EnsemblGenomes-Gn; YpAngola_A1923.
DR   EnsemblGenomes-Gn; YpAngola_A1924.
DR   EnsemblGenomes-Gn; YpAngola_A2046.
DR   EnsemblGenomes-Gn; YpAngola_A2055.
DR   EnsemblGenomes-Gn; YpAngola_A2056.
DR   EnsemblGenomes-Gn; YpAngola_A2057.
DR   EnsemblGenomes-Gn; YpAngola_A2105.
DR   EnsemblGenomes-Gn; YpAngola_A2336.
DR   EnsemblGenomes-Gn; YpAngola_A2453.
DR   EnsemblGenomes-Gn; YpAngola_A2580.
DR   EnsemblGenomes-Gn; YpAngola_A2581.
DR   EnsemblGenomes-Gn; YpAngola_A2681.
DR   EnsemblGenomes-Gn; YpAngola_A2736.
DR   EnsemblGenomes-Gn; YpAngola_A2737.
DR   EnsemblGenomes-Gn; YpAngola_A2738.
DR   EnsemblGenomes-Gn; YpAngola_A2740.
DR   EnsemblGenomes-Gn; YpAngola_A2799.
DR   EnsemblGenomes-Gn; YpAngola_A2800.
DR   EnsemblGenomes-Gn; YpAngola_A2801.
DR   EnsemblGenomes-Gn; YpAngola_A2802.
DR   EnsemblGenomes-Gn; YpAngola_A3212.
DR   EnsemblGenomes-Gn; YpAngola_A3226.
DR   EnsemblGenomes-Gn; YpAngola_A3227.
DR   EnsemblGenomes-Gn; YpAngola_A3398.
DR   EnsemblGenomes-Gn; YpAngola_A3399.
DR   EnsemblGenomes-Gn; YpAngola_A3401.
DR   EnsemblGenomes-Gn; YpAngola_A3402.
DR   EnsemblGenomes-Gn; YpAngola_A3468.
DR   EnsemblGenomes-Gn; YpAngola_A3469.
DR   EnsemblGenomes-Gn; YpAngola_A3472.
DR   EnsemblGenomes-Gn; YpAngola_A3473.
DR   EnsemblGenomes-Gn; YpAngola_A3852.
DR   EnsemblGenomes-Gn; YpAngola_A3989.
DR   EnsemblGenomes-Gn; YpAngola_A3990.
DR   EnsemblGenomes-Gn; YpAngola_A4050.
DR   EnsemblGenomes-Gn; YpAngola_A4129.
DR   EnsemblGenomes-Gn; YpAngola_A4154.
DR   EnsemblGenomes-Gn; YpAngola_A4220.
DR   EnsemblGenomes-Gn; YpAngola_A4223.
DR   EnsemblGenomes-Gn; YpAngola_A4225.
DR   EnsemblGenomes-Gn; YpAngola_A4232.
DR   EnsemblGenomes-Gn; YpAngola_A4245.
DR   EnsemblGenomes-Tr; EBT00001610519.
DR   EnsemblGenomes-Tr; EBT00001610520.
DR   EnsemblGenomes-Tr; EBT00001610521.
DR   EnsemblGenomes-Tr; EBT00001610522.
DR   EnsemblGenomes-Tr; EBT00001610523.
DR   EnsemblGenomes-Tr; EBT00001610524.
DR   EnsemblGenomes-Tr; EBT00001610525.
DR   EnsemblGenomes-Tr; EBT00001610526.
DR   EnsemblGenomes-Tr; EBT00001610527.
DR   EnsemblGenomes-Tr; EBT00001610528.
DR   EnsemblGenomes-Tr; EBT00001610529.
DR   EnsemblGenomes-Tr; EBT00001610530.
DR   EnsemblGenomes-Tr; EBT00001610531.
DR   EnsemblGenomes-Tr; EBT00001610532.
DR   EnsemblGenomes-Tr; EBT00001610533.
DR   EnsemblGenomes-Tr; EBT00001610534.
DR   EnsemblGenomes-Tr; EBT00001610535.
DR   EnsemblGenomes-Tr; EBT00001610536.
DR   EnsemblGenomes-Tr; EBT00001610537.
DR   EnsemblGenomes-Tr; EBT00001610538.
DR   EnsemblGenomes-Tr; EBT00001610539.
DR   EnsemblGenomes-Tr; EBT00001610540.
DR   EnsemblGenomes-Tr; EBT00001610541.
DR   EnsemblGenomes-Tr; EBT00001610542.
DR   EnsemblGenomes-Tr; EBT00001610543.
DR   EnsemblGenomes-Tr; EBT00001610544.
DR   EnsemblGenomes-Tr; EBT00001610545.
DR   EnsemblGenomes-Tr; EBT00001610546.
DR   EnsemblGenomes-Tr; EBT00001610547.
DR   EnsemblGenomes-Tr; EBT00001610548.
DR   EnsemblGenomes-Tr; EBT00001610549.
DR   EnsemblGenomes-Tr; EBT00001610550.
DR   EnsemblGenomes-Tr; EBT00001610551.
DR   EnsemblGenomes-Tr; EBT00001610552.
DR   EnsemblGenomes-Tr; EBT00001610553.
DR   EnsemblGenomes-Tr; EBT00001610554.
DR   EnsemblGenomes-Tr; EBT00001610555.
DR   EnsemblGenomes-Tr; EBT00001610556.
DR   EnsemblGenomes-Tr; EBT00001610557.
DR   EnsemblGenomes-Tr; EBT00001610558.
DR   EnsemblGenomes-Tr; EBT00001610559.
DR   EnsemblGenomes-Tr; EBT00001610560.
DR   EnsemblGenomes-Tr; EBT00001610561.
DR   EnsemblGenomes-Tr; EBT00001610562.
DR   EnsemblGenomes-Tr; EBT00001610563.
DR   EnsemblGenomes-Tr; EBT00001610564.
DR   EnsemblGenomes-Tr; EBT00001610565.
DR   EnsemblGenomes-Tr; EBT00001610566.
DR   EnsemblGenomes-Tr; EBT00001610567.
DR   EnsemblGenomes-Tr; EBT00001610568.
DR   EnsemblGenomes-Tr; EBT00001610569.
DR   EnsemblGenomes-Tr; EBT00001610570.
DR   EnsemblGenomes-Tr; EBT00001610571.
DR   EnsemblGenomes-Tr; EBT00001610572.
DR   EnsemblGenomes-Tr; EBT00001610573.
DR   EnsemblGenomes-Tr; EBT00001610574.
DR   EnsemblGenomes-Tr; EBT00001610575.
DR   EnsemblGenomes-Tr; EBT00001610576.
DR   EnsemblGenomes-Tr; EBT00001610577.
DR   EnsemblGenomes-Tr; EBT00001610578.
DR   EnsemblGenomes-Tr; EBT00001610579.
DR   EnsemblGenomes-Tr; EBT00001610580.
DR   EnsemblGenomes-Tr; EBT00001610581.
DR   EnsemblGenomes-Tr; EBT00001610582.
DR   EnsemblGenomes-Tr; EBT00001610583.
DR   EnsemblGenomes-Tr; EBT00001610584.
DR   EnsemblGenomes-Tr; EBT00001610585.
DR   EnsemblGenomes-Tr; EBT00001610586.
DR   EnsemblGenomes-Tr; EBT00001610587.
DR   EnsemblGenomes-Tr; EBT00001610588.
DR   EnsemblGenomes-Tr; EBT00001610589.
DR   EnsemblGenomes-Tr; EBT00001610590.
DR   EnsemblGenomes-Tr; EBT00001610591.
DR   EnsemblGenomes-Tr; EBT00001610592.
DR   EnsemblGenomes-Tr; EBT00001610593.
DR   EnsemblGenomes-Tr; EBT00001610594.
DR   EnsemblGenomes-Tr; EBT00001610595.
DR   EnsemblGenomes-Tr; EBT00001610596.
DR   EnsemblGenomes-Tr; EBT00001610597.
DR   EnsemblGenomes-Tr; EBT00001610598.
DR   EnsemblGenomes-Tr; EBT00001610599.
DR   EnsemblGenomes-Tr; EBT00001610600.
DR   EnsemblGenomes-Tr; EBT00001610601.
DR   EnsemblGenomes-Tr; EBT00001610602.
DR   EnsemblGenomes-Tr; EBT00001610603.
DR   EnsemblGenomes-Tr; EBT00001610604.
DR   EnsemblGenomes-Tr; EBT00001610605.
DR   EnsemblGenomes-Tr; EBT00001610606.
DR   EnsemblGenomes-Tr; EBT00001610607.
DR   EnsemblGenomes-Tr; EBT00001610608.
DR   EnsemblGenomes-Tr; EBT00001610609.
DR   EnsemblGenomes-Tr; EBT00001610610.
DR   EnsemblGenomes-Tr; EBT00001610611.
DR   EnsemblGenomes-Tr; EBT00001610612.
DR   EnsemblGenomes-Tr; EBT00001610613.
DR   EnsemblGenomes-Tr; EBT00001610614.
DR   EnsemblGenomes-Tr; EBT00001610615.
DR   EnsemblGenomes-Tr; EBT00001610616.
DR   EnsemblGenomes-Tr; EBT00001610617.
DR   EnsemblGenomes-Tr; EBT00001610618.
DR   EnsemblGenomes-Tr; EBT00001610619.
DR   EnsemblGenomes-Tr; EBT00001610620.
DR   EnsemblGenomes-Tr; EBT00001610621.
DR   EnsemblGenomes-Tr; EBT00001610622.
DR   EnsemblGenomes-Tr; EBT00001610623.
DR   EnsemblGenomes-Tr; EBT00001610624.
DR   EnsemblGenomes-Tr; EBT00001610625.
DR   EnsemblGenomes-Tr; EBT00001610626.
DR   EnsemblGenomes-Tr; EBT00001610627.
DR   EnsemblGenomes-Tr; EBT00001610628.
DR   EnsemblGenomes-Tr; EBT00001610629.
DR   EnsemblGenomes-Tr; EBT00001610630.
DR   EnsemblGenomes-Tr; EBT00001610631.
DR   EnsemblGenomes-Tr; EBT00001610632.
DR   EnsemblGenomes-Tr; EBT00001610633.
DR   EnsemblGenomes-Tr; EBT00001610634.
DR   EnsemblGenomes-Tr; EBT00001610635.
DR   EnsemblGenomes-Tr; EBT00001610636.
DR   EnsemblGenomes-Tr; EBT00001610637.
DR   EnsemblGenomes-Tr; EBT00001610638.
DR   EnsemblGenomes-Tr; EBT00001610639.
DR   EnsemblGenomes-Tr; EBT00001610640.
DR   EnsemblGenomes-Tr; EBT00001610641.
DR   EnsemblGenomes-Tr; EBT00001610642.
DR   EnsemblGenomes-Tr; EBT00001610643.
DR   EnsemblGenomes-Tr; EBT00001610644.
DR   EnsemblGenomes-Tr; EBT00001610645.
DR   EnsemblGenomes-Tr; EBT00001610646.
DR   EnsemblGenomes-Tr; EBT00001610647.
DR   EnsemblGenomes-Tr; EBT00001610648.
DR   EnsemblGenomes-Tr; EBT00001610649.
DR   EnsemblGenomes-Tr; EBT00001610650.
DR   EnsemblGenomes-Tr; EBT00001610651.
DR   EnsemblGenomes-Tr; EBT00001610652.
DR   EnsemblGenomes-Tr; EBT00001610653.
DR   EnsemblGenomes-Tr; EBT00001610654.
DR   EnsemblGenomes-Tr; EBT00001610655.
DR   EnsemblGenomes-Tr; EBT00001610656.
DR   EnsemblGenomes-Tr; EBT00001610657.
DR   EnsemblGenomes-Tr; EBT00001610658.
DR   EnsemblGenomes-Tr; EBT00001610659.
DR   EnsemblGenomes-Tr; EBT00001610660.
DR   EnsemblGenomes-Tr; EBT00001610661.
DR   EnsemblGenomes-Tr; EBT00001610662.
DR   EnsemblGenomes-Tr; EBT00001610663.
DR   EnsemblGenomes-Tr; EBT00001610664.
DR   EnsemblGenomes-Tr; EBT00001610665.
DR   EnsemblGenomes-Tr; EBT00001610666.
DR   EnsemblGenomes-Tr; EBT00001610667.
DR   EnsemblGenomes-Tr; EBT00001610668.
DR   EnsemblGenomes-Tr; EBT00001610669.
DR   EnsemblGenomes-Tr; EBT00001610670.
DR   EnsemblGenomes-Tr; EBT00001610671.
DR   EnsemblGenomes-Tr; EBT00001610672.
DR   EnsemblGenomes-Tr; EBT00001610673.
DR   EnsemblGenomes-Tr; EBT00001610674.
DR   EnsemblGenomes-Tr; EBT00001610675.
DR   EnsemblGenomes-Tr; EBT00001610676.
DR   EnsemblGenomes-Tr; EBT00001610677.
DR   EnsemblGenomes-Tr; EBT00001610678.
DR   EnsemblGenomes-Tr; EBT00001610679.
DR   EnsemblGenomes-Tr; EBT00001610680.
DR   EnsemblGenomes-Tr; EBT00001610681.
DR   EnsemblGenomes-Tr; EBT00001610682.
DR   EnsemblGenomes-Tr; EBT00001610683.
DR   EnsemblGenomes-Tr; EBT00001610684.
DR   EnsemblGenomes-Tr; EBT00001610685.
DR   EnsemblGenomes-Tr; EBT00001610686.
DR   EnsemblGenomes-Tr; EBT00001610687.
DR   EnsemblGenomes-Tr; EBT00001610688.
DR   EnsemblGenomes-Tr; EBT00001610689.
DR   EnsemblGenomes-Tr; EBT00001610690.
DR   EnsemblGenomes-Tr; EBT00001610691.
DR   EnsemblGenomes-Tr; EBT00001610692.
DR   EnsemblGenomes-Tr; EBT00001610693.
DR   EnsemblGenomes-Tr; EBT00001610694.
DR   EnsemblGenomes-Tr; EBT00001610695.
DR   EnsemblGenomes-Tr; EBT00001610696.
DR   EnsemblGenomes-Tr; EBT00001610697.
DR   EnsemblGenomes-Tr; EBT00001610698.
DR   EnsemblGenomes-Tr; EBT00001610699.
DR   EnsemblGenomes-Tr; EBT00001610700.
DR   EnsemblGenomes-Tr; EBT00001610701.
DR   EnsemblGenomes-Tr; EBT00001610702.
DR   EnsemblGenomes-Tr; EBT00001610703.
DR   EnsemblGenomes-Tr; EBT00001610704.
DR   EnsemblGenomes-Tr; EBT00001610705.
DR   EnsemblGenomes-Tr; EBT00001610706.
DR   EnsemblGenomes-Tr; EBT00001610707.
DR   EnsemblGenomes-Tr; EBT00001610708.
DR   EnsemblGenomes-Tr; EBT00001610709.
DR   EnsemblGenomes-Tr; EBT00001610710.
DR   EnsemblGenomes-Tr; EBT00001610711.
DR   EnsemblGenomes-Tr; EBT00001610712.
DR   EnsemblGenomes-Tr; EBT00001610713.
DR   EnsemblGenomes-Tr; EBT00001610714.
DR   EnsemblGenomes-Tr; EBT00001610715.
DR   EnsemblGenomes-Tr; EBT00001610716.
DR   EnsemblGenomes-Tr; EBT00001610717.
DR   EnsemblGenomes-Tr; EBT00001610718.
DR   EnsemblGenomes-Tr; EBT00001610719.
DR   EnsemblGenomes-Tr; EBT00001610720.
DR   EnsemblGenomes-Tr; EBT00001610721.
DR   EnsemblGenomes-Tr; EBT00001610722.
DR   EnsemblGenomes-Tr; EBT00001610723.
DR   EnsemblGenomes-Tr; EBT00001610724.
DR   EnsemblGenomes-Tr; EBT00001610725.
DR   EnsemblGenomes-Tr; EBT00001610726.
DR   EnsemblGenomes-Tr; EBT00001610727.
DR   EnsemblGenomes-Tr; EBT00001610728.
DR   EnsemblGenomes-Tr; EBT00001610729.
DR   EnsemblGenomes-Tr; EBT00001610730.
DR   EnsemblGenomes-Tr; EBT00001610731.
DR   EnsemblGenomes-Tr; EBT00001610732.
DR   EnsemblGenomes-Tr; EBT00001610733.
DR   EnsemblGenomes-Tr; EBT00001610734.
DR   EnsemblGenomes-Tr; EBT00001610735.
DR   EnsemblGenomes-Tr; EBT00001610736.
DR   EnsemblGenomes-Tr; EBT00001610737.
DR   EnsemblGenomes-Tr; EBT00001610738.
DR   EnsemblGenomes-Tr; EBT00001610739.
DR   EnsemblGenomes-Tr; EBT00001610740.
DR   EnsemblGenomes-Tr; EBT00001610741.
DR   EnsemblGenomes-Tr; EBT00001610742.
DR   EnsemblGenomes-Tr; EBT00001610743.
DR   EnsemblGenomes-Tr; EBT00001610744.
DR   EnsemblGenomes-Tr; EBT00001610745.
DR   EnsemblGenomes-Tr; EBT00001610746.
DR   EnsemblGenomes-Tr; EBT00001610747.
DR   EnsemblGenomes-Tr; EBT00001610748.
DR   EnsemblGenomes-Tr; EBT00001610749.
DR   EnsemblGenomes-Tr; EBT00001610750.
DR   EnsemblGenomes-Tr; EBT00001610751.
DR   EnsemblGenomes-Tr; EBT00001610752.
DR   EnsemblGenomes-Tr; EBT00001610753.
DR   EnsemblGenomes-Tr; EBT00001610754.
DR   EnsemblGenomes-Tr; EBT00001610755.
DR   EnsemblGenomes-Tr; EBT00001610756.
DR   EnsemblGenomes-Tr; EBT00001610757.
DR   EnsemblGenomes-Tr; EBT00001610758.
DR   EnsemblGenomes-Tr; EBT00001610759.
DR   EnsemblGenomes-Tr; EBT00001610760.
DR   EnsemblGenomes-Tr; EBT00001610761.
DR   EnsemblGenomes-Tr; EBT00001610762.
DR   EnsemblGenomes-Tr; EBT00001610763.
DR   EnsemblGenomes-Tr; EBT00001610764.
DR   EnsemblGenomes-Tr; EBT00001610765.
DR   EnsemblGenomes-Tr; EBT00001610766.
DR   EnsemblGenomes-Tr; EBT00001610767.
DR   EnsemblGenomes-Tr; EBT00001610768.
DR   EnsemblGenomes-Tr; EBT00001610769.
DR   EnsemblGenomes-Tr; EBT00001610770.
DR   EnsemblGenomes-Tr; EBT00001610771.
DR   EnsemblGenomes-Tr; EBT00001610772.
DR   EnsemblGenomes-Tr; EBT00001610773.
DR   EnsemblGenomes-Tr; YpAngola_A0013-1.
DR   EnsemblGenomes-Tr; YpAngola_A0014-1.
DR   EnsemblGenomes-Tr; YpAngola_A0016-1.
DR   EnsemblGenomes-Tr; YpAngola_A0126-1.
DR   EnsemblGenomes-Tr; YpAngola_A0127-1.
DR   EnsemblGenomes-Tr; YpAngola_A0128-1.
DR   EnsemblGenomes-Tr; YpAngola_A0130-1.
DR   EnsemblGenomes-Tr; YpAngola_A0131-1.
DR   EnsemblGenomes-Tr; YpAngola_A0161-1.
DR   EnsemblGenomes-Tr; YpAngola_A0304-1.
DR   EnsemblGenomes-Tr; YpAngola_A0328-1.
DR   EnsemblGenomes-Tr; YpAngola_A0329-1.
DR   EnsemblGenomes-Tr; YpAngola_A0330-1.
DR   EnsemblGenomes-Tr; YpAngola_A0331-1.
DR   EnsemblGenomes-Tr; YpAngola_A0332-1.
DR   EnsemblGenomes-Tr; YpAngola_A0397-1.
DR   EnsemblGenomes-Tr; YpAngola_A0467-1.
DR   EnsemblGenomes-Tr; YpAngola_A0468-1.
DR   EnsemblGenomes-Tr; YpAngola_A0469-1.
DR   EnsemblGenomes-Tr; YpAngola_A0471-1.
DR   EnsemblGenomes-Tr; YpAngola_A0472-1.
DR   EnsemblGenomes-Tr; YpAngola_A0473-1.
DR   EnsemblGenomes-Tr; YpAngola_A0474-1.
DR   EnsemblGenomes-Tr; YpAngola_A0525-1.
DR   EnsemblGenomes-Tr; YpAngola_A0526-1.
DR   EnsemblGenomes-Tr; YpAngola_A0527-1.
DR   EnsemblGenomes-Tr; YpAngola_A0528-1.
DR   EnsemblGenomes-Tr; YpAngola_A0625-1.
DR   EnsemblGenomes-Tr; YpAngola_A0626-1.
DR   EnsemblGenomes-Tr; YpAngola_A0627-1.
DR   EnsemblGenomes-Tr; YpAngola_A0629-1.
DR   EnsemblGenomes-Tr; YpAngola_A0630-1.
DR   EnsemblGenomes-Tr; YpAngola_A0631-1.
DR   EnsemblGenomes-Tr; YpAngola_A0632-1.
DR   EnsemblGenomes-Tr; YpAngola_A0706-1.
DR   EnsemblGenomes-Tr; YpAngola_A0707-1.
DR   EnsemblGenomes-Tr; YpAngola_A0733-1.
DR   EnsemblGenomes-Tr; YpAngola_A0841-1.
DR   EnsemblGenomes-Tr; YpAngola_A0894-1.
DR   EnsemblGenomes-Tr; YpAngola_A0895-1.
DR   EnsemblGenomes-Tr; YpAngola_A0896-1.
DR   EnsemblGenomes-Tr; YpAngola_A0897-1.
DR   EnsemblGenomes-Tr; YpAngola_A1282-1.
DR   EnsemblGenomes-Tr; YpAngola_A1400-1.
DR   EnsemblGenomes-Tr; YpAngola_A1401-1.
DR   EnsemblGenomes-Tr; YpAngola_A1402-1.
DR   EnsemblGenomes-Tr; YpAngola_A1445-1.
DR   EnsemblGenomes-Tr; YpAngola_A1446-1.
DR   EnsemblGenomes-Tr; YpAngola_A1483-1.
DR   EnsemblGenomes-Tr; YpAngola_A1678-1.
DR   EnsemblGenomes-Tr; YpAngola_A1689-1.
DR   EnsemblGenomes-Tr; YpAngola_A1918-1.
DR   EnsemblGenomes-Tr; YpAngola_A1919-1.
DR   EnsemblGenomes-Tr; YpAngola_A1922-1.
DR   EnsemblGenomes-Tr; YpAngola_A1923-1.
DR   EnsemblGenomes-Tr; YpAngola_A1924-1.
DR   EnsemblGenomes-Tr; YpAngola_A2046-1.
DR   EnsemblGenomes-Tr; YpAngola_A2055-1.
DR   EnsemblGenomes-Tr; YpAngola_A2056-1.
DR   EnsemblGenomes-Tr; YpAngola_A2057-1.
DR   EnsemblGenomes-Tr; YpAngola_A2105-1.
DR   EnsemblGenomes-Tr; YpAngola_A2336-1.
DR   EnsemblGenomes-Tr; YpAngola_A2453-1.
DR   EnsemblGenomes-Tr; YpAngola_A2580-1.
DR   EnsemblGenomes-Tr; YpAngola_A2581-1.
DR   EnsemblGenomes-Tr; YpAngola_A2681-1.
DR   EnsemblGenomes-Tr; YpAngola_A2736-1.
DR   EnsemblGenomes-Tr; YpAngola_A2737-1.
DR   EnsemblGenomes-Tr; YpAngola_A2738-1.
DR   EnsemblGenomes-Tr; YpAngola_A2740-1.
DR   EnsemblGenomes-Tr; YpAngola_A2799-1.
DR   EnsemblGenomes-Tr; YpAngola_A2800-1.
DR   EnsemblGenomes-Tr; YpAngola_A2801-1.
DR   EnsemblGenomes-Tr; YpAngola_A2802-1.
DR   EnsemblGenomes-Tr; YpAngola_A3212-1.
DR   EnsemblGenomes-Tr; YpAngola_A3226-1.
DR   EnsemblGenomes-Tr; YpAngola_A3227-1.
DR   EnsemblGenomes-Tr; YpAngola_A3398-1.
DR   EnsemblGenomes-Tr; YpAngola_A3399-1.
DR   EnsemblGenomes-Tr; YpAngola_A3401-1.
DR   EnsemblGenomes-Tr; YpAngola_A3402-1.
DR   EnsemblGenomes-Tr; YpAngola_A3468-1.
DR   EnsemblGenomes-Tr; YpAngola_A3469-1.
DR   EnsemblGenomes-Tr; YpAngola_A3472-1.
DR   EnsemblGenomes-Tr; YpAngola_A3473-1.
DR   EnsemblGenomes-Tr; YpAngola_A3852-1.
DR   EnsemblGenomes-Tr; YpAngola_A3989-1.
DR   EnsemblGenomes-Tr; YpAngola_A3990-1.
DR   EnsemblGenomes-Tr; YpAngola_A4050-1.
DR   EnsemblGenomes-Tr; YpAngola_A4129-1.
DR   EnsemblGenomes-Tr; YpAngola_A4154-1.
DR   EnsemblGenomes-Tr; YpAngola_A4220-1.
DR   EnsemblGenomes-Tr; YpAngola_A4223-1.
DR   EnsemblGenomes-Tr; YpAngola_A4225-1.
DR   EnsemblGenomes-Tr; YpAngola_A4232-1.
DR   EnsemblGenomes-Tr; YpAngola_A4245-1.
DR   EuropePMC; PMC2530875; 18647395.
DR   EuropePMC; PMC2806259; 20017936.
DR   EuropePMC; PMC2832528; 20061468.
DR   EuropePMC; PMC3172189; 21931876.
DR   EuropePMC; PMC4191943; 25299702.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01393; isrJ.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   SILVA-LSU; CP000901.
DR   SILVA-SSU; CP000901.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4504254
FT                   /organism="Yersinia pestis Angola"
FT                   /strain="Angola"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:349746"
FT   gene            complement(270..710)
FT                   /gene="mioC"
FT                   /locus_tag="YpAngola_A0001"
FT   CDS_pept        complement(270..710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mioC"
FT                   /locus_tag="YpAngola_A0001"
FT                   /product="MioC protein"
FT                   /note="identified by match to protein family HMM PF00258"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85603"
FT                   /protein_id="ABX85603.1"
FT                   /translation="MADITLISGSTLGSAEYVAEHLADKLEEAGFSTEILHGPELDELT
FT                   LNGLWLIVTSTHGAGDLPDNLQPLLEQIEQQKPDLSQVRFGAVGLGSSEYDTFCGAIIK
FT                   LDQQLIAQGAQRLGEILEIDVIQHEIPEDPAEIWVKDWINLL"
FT   gene            complement(803..1264)
FT                   /locus_tag="YpAngola_A0002"
FT   CDS_pept        complement(803..1264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0002"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85203"
FT                   /protein_id="ABX85203.1"
FT                   /translation="MSEIYQIDNLDRSILKALMENARTPYAELAKNLAVSPGTIHVRVE
FT                   KMRQAGIITAACVHVNPKQLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYTTG
FT                   HYSIFIKVMCKSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
FT   gene            1434..2426
FT                   /gene="asnA"
FT                   /locus_tag="YpAngola_A0003"
FT   CDS_pept        1434..2426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="YpAngola_A0003"
FT                   /product="aspartate--ammonia ligase"
FT                   /EC_number="6.3.1.1"
FT                   /note="identified by match to protein family HMM PF03590;
FT                   match to protein family HMM TIGR00669"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86664"
FT                   /db_xref="GOA:A9QYG3"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYG3"
FT                   /protein_id="ABX86664.1"
FT                   /translation="MKKQFIQKQQQISFVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQ
FT                   DNLSGSEKAVQVKVKSLPDSTFEVVHSLAKWKRKTLGRFDFGADQGVYTHMKALRPDED
FT                   RLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIKETEAAISAEFGVKPFLPD
FT                   HIQFIHSESLRARFPDLDAKGRERAIAKELGAVFLIGIGGKLADGQSHDVRAPDYDDWT
FT                   SPSAEGFSGLNGDIIVWNPILEDAFEISSMGIRVDAEALKRQLALTGDEDRLELEWHQS
FT                   LLRGEMPQTIGGGIGQSRLVMLLLQKQHIGQVQCGVWGPEISEKVDGLL"
FT   gene            complement(2525..3991)
FT                   /locus_tag="YpAngola_A0004"
FT   CDS_pept        complement(2525..3991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0004"
FT                   /product="protein viaA"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86273"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYG4"
FT                   /protein_id="ABX86273.1"
FT                   /translation="MLSLATLDMLLSISEGELIEEMVVGLLAAPQLAIFFEKFPRIKRA
FT                   LMKDIPGWKQNLQQRIREASVPPGLANEFSLYQQSLLEDSPQFYAHLPDIVAQLQDLHS
FT                   PFATQAKTLVQTADLAKNPPGGDSLQTLFLQRWRVSLILQTITIHHQLLEQEREQLLAE
FT                   LQRRLALSGALEPILTTNDNAAGRLWDMSQGHLQRGDYQLLLQYGDFLQQQPELIRLAE
FT                   QLGRSRSAKAQPAPDARYEPYTVMVRQPDSVPEEVSGIHQSNDILRLLPTELVMLGMSE
FT                   LEFEFYRRLLERRLLTYRLQGDNWQEKTQQRPVSLKQNDEQPRGPFIVCVDTSGSMGGF
FT                   NEQCAKAFCLALLRIALADNRRCYIMLFATEIIHYELSADNGIEQAIRFLNQHFRGGTD
FT                   LAACLANTLNKMEDREWYDADAVIISDFIAQRLPEELVRKIKIQQQAHQHRFHAVAMSA
FT                   YGKPGIMRIFDHIWRFDTSLKSRLIRRWKR"
FT   gene            complement(3995..5533)
FT                   /locus_tag="YpAngola_A0005"
FT   CDS_pept        complement(3995..5533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0005"
FT                   /product="putative ATPase RavA"
FT                   /note="identified by match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86752"
FT                   /db_xref="GOA:A9QYG5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR023671"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYG5"
FT                   /protein_id="ABX86752.1"
FT                   /translation="MAQSSQLAERISRLSHALESGLYERQEAIRLCLLAALSGESVFLL
FT                   GPPGIAKSLIARRLKFAFRHARAFEYLMTRFSTPEEVFGPLSIQALKEEGRYQRMTGGY
FT                   LPEAEIVFLDEIWKAGPAILNTLLTAINERRFRNGDREDSIPMRLLVTASNELPDADSS
FT                   LEALYDRMLIRLWLDRVQEKQNFRSLLISRQNENHNPVAENLSITDEEFHQWQPLIDKI
FT                   TLPDHCFELIFQLRQRLSALEHTPYVSDRRWKKALRLLQASAFFSGRDEITPIDLILLK
FT                   DCLWHDLNSFKLLQQQLEQLLTEQGYQQQNLLMKLQDINSKWLQHQQQQSDHQALTVVK
FT                   QSGMFSRKAQYALPDNLTDSTLTLLLQKPLNLHDIQVNHLQVDKEALAQWLNKGGALRA
FT                   KLNGVGYAQSIDAEIDDQLHIIILDVSRQPSTLSLPGATTTSVPPELLLALTKLESTLA
FT                   EQRRLFSQHQPCLFTPSSWLAKIEASLLQVVEQLQFQQIQFQQRKFQQQKHSGH"
FT   gene            5807..7675
FT                   /gene="kup"
FT                   /locus_tag="YpAngola_A0006"
FT   CDS_pept        5807..7675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /locus_tag="YpAngola_A0006"
FT                   /product="potassium uptake protein"
FT                   /note="identified by match to protein family HMM PF02705;
FT                   match to protein family HMM TIGR00794"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86203"
FT                   /db_xref="GOA:A9QYG6"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYG6"
FT                   /protein_id="ABX86203.1"
FT                   /translation="MSTEHKQYLSAVTLAAIGVVYGDIGTSPLYTLRECFSGHYGFDVR
FT                   PDVVFGFLSLIFWMLILVVSVKYLTYVMRADNAGEGGILTLMSLAGRNTSSRATSILVV
FT                   LGLIGGSFFYGEVVITPAISVMSAIEGLEIAAPALDPYIVPCSIAVLTLLFVIQKHGTG
FT                   SVGKLFAPVMLVWFLTLALLGLRSIIANPEVLAALNPKWAISFFVEYKSVSFFALGAVV
FT                   LAITGVEALYADMGHFGKFPIRLAWFTVVLPSLVLNYFGQGALLLKNPEAIKNPFFLLA
FT                   PDWALIPLLILATLATVIASQAVISGVFSLTRQAVRLGYLPPMRIIHTSEMESGQIYIP
FT                   VINWTLYLAVVLVIIGFERSSNLAAAYGIAVTGTMVITSILFCTVAWKNWHWNRFLVVF
FT                   LLMVLLIIDIPMFSANVLKLFSGGWLPLSLGLVMFIIMTTWKSERFSLLRRMHEHSNSL
FT                   EAMIASLEKSPPVRVPGTAVYMSRAMNVIPFALLHNLKHNKVLHERVVLLTMRTDDVPY
FT                   VHNVERVTIEQLSPTFWRVVARYGWRETPNVAEIFHRCGLEGLSCQMMETSFFMSHESL
FT                   ILTKRPWHLFLRGKLFIALSRNALRAPDQFEIPPNRVIELGTQVEI"
FT   gene            7880..8299
FT                   /gene="rbsD"
FT                   /locus_tag="YpAngola_A0007"
FT   CDS_pept        7880..8299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="YpAngola_A0007"
FT                   /product="cytoplasmic D-ribose-binding protein RbsD"
FT                   /note="identified by match to protein family HMM PF05025"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87354"
FT                   /db_xref="GOA:A9QYG7"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYG7"
FT                   /protein_id="ABX87354.1"
FT                   /translation="MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALT
FT                   RGVPGFLQVVDVVTQEMQVENAYLAEEIVKNNPQLHEALLVLLTQLEQRQENQIALRYI
FT                   SHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF"
FT   gene            8350..9276
FT                   /gene="rbsK"
FT                   /locus_tag="YpAngola_A0008"
FT   CDS_pept        8350..9276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="YpAngola_A0008"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM PF08543; match to protein
FT                   family HMM TIGR02152"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86799"
FT                   /protein_id="ABX86799.1"
FT                   /translation="METGKLVVLGSINADHILNIEQFPRPGETVIGQQYNVAFGGKGAN
FT                   QAVAAGRSGADIAFIACVGDDDIGERVRQQLTADKIDTQPIEAIKGATTGVALIFVNSD
FT                   GENVIGINAGANSAVTPEYLRRYQQQVIDADALLMQLESPLDTVIAAAKLAKQHQTQVI
FT                   LNPAPARKLPDELLTLVDMITPNETEAERLTGIHIEQDDDAAKAAQILHDKGIATVIIT
FT                   LGSRGVWLSEQGKGKLVAGFKVNAVDTIAAGDTFNGALLTALLEGQSMDVAVRFAHAAA
FT                   AIAVTRPGAQPSIPWRAEIDSFLQERV"
FT   gene            9329..9499
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0010"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of sequencing error"
FT   gene            complement(9496..10920)
FT                   /locus_tag="YpAngola_A0009"
FT   CDS_pept        complement(9496..10920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0009"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88341"
FT                   /protein_id="ABX88341.1"
FT                   /translation="MIKSARSMAGLPWIAAMAFFMQALDATILNTALPSIAESLNRSPL
FT                   TMQSAIISYTLTVAMLIPVSGWLADRFGTRRIFILAVSLFTFGSLLCALSGSLAFLVAS
FT                   RVIQGIGGAMMMPVARLALIRAYPRSELLPVLNFVTIPGLVGPVMGPLLGGLLVTYTTW
FT                   HWIFILNIPIGLLGIFYARKYMPNFTMPKRTFDFVGFLLFGISLVMISTSLEIMGRPEI
FT                   ADYLPAATLLGGLLMLIFYIFHAKGHPNPLIGLPLFKTRTFSVGIAGNVASRLGTGCVP
FT                   FLMPLMLQVGFGYSALIAGCMMAPTAIGSIMAKSAVTQVLRSLGYRKVLVGITLIIGVL
FT                   IASFALQSPGMSAWMMILPLFILGIAMSTQFTAMNTITLADLTDNNASSGNSVLAVTQQ
FT                   LSISFGIAISATVLRFYDGLSLGGNVDHFHYTFITMGIVTLLSSLVFLLLKPRDGDNLI
FT                   QGRNVKKVAPQVKNNV"
FT   gene            complement(11000..11689)
FT                   /locus_tag="YpAngola_A0011"
FT   CDS_pept        complement(11000..11689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0011"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85312"
FT                   /protein_id="ABX85312.1"
FT                   /translation="MQLNTQQQAAQRNLSYLLAEKIGQRILAGEYEAGSILPGEIELGE
FT                   QFGVSRTAVREAVKMLAAKGMLLPRPRIGTRVMPQTNWNYLDQELLTWWMTKENFDQVM
FT                   QHFLILRTSLEPQACYLAATHANEKQRELLASLVAEMRALHSNFNREQWIQVDTQFHKL
FT                   IYEASGNPFLISFANLFSSVYYSYFRAITGDEVIKLQHHQNIVDTILAGDNQGALFACQ
FT                   VLLKTVD"
FT   gene            complement(12058..12204)
FT                   /locus_tag="YpAngola_A0012"
FT   CDS_pept        complement(12058..12204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86692"
FT                   /protein_id="ABX86692.1"
FT                   /translation="MLKDYFLQIGILTGVKMFTALVTLQDLILFLPAETGVDIVLRVPT
FT                   QIV"
FT   gene            12273..13750
FT                   /gene="rrs"
FT                   /locus_tag="YpAngola_A0013"
FT   rRNA            12273..13750
FT                   /gene="rrs"
FT                   /locus_tag="YpAngola_A0013"
FT                   /product="16S ribosomal RNA"
FT   gene            13927..14004
FT                   /locus_tag="YpAngola_A0014"
FT   tRNA            13927..14004
FT                   /locus_tag="YpAngola_A0014"
FT                   /product="tRNA-Glu"
FT   gene            14256..17162
FT                   /gene="rrl"
FT                   /locus_tag="YpAngola_A4245"
FT   rRNA            14256..17162
FT                   /gene="rrl"
FT                   /locus_tag="YpAngola_A4245"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(14479..14640)
FT                   /locus_tag="YpAngola_A0015"
FT   CDS_pept        complement(14479..14640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87332"
FT                   /protein_id="ABX87332.1"
FT                   /translation="MSRPTHRVHSLCILVYGTITLYRATFQTLPLTHKLIQTLGSSPFA
FT                   RRYWGNLG"
FT   gene            17272..17387
FT                   /gene="rrf"
FT                   /locus_tag="YpAngola_A0016"
FT   rRNA            17272..17387
FT                   /gene="rrf"
FT                   /locus_tag="YpAngola_A0016"
FT                   /product="5S ribosomal RNA"
FT   gene            17956..19164
FT                   /locus_tag="YpAngola_A0017"
FT   CDS_pept        17956..19164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0017"
FT                   /product="IS285, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86785"
FT                   /protein_id="ABX86785.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            complement(19222..19779)
FT                   /gene="mobB"
FT                   /locus_tag="YpAngola_A0018"
FT   CDS_pept        complement(19222..19779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="YpAngola_A0018"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="identified by match to protein family HMM PF03205;
FT                   match to protein family HMM TIGR00176"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87307"
FT                   /protein_id="ABX87307.1"
FT                   /translation="MGTKEKRPMMNYKSPPLLGIAAYSGTGKTTLLKSLIPLLQQRQVR
FT                   VGLIKHTHHNMEIDTPGKDSYELRKAGALQTLVASDCRWALMTETPEQQPLNLHYLASR
FT                   LDASTIDLILVEGFKHEPINKIALYRESIGKPFSGLIDKHVIALASDKPIETTVKQLDI
FT                   NQPEQITEFICTWLENISFEVR"
FT   gene            complement(19752..20339)
FT                   /gene="mobA"
FT                   /locus_tag="YpAngola_A0019"
FT   CDS_pept        complement(19752..20339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="YpAngola_A0019"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="identified by match to protein family HMM TIGR02665"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86890"
FT                   /db_xref="GOA:A9QYH5"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYH5"
FT                   /protein_id="ABX86890.1"
FT                   /translation="MQPNITGVILAGGRSSRMGGNDKGLIPLNGKPLFQYVIDRFKPQV
FT                   SDLVINANRNQGLYKESGIPVIDDIITGFVGPLAGMHAGLSYASTEWVVFAPCDVPALP
FT                   SDLVSQLWQGKKQALAAYANDDERAHPTFALMHISLKTQLADYLIRGDRKLMLFLDSIN
FT                   AQRVKFSGKADLFSNLNTPADCDLWEQKRRGQ"
FT   gene            20493..20762
FT                   /locus_tag="YpAngola_A0020"
FT   CDS_pept        20493..20762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06288"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88377"
FT                   /protein_id="ABX88377.1"
FT                   /translation="MKCHRVNELIELLHPAWQQEPDLNLVQFLQKLAAEAGFKGDFSDL
FT                   TDDVLIYHLKMRGAASTEVIPGLKKDYEEDFKTALLRARGIIKD"
FT   gene            20853..21839
FT                   /locus_tag="YpAngola_A0021"
FT   CDS_pept        20853..21839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0021"
FT                   /product="putative RdoA protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87932"
FT                   /protein_id="ABX87932.1"
FT                   /translation="MNNSAFNFQTLSPDLIMDALEGAGLRVDSGLTALNSYENRVYQFM
FT                   DEESKRYVVKFYRPERWSSEQITEEHQFSLDLAESEIPVIAPLRLNGKTLHTHCGFFFA
FT                   VFPSVGGRQYEIDNLDQLEWVGRFLGRIHQAARNSLFVARPTMGIEEYLTEPRQLLANC
FT                   DLVPVKQRDKFLAAADLLITTIKQYWHTEWQPLRLHGDCHPGNILWRDGPMFVDLDDAR
FT                   NGPAIQDLWMLLHGDRRDQSMQLDILLEAYSEFADFDQRELALIEPLRAMRMVYYLAWV
FT                   ARRWQDPAFPKSFPWMAESDFWLQQTASFTEQVKLLQEPPLQLMPMY"
FT   gene            21867..22490
FT                   /gene="dsbA"
FT                   /locus_tag="YpAngola_A0022"
FT   CDS_pept        21867..22490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="YpAngola_A0022"
FT                   /product="thiol:disulfide interchange protein DsbA"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85611"
FT                   /protein_id="ABX85611.1"
FT                   /translation="MKNVWLALVGIVMAFSVTAAQFTDGKQYLTLDKPVTGEPQVLEFF
FT                   SFYCPHCYQFEEVYQVPKAVKKALPEGTKMTRYHVEFLGPLGKQLTQAWAVAMALGVEE
FT                   KITPLMFEGVQKTQTVQTPGDIRNVFIKAGISGEDYDAALNSFVVKSLVAQQQKAAEDL
FT                   QLRGVPAMFVNGKYMIKNDGMDTSSMDNYVKQYADVVTFLLTQK"
FT   gene            22982..25780
FT                   /gene="polA"
FT                   /locus_tag="YpAngola_A0023"
FT   CDS_pept        22982..25780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="YpAngola_A0023"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00476;
FT                   match to protein family HMM PF01367; match to protein
FT                   family HMM PF01612; match to protein family HMM PF02739;
FT                   match to protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85098"
FT                   /protein_id="ABX85098.1"
FT                   /translation="MAQIAENPLILVDGSSYLYRAYHAFPPLTNGSGEPTGAMYGVLNM
FT                   LRSLLLQYRPSHVAVVFDAKGKTFRDELFAEYKSHRPPMPDDLRVQIEPLHQMVKAMGL
FT                   PLLVVSGVEADDVIGTLAREAEKAGHSVLISTGDKDMAQLVTPNITLINTMNNTILGPQ
FT                   DVCDKYGVPPELIIDFLALMGDSSDNIPGVPGVGEKTAQALLQGLGGLDTLFSNLDKIS
FT                   TLTFRGAKTMSAKLEQNKDVAYLSYKLATIKTDVELDVTCDELTVSPPDDKQLHQLFSR
FT                   YEFKRWLADVEAGKWLDSKKDRPTGQTSSQSFVAADTAPTAEVTAVLSQENYQTILDEK
FT                   ALADWIERLKAAEVFAFDTETDGLDTLSCNLIGMSFAVAPGEAAYLPLAHDYLDAPPQL
FT                   DRDWVLATLKPLLEDDKALKVGQNLKFDKSMLARYGIDLKGIAFDTMLESYVLDSVAGR
FT                   HDMDSLAERYLNHKTITFEEIAGKGKNQLTFNQIALEQAGPYAAEDADVTLQLHLVLWP
FT                   KLQQSEGLKRVFQEIEMPLLPILSRIERTGVLIDQNILAAHSKELTIRLDELEKQAHEL
FT                   AEEPFNLASPKQLQAILYEKQKLPILKKTPGGAASTNEEVLAELALDYPLPKVILEYRG
FT                   LAKLKSTYTDKLPLMINPVSGRVHTSYHQAVTATGRLSSRDPNLQNIPVRNEEGRRIRQ
FT                   AFIAPKGYCIMAADYSQIELRIMAHLSQDNGLLAAFAAGQDIHRATAAEVFGSPLEKVT
FT                   TEQRRSAKAINFGLIYGMSAFGLARQLGIPRGEAQRYMDLYFERYPGVLEYMERTRKQA
FT                   AEQGYVTTLDGRRLYLPDIHSRNANRRKAAEREAINAPMQGTAADIIKRAMIAVDGWLQ
FT                   QEPEPLVRVIMQVHDELVFEVHESVLQSAEQKIRELMEQSMQLAVPLKVDVGVGANWDQ
FT                   AH"
FT   gene            25929..26046
FT                   /gene="spf"
FT                   /locus_tag="YpAngola_A4213"
FT   misc_RNA        25929..26046
FT                   /gene="spf"
FT                   /locus_tag="YpAngola_A4213"
FT                   /product="Spot 42 RNA"
FT   gene            complement(26188..26838)
FT                   /locus_tag="YpAngola_A0024"
FT   CDS_pept        complement(26188..26838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0024"
FT                   /product="putative GTP-binding protein EngB"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87273"
FT                   /db_xref="GOA:A9QYI0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYI0"
FT                   /protein_id="ABX87273.1"
FT                   /translation="MTIRNYNYHMTHFVISAPDIRHLPRDEGIEVAFAGRSNAGKSSAL
FT                   NTLTNQKGLARTSKTPGRTQLINLFEVVDGVRLVDLPGYGYAEVPEEMKLKWQRALGEY
FT                   LQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVLLLLTKADKLASGACKAQLNL
FT                   VREAIIPFMGDIQVEAFSSLKKIGVDKLREKLDTWFSEIPPEVMAEEFDGEGE"
FT   gene            27184..27438
FT                   /locus_tag="YpAngola_A4214"
FT   misc_RNA        27184..27438
FT                   /locus_tag="YpAngola_A4214"
FT                   /product="CsrC RNA family"
FT   gene            27583..28149
FT                   /locus_tag="YpAngola_A0025"
FT   CDS_pept        27583..28149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04220"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86861"
FT                   /db_xref="GOA:A9QYI1"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYI1"
FT                   /protein_id="ABX86861.1"
FT                   /translation="MKQPNKAPRANIAAPKGTATPKRRRKTRDELDAEARDRKRQKKHS
FT                   GNRSGARTNVEGSNKKGHSQTQEKDPRVGSKVPVPLVIESQVKAKSMPKPVEKNVVKPR
FT                   LTPEEELAKLENDERLDALLDRLDNDEVLNKEDQAYVDLTLDRIDALMEQLGIELGDDE
FT                   DDVEREEKQEDILQLLKRGNPKDTF"
FT   gene            28332..29705
FT                   /gene="hemN"
FT                   /locus_tag="YpAngola_A0026"
FT   CDS_pept        28332..29705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="YpAngola_A0026"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969; match to protein
FT                   family HMM TIGR00538"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88417"
FT                   /protein_id="ABX88417.1"
FT                   /translation="MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQAV
FT                   KRYPQRPLSLYVHIPFCHKLCYFCGCNKLVTRQQHKADEYLVVLEKEIRQRAALFTGRQ
FT                   VSQMHWGGGTPTYLNKTQISHLMTVLREHFDFLPDAEQSIEVDPREIELDVLDHLRAEG
FT                   FNRLSMGVQDFNKEVQRLVNREQDEDFIFALIARAKALGFNSTNIDLIYGLPKQTPESF
FT                   AFTLKRVAELNPDRLSVFNYAHLPSLFAAQRKIKDADLPTAEQRLDILQHTIRFLTESG
FT                   YQFIGMDHFARPDDELAIAQQEGTLHRNFQGYTTQGESDLLGLGVSAISMLGDSYAQNE
FT                   KDLETYYACVEQRGNALWRGLTMTEDDCLRRDVIKTLICHFQLSYQPIEQRYGIRFADY
FT                   FAEDFELLAPFEQDGLVERNETGLRVTPRGRLLIRNICMCFDIYLRKQARKQQFSRVI"
FT   gene            complement(29759..31171)
FT                   /gene="ntrC"
FT                   /locus_tag="YpAngola_A0027"
FT   CDS_pept        complement(29759..31171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="YpAngola_A0027"
FT                   /product="nitrogen regulation protein NR(I)"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01818"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87940"
FT                   /protein_id="ABX87940.1"
FT                   /translation="MQRGIVWIVDDDSSIRWVLERALTGAGLNCVAFDSGNQVLDALAT
FT                   RTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPK
FT                   PFDIDEAVALVERAISHYQEQQQPARSQPVSGPTADIIGEAPAMQDVFRIIGRLSRSSI
FT                   SVLINGESGTGKELVAHALHRHSPRAKALFIALNMAAIPKDLIESELFGHEKGAFTGAN
FT                   QVRQGRFEQADTGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAAT
FT                   HQNLELRVQEGKFREDLFHRLNVIRVHLPPLRERSEDIPRLARYFLHVAAKELGVESKN
FT                   LHPETEAALTRLPWPGNVRQLENTCRWLTVMAAGQEVLVQDLPSELFETHMPDASGQRA
FT                   PDSWSTLLAQWADRALRSGHQDLLSEAQPEMERTLLTTALRHTQGHKQEAARLLGWGRN
FT                   TLTRKLKELGME"
FT   gene            complement(31179..32228)
FT                   /gene="ntrB"
FT                   /locus_tag="YpAngola_A0028"
FT   CDS_pept        complement(31179..32228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrB"
FT                   /locus_tag="YpAngola_A0028"
FT                   /product="nitrogen regulation protein NR(II)"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85216"
FT                   /protein_id="ABX85216.1"
FT                   /translation="MATGTLPDAGQILNTLINSILLLDDDLAIHYANPAAQQLLAQSSR
FT                   KLFGTPLPDLLGYFSLNIVLMRESLQAGQGFTDNEVTLVVDGRAHILSLTAQSLAEGFI
FT                   LLELAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLAKALPDPA
FT                   LLEYTQVIIEQADRLRNLVDRLLGPQRPGQHITQSIHQVAERVCQLVSLEKPDNVTLIR
FT                   DYDPSLPELAHDPDQIEQVLLNITRNALQALGETGGTITLRTRTAFQVTLHGMRYRLAA
FT                   RIDIEDDGPGVPTQLQDTVFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFNSWPGHTE
FT                   FSVYLPIRQ"
FT   gene            complement(32466..32975)
FT                   /locus_tag="YpAngola_A0029"
FT   CDS_pept        complement(32466..32975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0029"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88621"
FT                   /protein_id="ABX88621.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(33192..34601)
FT                   /gene="glnA"
FT                   /locus_tag="YpAngola_A0030"
FT   CDS_pept        complement(33192..34601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="YpAngola_A0030"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="identified by match to protein family HMM PF00120;
FT                   match to protein family HMM PF03951; match to protein
FT                   family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85423"
FT                   /protein_id="ABX85423.1"
FT                   /translation="MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHITIPAHQVNADFFE
FT                   EGKMFDGSSIGGWKGINESDMVLMPDASTAVMDPFFADSTLIIRCDILEPGTMQGYDRD
FT                   PRSISKRAEDFLKSSGIADTVLFGPEPEFFLFDDIRFGSSINGSHVSIDDVEGAWNSST
FT                   KYEGGNKGHRPAVKGGYFPVPPVDSAQDLRSAMCLTMEEMGLVVEAHHHEVATAGQNEV
FT                   ATRFNTMTKKADEIQIYKYVVHNVAHAFGKTATFMPKPMFGDNGSGMHCHMSLSKNGNN
FT                   LFAGDKYGGLSEIALFYIGGIIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVASPKARRIEARFPDPAANPYLCFAALLMAGLDGIINKIHPGDAMDKNLYD
FT                   LPPEEEAEIPKVAGSLDEAMAALNEDREFLTRGGVFTDDAIDAYIELRREEMDRVRMTP
FT                   HPVEFELYYSV"
FT   gene            34959..35102
FT                   /locus_tag="YpAngola_A0031"
FT   CDS_pept        34959..35102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0031"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84920"
FT                   /protein_id="ABX84920.1"
FT                   /translation="MHYFGASFAPLGTILVQGWAERLFLHRERDHKHTAVRLFIREFCD
FT                   LV"
FT   gene            35162..36985
FT                   /gene="typA"
FT                   /locus_tag="YpAngola_A0032"
FT   CDS_pept        35162..36985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="YpAngola_A0032"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86908"
FT                   /protein_id="ABX86908.1"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTFGERTEATERVMDS
FT                   NDLEKERGITILAKNTAINWKDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAMDG
FT                   PMPQTRFVTKKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDFPII
FT                   YASALMGIAGEDHNDMAEDMTPLYQAIIDHVPAPDVDSSGPLQMQISQLDYNNYVGVIG
FT                   IGRIKRGIVKPNQQVTVIDSEGKTRNGKVGKVLGHMGLERIETTQAEAGDIVAITGLGE
FT                   LNISDTICDVNAVEALPPLSVDEPTVTMYFCVNTSPFCGKEGKYVTSRQILDRLNKELI
FT                   HNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVINRIIDGRNQEP
FT                   FESVTLDIEEQHQGAVMQAMGERKGDVKDMIPDGKGRIRLDYMIPSRGLIGFRTEFMTM
FT                   TSGTGLLYSTFSHYDDVRPGDIGQRQNGVLISNGQGKAVAFALYKLQDRGKLFIGHGTE
FT                   VYEGQIIGIHSRSNDLTVNCLTGKQLTNMRASGTDEATTLVPFLKKTLEQALEFIDDDE
FT                   LVEVTPQSIRIRKRHLTENDRKRAGRGPREG"
FT   gene            37307..37897
FT                   /locus_tag="YpAngola_A0033"
FT   CDS_pept        37307..37897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0033"
FT                   /product="HAD hydrolase, IA family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86348"
FT                   /protein_id="ABX86348.1"
FT                   /translation="MLYIFDLGNVIVDIDFKRVLGVWSKLSSVPLATLNERFTMGEVFQ
FT                   QHERGEISDEDFAHQLSDEMGISLSFEQFAEGWQAIFVALRPEVIDIMNKLRREGNRVV
FT                   VLSNTNRLHCYYWPEHYPEVAAAADHMYLSQDLGMRKPEARIYQHVLNAENVPAEQAVF
FT                   FDDVEANVLAAKAVGINAIHVTDRQIIPTYFSL"
FT   gene            37994..38878
FT                   /gene="rbn"
FT                   /locus_tag="YpAngola_A0034"
FT   CDS_pept        37994..38878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="YpAngola_A0034"
FT                   /product="tRNA-processing ribonuclease BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85870"
FT                   /db_xref="GOA:A9R654"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R654"
FT                   /protein_id="ABX85870.1"
FT                   /translation="MASFRRFRLLSPLKPCVTFGRMLYTRIDKDGLTMLAGHLAYVSLL
FT                   SLVPLITVIFALFAAFPMFAEISIKLKAFIFANFMPATGDIIQNYLEQFVANSNRMTVV
FT                   GTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFSFAVYWMVLTLGPILVGASMVISSY
FT                   LLSLHWLAHARVDSMIDEILRVFPLLISWVSFWLLYSVVPTVRVPARDALIGALVAALL
FT                   FELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWVYWSWCIVLLGAEITVTLGEYRAER
FT                   HHAKSVTTQSPEM"
FT   gene            38885..39322
FT                   /gene="dtd"
FT                   /locus_tag="YpAngola_A0035"
FT   CDS_pept        38885..39322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="YpAngola_A0035"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF02580;
FT                   match to protein family HMM TIGR00256"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87646"
FT                   /db_xref="GOA:A9R655"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R655"
FT                   /protein_id="ABX87646.1"
FT                   /translation="MIALIQRALSASVVVEGNIVGEIGPGLLVLLGVEQGDTEQKAQRL
FT                   CERVLGYRIFSDENDKMNLNVQQAGGSVLVVSQFTLVADTQKGMRPSFSRGAIPQEADR
FT                   LYQYFVAQCRERGVKTETGLFAADMKVSLVNDGPVTFWLQV"
FT   gene            complement(39396..40871)
FT                   /locus_tag="YpAngola_A0036"
FT   CDS_pept        complement(39396..40871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0036"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF00665;
FT                   match to protein family HMM PF01695; match to protein
FT                   family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87212"
FT                   /protein_id="ABX87212.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDFTFATGAPQKQLQSLRSLSFIERNENIVLL
FT                   GPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVMAPRL
FT                   LIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTSAMLD
FT                   RILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            41141..42064
FT                   /locus_tag="YpAngola_A0037"
FT   CDS_pept        41141..42064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0037"
FT                   /product="acetyltransferase, GNAT family /thioesterase
FT                   domain"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR02447"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88455"
FT                   /protein_id="ABX88455.1"
FT                   /translation="MYHLRVPITEQELKDYYQFRWEMLRKPLHQPIGSEKDAYDAMAHH
FT                   QMVVDEQGKAVAIGRLYINADNEAAIRFLAVAPSVRNKGLGTLVAMTLESVARQEGVKR
FT                   VVCSAREDAVDFFAKLGFVCQGEITAPQTTPVRHFLMIKPVATMDDILHRPDWCGQLQQ
FT                   AWYDHIPLSEKMGVRISQYTGQRFVTTMPEAGNQNPHHTLFAGSLFSLATLTGWGLIWL
FT                   LLRERHLGGTIILADAHIRYSAPVTGRPRAVAELSSLSGDLDRLARGRRARVQLNVNLF
FT                   GDENQGAVFEGTYMVLPVAAGDDMAN"
FT   gene            complement(42199..43908)
FT                   /locus_tag="YpAngola_A0038"
FT   CDS_pept        complement(42199..43908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0038"
FT                   /product="asmA family protein"
FT                   /note="identified by match to protein family HMM PF05170"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88536"
FT                   /protein_id="ABX88536.1"
FT                   /translation="MKFLGKTLLTLLLLFALSIVLCYAVLQTSWAAGWLSRWVSNNSGY
FT                   HLSLRGIDHRWSQPGQISFSDVTLARADQPPFLTAQQVIFGLSWRQLTDPKHFLSLQLQ
FT                   NGSLTLNNSTPSLPLQADTLQLTDMTLNTTVESKNATSQWKIAGQHVNGGLVPWQPIPG
FT                   NSFGENTQFHFSAGFLTINDISAQQIYLQGSIQKDILTLTNFGANIAQGELTGNARQSA
FT                   DGSWLVDRLRLSNIRLQTTASLEDVWNNVLQLPPITLKRFDLIDARVEGKGWAVNDVDL
FT                   TLKNITFKQGDWQSDDGELVFNASDIIKGNIHLIDPIATFTLSPEGVAINQFTTRWQDG
FT                   LLRTLGSWSRATHRLQLGELTVVALVYTLPNDWKQLWQQTLPDWLSEVYVGKLSANRNL
FT                   LIDISPDFPFQITSLDAAGSNLLLAKNHQWGVWSGSLVLNAGNATFNKNDIRRPSLALN
FT                   ANEQQITFSDLSAFTKEGLLEATASIDQTPDRALSLALTGRSVDLNFLHNWGWPALPLQ
FT                   GLGNLKLQIKGNLTADAPLKPTLNGSLQAIDSNGQQINQTVLHGVVQGTAEQ"
FT   gene            complement(44056..45441)
FT                   /gene="yicE"
FT                   /locus_tag="YpAngola_A0039"
FT   CDS_pept        complement(44056..45441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicE"
FT                   /locus_tag="YpAngola_A0039"
FT                   /product="xanthine permease"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM TIGR00801"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85459"
FT                   /protein_id="ABX85459.1"
FT                   /translation="MSTQSAELDTAPPSPAHPSELIYHLEDRPPLPQTLFAACQHLLAM
FT                   FVAVITPGLLICQALGLPAEDTQRIISMSLFASGLASLLQIKTWGPVGSGLLSIQGTSF
FT                   NFVSPLIMGGLALKNGGADIPTMMAALFGTLMVASCTEILLSHVLHLARRIITPLVSGI
FT                   VVMIIGLSLIQVGLTSIGGGYGAMSDNTFGAPKNLLLAGAVLGVIILLNRQRNPYLRVA
FT                   SLVIAMAVGYLLAWALGMLPESRPVVDTALITIPTPLYYGLSFDWNLLIPLMLIFMVTS
FT                   LETIGDITATSDVSEQPVRGPLYMKLLKGGVLANGLNSMLSAIFNTFPNSCFGQNNGVI
FT                   QLTGVASRYVGFVVAIMLIILGLFPAVAGFVQHIPEPVLGGATLVMFGTIAASGVRIVS
FT                   RETLNRRAIMIMALSLAVGMGVAQQPLILQFAPDWIKTLFSSGIAAGGITAIVLNLLFP
FT                   QEK"
FT   gene            45679..46893
FT                   /gene="gltS"
FT                   /locus_tag="YpAngola_A0040"
FT   CDS_pept        45679..46893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /locus_tag="YpAngola_A0040"
FT                   /product="sodium/glutamate symporter"
FT                   /note="identified by match to protein family HMM PF03616;
FT                   match to protein family HMM TIGR00210"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85060"
FT                   /protein_id="ABX85060.1"
FT                   /translation="MFHLDTYGTLVAACLVLLLGRKLVQTVPFLKKYTIPEPVAGGLLV
FT                   AFMMLLVQKTLGWEVSFDMSLKDPLMLAFFATIGLNANLASLRAGGKALSIFVFIVVGL
FT                   LLVQNTIGIVLAKLMGLDPLMGLLAGSITLSGGHGTGAAWSKLFSERYGFENATEVAMA
FT                   CATFGLVLGGLIGGPVARYLVKHSSTPEGTPDDSAVPSAFEKPSAGRMITSLVLIETIA
FT                   MISICLMAGNLIAGWLQGTMFELPIFVCVLFVGVILSNTLSASGFYRVFDRAVSVLGNV
FT                   SLSLFLAMALMSLKLWELASLALPMLVILSVQALAMALYAIFVTYRIMGKNYDAAVLAA
FT                   GHCGFGLGATPTAIANMQAITDRFGPSHLAFLVVPMVGAFFIDIVNAIVIKLYLLLPIF
FT                   PAVTG"
FT   gene            complement(47259..49340)
FT                   /gene="recG"
FT                   /locus_tag="YpAngola_A0041"
FT   CDS_pept        complement(47259..49340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="YpAngola_A0041"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF01336; match to protein family HMM TIGR00643"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86311"
FT                   /protein_id="ABX86311.1"
FT                   /translation="MKGRLLDAVPLSTLSGVGASQAGKLAKIGLETIQDLLLHLPLRYE
FT                   DRTRLYRIGDLLPGLSVTVEGEVLRSDISFGRRRMMTCQISDGSGVLTLRFFNFNAAMK
FT                   NSLSVGKHVIAYGEAKRGNNGPEIIHPEYRVHGENIGVELQESLTPVYPTTEGIRQATL
FT                   RKLIDQALAMLDTCVIAELLPIELSRSLISLPEAIHTLHRPPADIQLADLEQGKHPAQR
FT                   RLIMEELLAHNLSMLAVRAGAQSYRALPLMAEEQLKQRFLAALPFTPTQAQQRVVAEIE
FT                   RDMTQSFPMMRLIQGDVGSGKTLVAALAALRAIAHGKQVALMAPTELLAEQHATTFRQW
FT                   LEPLGFSVGWLAGKQKGKARLAQQEAVASGQVSMVIGTHAMFQEQVQFSGLALVIIDEQ
FT                   HRFGVHQRLTLWEKGEEQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPV
FT                   TTVAIPDTRRSDVIQRVKNACLEEGRQAYWVCTLIEESELLEAQAAEVTCEELKIALPE
FT                   IKVGLVHGRMKGPEKQAIMLAFKQGELQLLVATTVIEVGVDVPNASLMIIDNPERLGLA
FT                   QLHQLRGRVGRGAVASHCVLLYKTPLSKTAQMRLQVLRDSNDGFVIAQRDLEIRGPGEL
FT                   LGTRQTGSAEFKVADLLRDQAMIPEVQRVARHLHQQYPEHAKALIERWLPERVRYTNA"
FT   gene            complement(49341..50033)
FT                   /gene="trmH"
FT                   /locus_tag="YpAngola_A0042"
FT   CDS_pept        complement(49341..50033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmH"
FT                   /locus_tag="YpAngola_A0042"
FT                   /product="tRNA guanosine-2'-O-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86331"
FT                   /protein_id="ABX86331.1"
FT                   /translation="MNPQRYARICDMLATRQPDLTVCLEQVHKPHNVSAIIRTADAVGI
FT                   HQVHAIWPTTQMYTRLSAAAGSNSWVQVKTHPHIADAIAYLKSQDMQILATHLSDKAVD
FT                   FREIDYTRPTCILMGQEKTGISPEALALADQDIIIPMIGMVQSLNVSVASALILYEAQR
FT                   QRQNAGMYKRTHSVLAESEQQRLLFEGGYPVLAHVAKRKGLPQPHIDEQGQIIADAQWW
FT                   SAMQATES"
FT   gene            complement(50039..52147)
FT                   /gene="spoT"
FT                   /locus_tag="YpAngola_A0043"
FT   CDS_pept        complement(50039..52147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="YpAngola_A0043"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase"
FT                   /EC_number="3.1.7.2"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM PF02824; match to protein
FT                   family HMM PF04607; match to protein family HMM TIGR00691"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85923"
FT                   /protein_id="ABX85923.1"
FT                   /translation="MYLFESLNLLIQRYLPEEQIKRLKQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLD
FT                   KLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILAEIEG
FT                   RLTEAGIPCRVSGREKHLYSIYCKMHLKEQRFHSIMDIYAFRVIVKEVDTCYRVLGQAH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEQGESGTTAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFTPEGRIVE
FT                   LPAGATPVDFAYVVHTDIGHACVGARVDRQPYPLSQPLSSGQTVEIITAPGARPNAAWL
FT                   NFVVSSKARAKIRQLLKNLKRDESVSLGRRLLNHALGNGRKLSDISEENIKHELDRMKL
FT                   ATVDDLLAEIGLGNAMSVVVAKNLLGDPSTLGTSASGTRKLPIKGADGVLITFAKCCRP
FT                   IPGDPIIAHISPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDQETEQEFIAEIKVDMFN
FT                   QQGALANLTAAINAAESNIQSLNTEEKDGRVYSAFIRLTTRNRVHLANIMRKIRIMPDV
FT                   VKVSRNRN"
FT   gene            complement(52167..52442)
FT                   /gene="rpoZ"
FT                   /locus_tag="YpAngola_A0044"
FT   CDS_pept        complement(52167..52442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="YpAngola_A0044"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01192;
FT                   match to protein family HMM TIGR00690"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88463"
FT                   /db_xref="GOA:A9R664"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R664"
FT                   /protein_id="ABX88463.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQIQSGGKDALVPEENDK
FT                   VTVIALREIEEGLITNQILDVRERQEQQEQQAAEIQAVTAIAEGRR"
FT   gene            complement(52497..53120)
FT                   /gene="gmk"
FT                   /locus_tag="YpAngola_A0045"
FT   CDS_pept        complement(52497..53120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="YpAngola_A0045"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by match to protein family HMM PF00625;
FT                   match to protein family HMM TIGR03263"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87022"
FT                   /protein_id="ABX87022.1"
FT                   /translation="MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKR
FT                   PGENHGEHYFFVSEKEFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDID
FT                   WQGAQQIRAKMPTARSIFILPPSKTELDRRLRGRGQDSEEVIAKRMEQAVSEMAHYAEY
FT                   DYLIVNDDFNLALSDLKTIIRAERLRLGRQKQRHDALISKLLAD"
FT   gene            53548..55224
FT                   /gene="ligA2"
FT                   /locus_tag="YpAngola_A0046"
FT   CDS_pept        53548..55224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA2"
FT                   /locus_tag="YpAngola_A0046"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /note="identified by match to protein family HMM PF01653;
FT                   match to protein family HMM PF03120"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87376"
FT                   /db_xref="GOA:A9R666"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R666"
FT                   /protein_id="ABX87376.1"
FT                   /translation="MFLLISNTIVVGGAWATSTCPDWPATRIAVEINALEQQLNKWSAA
FT                   YHQQGHSPVTDDIYDQLQDKLRVWQSCRGLPDKTESQPIPGKGQFLHPVAHTGLKKLKD
FT                   ETALTRWMAGRKNLWVQPKVDGVAVTLVYHGGKLVQLLSRGNGVKGQNWTEKAPFISAI
FT                   PQYIANAPALLTLQGELFLLMDGHQQAKSGGVNARSTVAGALMRKSPSPLLAQVGVFIW
FT                   AWPDGPTTMKEKVALLQVMGFPFTAKYSEPVMSHLDVVQWRQFWFQAPLPFVTDGVVVR
FT                   QEEEPAGRYWQATPGQWSMAWKYPPLQHIAEVKDIHFTLGRTGKGTVVLEVLPIKIDDK
FT                   WIRRVNIGSVTRWKQWDIAPGDHITLALAGHGIPRLDNVVWRVHQRNTITAPNWDKFHQ
FT                   LSCFQRLPHGCEPQFLSRLIWLSGPGGLDIGGIGGGFWQELIHHELINDLVGWLLLTPE
FT                   QIASIPGIGNARAEKIYQQFQRAKQQPFSRWLLALGFPQVVSVDAQWQVVLRRSLSEWA
FT                   TMAGIGQMRAKQIKHFWDHPDVQALADFLSTQKVVGFELTE"
FT   gene            complement(55237..55860)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0047"
FT                   /note="putative membrane protein; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF03458"
FT   gene            complement(56263..57126)
FT                   /locus_tag="YpAngola_A0048"
FT   CDS_pept        complement(56263..57126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0048"
FT                   /product="conserved hypothetical protein TIGR00255"
FT                   /note="identified by match to protein family HMM PF03755;
FT                   match to protein family HMM PF08340; match to protein
FT                   family HMM TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87908"
FT                   /protein_id="ABX87908.1"
FT                   /translation="MIRSMTAYARRDIKGEWGNAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EPVIRERIRSRLTRGKIECHLRFELDANAQSSLILNEKLAKQLVEAGNWVKMQSDEGEI
FT                   NPVDILRWPGVMSAEEQDLDAISTELMQALDTALDDFIVSRETEGAALKTLIEQRLEGV
FT                   SAEVVKVRAHMPNILQWQRERLLNKLEEAQVQLENTRLEQELVLMAQRIDVAEELDRLE
FT                   AHVKETYNILKKKEAVGRRLDFMMQEFNRESNTLASKSINAEVTNSAIELKVLIEQMRE
FT                   QIQNIE"
FT   gene            57253..57969
FT                   /gene="rph"
FT                   /locus_tag="YpAngola_A0049"
FT   CDS_pept        57253..57969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="YpAngola_A0049"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="identified by match to protein family HMM PF01138;
FT                   match to protein family HMM PF03725; match to protein
FT                   family HMM TIGR01966"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88355"
FT                   /db_xref="GOA:A9R668"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R668"
FT                   /protein_id="ABX88355.1"
FT                   /translation="MRPADRAAQQVRPLTLTRNYTKHAEGSVLVEFGDTKVLCTATVEE
FT                   GVPRFLKGQGQGWITAEYGMLPRSTHSRNAREAAKGKQGGRTLEIQRLIARSLRAAVDL
FT                   KKLGEFTITLDCDVLQADGGTRTASISGACVALADALNKLVASGKLKANPMKGLVAAVS
FT                   VGIVKGEALCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLALLDLAR
FT                   GGIETIFQAQKAALES"
FT   gene            58094..58603
FT                   /locus_tag="YpAngola_A0050"
FT   CDS_pept        58094..58603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0050"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86871"
FT                   /protein_id="ABX86871.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            58846..59493
FT                   /gene="pyrE"
FT                   /locus_tag="YpAngola_A0051"
FT   CDS_pept        58846..59493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="YpAngola_A0051"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87243"
FT                   /db_xref="GOA:A9R670"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R670"
FT                   /protein_id="ABX87243.1"
FT                   /translation="MKAYQREFIEFALNKQVLKFGEFTLKSGRISPYFFNAGLFNTGLD
FT                   LAKLGRFYAAALMDCGVEFDLLFGPAYKGIPIATTTAVALAEHHERDVPYCFNRKEAKT
FT                   HGEGGNLVGSPLQGRVMLVDDVITAGTAIRESMEIINAQGATLAGVMISLDRQERGRGE
FT                   ISAIQEVERDYHCKVIAIVTLNDVIRYLEDKPEMAEHLVAVRQYREQYGVTL"
FT   gene            complement(59628..60224)
FT                   /locus_tag="YpAngola_A0052"
FT   CDS_pept        complement(59628..60224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0052"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86270"
FT                   /db_xref="GOA:A9R671"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R671"
FT                   /protein_id="ABX86270.1"
FT                   /translation="MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVSE
FT                   AALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAERNPG
FT                   LTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLATQLL
FT                   AFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ"
FT   gene            complement(60346..60801)
FT                   /gene="dut"
FT                   /locus_tag="YpAngola_A0053"
FT   CDS_pept        complement(60346..60801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="YpAngola_A0053"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by match to protein family HMM PF00692;
FT                   match to protein family HMM TIGR00576"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86707"
FT                   /db_xref="GOA:A9R672"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R672"
FT                   /protein_id="ABX86707.1"
FT                   /translation="MKKIDIKILDPRVGNEFPLPTYATEGSAGLDLRACLDHAVELQPG
FT                   QTTLLPTGLAIHIGDSALAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNRG
FT                   QQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTGGFGHSGRQ"
FT   gene            complement(60782..62113)
FT                   /gene="coaBC"
FT                   /locus_tag="YpAngola_A0054"
FT   CDS_pept        complement(60782..62113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="YpAngola_A0054"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="identified by match to protein family HMM PF02441;
FT                   match to protein family HMM PF04127; match to protein
FT                   family HMM TIGR00521"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85394"
FT                   /protein_id="ABX85394.1"
FT                   /translation="MRDVSQILRLVASESALIANLFNGYAKISPLTAFIRTIMMTGLSG
FT                   KHIVLGISGGIAAYKSPELVRRLRDKGADVRVVMTHAAKAFIAPLTLQAVSGYPVSDDL
FT                   LDPAAEAAMGHIELGKWADLVIIAPATADLLARMAAGMANDLLTTVCLATAAPIAAVPA
FT                   MNQQMYRAPATQENLQTLSKWGVLLWGPDSGSQACGDIGPGRMLDPQEIVALAYNHFSA
FT                   KQDLQHLSVMITAGPTREPLDPVRFISNQSSGKMGFAIAQALAARGSNVTLIAGPVNLS
FT                   TPEGVKRIDVITALEMQQAVQKIAQQQNIFISCAAVADYRAEHVSDEKIKKQGDEITLK
FT                   LVKNPDIVAGVASMAKNRPFVVGFAAETQNVEEYARQKLARKNLDLICANDVSLAEHGF
FT                   NSDTNALHLFWSTGEKRLPLSDKYLLSQRLIDEIVSRYDEKNRH"
FT   gene            62193..62861
FT                   /gene="radC"
FT                   /locus_tag="YpAngola_A0055"
FT   CDS_pept        62193..62861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="YpAngola_A0055"
FT                   /product="DNA repair protein RadC"
FT                   /note="identified by match to protein family HMM PF04002;
FT                   match to protein family HMM TIGR00608"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87851"
FT                   /db_xref="GOA:A9R674"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R674"
FT                   /protein_id="ABX87851.1"
FT                   /translation="MDEWYGQVAPREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMA
FT                   EYLIETFGSLHGLISADYQTLCAHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNP
FT                   GITQKFLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREALKVN
FT                   AAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL
FT                   "
FT   gene            63124..63360
FT                   /gene="rpmB"
FT                   /locus_tag="YpAngola_A0056"
FT   CDS_pept        63124..63360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="YpAngola_A0056"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88650"
FT                   /db_xref="GOA:A9R675"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R675"
FT                   /protein_id="ABX88650.1"
FT                   /translation="MSRVCQVTGKRPMSGNNRSHAMNATKRRFLPNLHSHRFWVEGEKR
FT                   FVTLRVSAKGMRVIDKKGIETVLAEIRARGEKY"
FT   gene            63372..63539
FT                   /gene="rpmG"
FT                   /locus_tag="YpAngola_A0057"
FT   CDS_pept        63372..63539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="YpAngola_A0057"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by match to protein family HMM PF00471;
FT                   match to protein family HMM TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86768"
FT                   /db_xref="GOA:A9R676"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R676"
FT                   /protein_id="ABX86768.1"
FT                   /translation="MAKGVREKIKLVSSAGTGHFYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVLYKEAKIK"
FT   gene            63622..64431
FT                   /gene="mutM"
FT                   /locus_tag="YpAngola_A0058"
FT   CDS_pept        63622..64431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="YpAngola_A0058"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM PF06831; match to protein family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85219"
FT                   /db_xref="GOA:A9R677"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R677"
FT                   /protein_id="ABX85219.1"
FT                   /translation="MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWPVSDEILTLS
FT                   DQPVLSVQRRAKYLLLELPKGWIIIHLGMSGSLRVLSEETAAEKHDHVDLVVSNGKILR
FT                   YTDPRRFGAWLWAKDLETSNVLAHLGPEPLSDEFTAQYLFDKSRNKRTLIKPWLMDNKV
FT                   VVGVGNIYASESLFAAGILPDRAAGSLTDAESVLLVATIKAVLLHSIEQGGTTLRDFLQ
FT                   SDGKPGYFAQELQVYGRAGEPCRQCGHPIEIAKHGQRSTFFCRHCQH"
FT   gene            complement(64437..64916)
FT                   /gene="coaD"
FT                   /locus_tag="YpAngola_A0059"
FT   CDS_pept        complement(64437..64916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="YpAngola_A0059"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88228"
FT                   /db_xref="GOA:A9R678"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R678"
FT                   /protein_id="ABX88228.1"
FT                   /translation="MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPM
FT                   FTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLAN
FT                   MNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA"
FT   gene            complement(64913..65695)
FT                   /locus_tag="YpAngola_A0060"
FT   CDS_pept        complement(64913..65695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0060"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88177"
FT                   /protein_id="ABX88177.1"
FT                   /translation="MGTKKRLSVVMITKNEASLLTDCLASVAWADEIIVLDSGSEDETR
FT                   ALAQQFGAKVYSNINWPGYGKQRQLAQQYASGDYILMLDADERVTPELKIAIESVLLAP
FT                   EEGAVYSCSRRNLFLGRFMRHSGWYPDRVTRLYPHHQYRYNDNLVHESLDSGSAKVIPL
FT                   AGDLLHLTCRDFFAFQRKQLSYAEAWAIQRHQQGKSCSYFAILSHTLGAFSKTWLLRAG
FT                   FLDGKQGLLLAVVNAQYTFNKYAALWALSHQYQKSEKS"
FT   gene            complement(65696..66973)
FT                   /gene="kdtA"
FT                   /locus_tag="YpAngola_A0061"
FT   CDS_pept        complement(65696..66973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="YpAngola_A0061"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF00534;
FT                   match to protein family HMM PF04413"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87654"
FT                   /protein_id="ABX87654.1"
FT                   /translation="MLLRLYQVLLYLIQPLIWLRLLLRSRKAPAYRKRWGERYGFCAGK
FT                   VVAGGIMLHSVSVGETLAAIPLVRALRHRYPSLPITVTTMTPTGSERVQSAFGKDVHHV
FT                   YLPYDLPGSVNRFLDQVNPKLVIIMETELWPNLINTLHRRKIPLVIANARLSARSAAGY
FT                   KKIGSFIRTILQRITLIAAQNQEDGDRFIELGLKRSQLTVTGSLKFDISVTPELAARAV
FT                   TLRRQWAPHRPVWIATSTHDGEETILLEAHRQLLQQFPTLLLILVPRHPERFGKAVELT
FT                   QKIGLSYTLRSKGEVPSSSTQVVIGDTMGELMLLYGIADLAFVGGSLVERGGHNPLEAA
FT                   AHAIPVLMGPHTFNFKDICAKLEQAEGLITVTDTLSLVKEITVLLTDEDCRLYYGRHAV
FT                   DVLHENQGALQRLLHLLEPYLPQRSH"
FT   gene            complement(67393..68358)
FT                   /gene="rfaC"
FT                   /locus_tag="YpAngola_A0062"
FT   CDS_pept        complement(67393..68358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaC"
FT                   /locus_tag="YpAngola_A0062"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF01075;
FT                   match to protein family HMM TIGR02193"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87577"
FT                   /protein_id="ABX87577.1"
FT                   /translation="MHVLIVKTSSMGDVLHTLPALTDAMNAIPGIRFDWVVEEGFSQIP
FT                   SWHPAVDKVIPVAIRRWRKNWFGSDTRQERCDFKRVVQQRSYDRVIDAQGLIKSAALIT
FT                   RIAKGTKHGPDCKSAREPFASWFYNCRHEIDTKQHAVERIRQLFAKSLGYDKPESYGDY
FT                   AIAQRFLNQLPADAGQYLVFLHATTRDNKHWPESHWVQLIELVQPTGLKIKLPWGAEHE
FT                   HQRALRLAEHFPHVEVLPKLSLQQVAEVLAGAKAVVSVDTGLSHLTAALDRPNITLFGP
FT                   TDPGLIGGYGKNQIAVISEQKKMDSLSAPTIMARLETLIS"
FT   gene            complement(68358..69422)
FT                   /gene="rfaF"
FT                   /locus_tag="YpAngola_A0063"
FT   CDS_pept        complement(68358..69422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /locus_tag="YpAngola_A0063"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="identified by match to protein family HMM PF01075;
FT                   match to protein family HMM TIGR02195"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87067"
FT                   /protein_id="ABX87067.1"
FT                   /translation="MKILVIGPSWVGDMMMSQSLYRTLKAEYPAADIDVMAPAWCRPLL
FT                   ARMPEVRHAIPMPLGHGAFAFEERRRLGLALRETEYDRAYVLPNSFKSALIPYFSGIKR
FT                   RIGWRGEMRYFLLNDLRILDKQAFPMMVQRYVALAYDKERIRSAADLPQPLLWPQLQVR
FT                   DEEIAETTASFNLTDNRPIIGFCPGAEFGPAKRWPHYHYATLAQKLIDDGYQVILFGSA
FT                   KDNEAGEDIRQALSDTDREYCLNLAGQTSLEQAVVLIAACSAVVSNDSGLMHVAAALNK
FT                   PLVALYGPSSPDFTPPLSEKATVIRLITGYHKVRKGDSAQGYHQSLIDIQPEHVMAALE
FT                   KQLATQECSVKGGD"
FT   gene            complement(69453..70385)
FT                   /gene="rfaD"
FT                   /locus_tag="YpAngola_A0064"
FT   CDS_pept        complement(69453..70385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /locus_tag="YpAngola_A0064"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /EC_number="5.1.3.20"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF04321; match to protein family HMM PF07993;
FT                   match to protein family HMM TIGR02197"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84929"
FT                   /db_xref="GOA:A9R683"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R683"
FT                   /protein_id="ABX84929.1"
FT                   /translation="MIIVTGGAGFIGSNIVKALNNIGYKDILVVDNLKDGTKFVNLVDL
FT                   DIADYMDKEDFVASIVAGDDMGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDILHFC
FT                   LDRSIPFLYASSAATYGGRTDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPQADSQIC
FT                   GFRYFNVYGPREGHKGSMASVAFHLNNQINAGERPKLFAGSENFKRDFIYVGDVADVNL
FT                   WFWQNGVSGIFNCGTGRAESFQAVADAVVDYHQSGPVEYIEFPEKLKGRYQAYTQADLT
FT                   KLRAAGYGKPFKTVAEGVKEYLAWLNRSV"
FT   gene            70601..71842
FT                   /gene="kbl"
FT                   /locus_tag="YpAngola_A0065"
FT   CDS_pept        70601..71842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="YpAngola_A0065"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00202; match to protein
FT                   family HMM PF00464; match to protein family HMM TIGR01822"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85338"
FT                   /protein_id="ABX85338.1"
FT                   /translation="MQLPILEITEMSLPCNKHPFYQQLEQQLDTTRTEGLYKNERVITS
FT                   AQQANIAVADGSRVINFCANNYLGLANHPKLIAAAKAGMDSHGFGMASVRFICGTQDIH
FT                   KELEHKLASFLGMEDAILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKA
FT                   KRYRYANNDMTELEAQLKQAKAEGARHIMIATDGVFSMDGVIANLKRVCDLADEYQALV
FT                   MVDDSHAVGVIGANGRGTHEYCEVMDRVDIITGTLGKALGGASGGYTAGRKELVEWLRQ
FT                   RSRPYLFSNSLAPAIVAASIEVLSLLEEGGALRDRLWANARLFREKMSAAGFTLAGADH
FT                   AIIPVMLGEAKLAQDFANALLKEGIYVTGFFFPVVPKGQARIRTQMSAGHTTEQVERAI
FT                   EAFVRIGKQLNVIA"
FT   gene            71852..72877
FT                   /gene="tdh"
FT                   /locus_tag="YpAngola_A0066"
FT   CDS_pept        71852..72877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="YpAngola_A0066"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240; match to protein
FT                   family HMM TIGR00692"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86038"
FT                   /db_xref="GOA:A9R685"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R685"
FT                   /protein_id="ABX86038.1"
FT                   /translation="MKALSKLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHIY
FT                   NWDEWSQKTIPVPMVVGHEYVGEVVAIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRT
FT                   HLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGIMAAAVCKHVGARHVVIADVNEYRLDLARKMGVTRAVNVSKENLND
FT                   VMTELGMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRIAMLGIPPSDMSIDWNQVIFKGL
FT                   FIKGIYGREMFETWYKMAALIQSGLDLTPIITHRFPIDEFQQGFDAMRSGKSGKVVLSW
FT                   D"
FT   gene            complement(73015..73949)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0067"
FT                   /note="this gene contains a frame shift which may be the
FT                   result of sequencing error"
FT   gene            complement(73973..75325)
FT                   /locus_tag="YpAngola_A0068"
FT   CDS_pept        complement(73973..75325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0068"
FT                   /product="peptidase, M23 family domain protein"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87501"
FT                   /protein_id="ABX87501.1"
FT                   /translation="MAKSITTKDAVSDGRESPSLLSDKLSRLPWSTLYASVFCAGVLLL
FT                   PFSGQAVEPPVAAKASENKNQLKTLQQDIAEKEKSVQQQKKQRSSLLDQLKQQENTISQ
FT                   TSRSLRETQATLAELSKDIASLTTSIEKLQNQQSQQQSILSKQLAAAFKQGKHSSLQLI
FT                   LSGEESQRSERILAYFSYLNEARQKAIEELKQTRTTLSAEKKMLEQKQNQHKALLDEQK
FT                   AQQQKLEQARIARQKTLTSLEASLEKDQQSLAELKLNESRLRDQIAKAEREAKARAERE
FT                   AKEAARVREQVKVKEQQAKKTGSSYKPSESERSLMARTGGLGRPGGQALWPVRGNVSHR
FT                   FGEPLQGELRWKGMVITAPEGSEVKAIADGRVLLADWLQGYGLVVVIEHGKGDMSLYGY
FT                   NQSALVNVGAQVKAGQPIALVGTSGGQGEPSLYFEIRRQGQAVNPQPWLGR"
FT   gene            complement(75353..76900)
FT                   /gene="gpmI"
FT                   /locus_tag="YpAngola_A0069"
FT   CDS_pept        complement(75353..76900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="YpAngola_A0069"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by match to protein family HMM PF01676;
FT                   match to protein family HMM PF06415; match to protein
FT                   family HMM TIGR01307"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87882"
FT                   /protein_id="ABX87882.1"
FT                   /translation="MSSTKKPLVLTILDGYGHREEQQDNAILNAKTPVMDVLWQQQPHT
FT                   LIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEGDFFTNPTLTAAVD
FT                   NAVKTGKAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATAIYLHAFLDGRDTPPRSAE
FT                   SSLKRFTAKFAELGNGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTADNAVAG
FT                   LQAAYARGENDEFVKPTVIQATGEADAAMNEGDTLIFMNFRADRARQITRTFVNAEFDG
FT                   FKRDKVVNFGDFIMLTEYAADIKVACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAH
FT                   VTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVSAIGSGKYDVIICN
FT                   YPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAEQMRDPATG
FT                   QAHTAHTSLPVPLIYVGNKAVKAVEGGKLSDIAPTMLSLMEMEIPQEMTGKPLFIVE"
FT   gene            77297..77731
FT                   /locus_tag="YpAngola_A0070"
FT   CDS_pept        77297..77731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0070"
FT                   /product="rhodanese domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88344"
FT                   /protein_id="ABX88344.1"
FT                   /translation="MLQEIMQFISQHPILSLAWVLLFGAVVFTSFKNSLSKVKEVTRGE
FT                   ATRLINKEDAVVVDIRTREDYRKGHIANSINLIPSDIKNGNLGELEKHKTQPIIVVCAM
FT                   GTTSRASADMLSKAGFERVFTLKEGISGWSGENLPLARGK"
FT   gene            77850..78098
FT                   /gene="grxC"
FT                   /locus_tag="YpAngola_A0071"
FT   CDS_pept        77850..78098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="YpAngola_A0071"
FT                   /product="glutaredoxin 3"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM PF05768; match to protein
FT                   family HMM TIGR02181"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85136"
FT                   /protein_id="ABX85136.1"
FT                   /translation="MAKIEMYTKATCPFCHRAKALLNAKGAAFHEIAIDNDPAKREEMI
FT                   ARSGRTTVPQIFIDGQHIGGCDDLHALDARGGLDPLL"
FT   gene            78186..78662
FT                   /gene="secB"
FT                   /locus_tag="YpAngola_A0072"
FT   CDS_pept        78186..78662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="YpAngola_A0072"
FT                   /product="protein-export chaperone SecB"
FT                   /note="identified by match to protein family HMM PF02556;
FT                   match to protein family HMM TIGR00809"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85774"
FT                   /db_xref="GOA:A9R690"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R690"
FT                   /protein_id="ABX85774.1"
FT                   /translation="MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLD
FT                   TASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPN
FT                   ILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA"
FT   gene            78662..79681
FT                   /gene="gpsA"
FT                   /locus_tag="YpAngola_A0073"
FT   CDS_pept        78662..79681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="YpAngola_A0073"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF02558; match to protein
FT                   family HMM PF07479"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86514"
FT                   /db_xref="GOA:A9R691"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R691"
FT                   /protein_id="ABX86514.1"
FT                   /translation="MNTNPASMAVIGAGSYGTALAITLARNGHQVVLWGHDPKHIQQLQ
FT                   QDRCNRAFLPDAAFPDTLRLETDLACALAASRDVLVVVPSHVFGAVLHQLKPHLRKDAR
FT                   IVWATKGLEAETGRLLQDVAREVLGEAIPLAVISGPTFAKELAAGLPTAIALASTDVQF
FT                   SEDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTALITRG
FT                   LAEMTRLGTALGADPSTFMGMAGLGDLVLTCTDNQSRNRRFGIMLGQGLGVKEAQDNIG
FT                   QVVEGYRNTKEVLALAQRHGVEMPITEQIYQVLYCHKNAREAALTLLGRTKKDEKIGI"
FT   gene            79944..80768
FT                   /gene="cysE"
FT                   /locus_tag="YpAngola_A0074"
FT   CDS_pept        79944..80768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="YpAngola_A0074"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM PF06426;
FT                   match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86837"
FT                   /protein_id="ABX86837.1"
FT                   /translation="MMSSEELEQVWSNIKSEARALAECEPMLASFFHATLLKHENLGSA
FT                   LSYILANKLANPIMPAIAIREVVEEAYRSDAHMIVSAARDILAVRLRDPAVDKYSTPLL
FT                   YLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGI
FT                   VIGETAVVENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGAKIG
FT                   AGSVVLQSVPAHTTAAGVPARIVGKPESDKPSLDMDQHFNGSIQGFEYGDGI"
FT   gene            complement(80891..81379)
FT                   /locus_tag="YpAngola_A0075"
FT   CDS_pept        complement(80891..81379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0075"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00185"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87124"
FT                   /protein_id="ABX87124.1"
FT                   /translation="MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLR
FT                   RAGLDYHEFADIKHHHDYQAFLDSEKLDSTQPARLFALTTKGTPAHSAVSYQANDYLLF
FT                   GPETRGLPAYILDALPAQQKIRIPMQADSRSMNLSNAVSVVVYEAWRQLGYPGALLKE"
FT   gene            81568..82389
FT                   /locus_tag="YpAngola_A0076"
FT   CDS_pept        81568..82389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0076"
FT                   /product="regulatory protein ada (Regulatory protein of
FT                   adaptative response)"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02805; match to protein
FT                   family HMM PF02870"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87881"
FT                   /protein_id="ABX87881.1"
FT                   /translation="MNNVKDPRWAAIINRDKTADGQFVYAVKTTGIYCRPSCPSRRAKA
FT                   ENIEFFIDNTAAEQAGYRPCKRCQPTQLSRAQQQVEKISQACRLIELAETPPKLNELAA
FT                   QLGLSTFYFHRLFKAITGLTPKGYANATRSERIRAQLSHGGSVTDAIFEAGYNSSSRFY
FT                   AQSQQLLGMTPTRYRKGGCDARLHFAVGESSLGAILVAKSELGVCAILLGDDPVRLVQQ
FT                   LQDKFPQANLVGGDAEFEQWVAQVVGCVEAPKLGLNLPLDIRGTAFQQRVL"
FT   gene            82471..83493
FT                   /locus_tag="YpAngola_A0077"
FT   CDS_pept        82471..83493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0077"
FT                   /product="transposase for insertion sequence"
FT                   /note="identified by match to protein family HMM PF00665;
FT                   match to protein family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88185"
FT                   /protein_id="ABX88185.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            83493..84272
FT                   /locus_tag="YpAngola_A0078"
FT   CDS_pept        83493..84272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0078"
FT                   /product="putative transposition helper protein"
FT                   /note="identified by match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88519"
FT                   /protein_id="ABX88519.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQHQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            84352..84591
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0079"
FT                   /note="regulatory protein ada (Regulatory protein of
FT                   adaptative response).; this gene contains a premature stop
FT                   which may be the result of sequencing error; identified by
FT                   match to protein family HMM PF01035; match to protein
FT                   family HMM TIGR00589"
FT   gene            complement(84640..86016)
FT                   /gene="cpxA"
FT                   /locus_tag="YpAngola_A0080"
FT   CDS_pept        complement(84640..86016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxA"
FT                   /locus_tag="YpAngola_A0080"
FT                   /product="sensor protein CpxA"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86665"
FT                   /protein_id="ABX86665.1"
FT                   /translation="MINSLTTRIFAIFWFTLALVLMLVLMVPKLDSRQLTVLLDSEQRQ
FT                   GTMLEQHIEAELANDPANDLMWWRRLHRAIEKWAPPGQHLILVTSEGRIIGVQRQEVQM
FT                   VRNFIGQSDNADQPKKKKYGRVEMVGPFSIRDGEDNYQLYLIRPANSPQSDFINLMFDR
FT                   PLLLLIATMLISAPLLLWLAWSLAKPARKLKNAADDVARGNLKQHPELESGPQEFLATG
FT                   ASFNQMISSLDRMVVAQQRLISDISHELRTPLTRLQLATALMRRRHGEGKELERIEMEA
FT                   QRLDSMINDLLVLSRSQHKNELHREPIKADELWSDVLENAQFEAEQMGKTLVVTAPPGP
FT                   WPLFCNPAALDSALENIVRNALRYSHHHIAVAFSIDNQGVTIIVDDDGPGVSPEDREQI
FT                   FRPFYRTDEARDRASGGTGLGLAIVETAVSQHRGWVKAEDSPLGGLRLIVWLPLHPLKS
FT                   "
FT   gene            complement(86013..86711)
FT                   /gene="cpxR2"
FT                   /locus_tag="YpAngola_A0081"
FT   CDS_pept        complement(86013..86711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR2"
FT                   /locus_tag="YpAngola_A0081"
FT                   /product="transcriptional regulatory protein CpxR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86987"
FT                   /protein_id="ABX86987.1"
FT                   /translation="MHKILLVDDDRELTSLLKELLEMEGFNVVVAYDGEQALSQLDSSI
FT                   DLLLLDIMMPRKNGIETLKELRQHHQTPVIMLTARGSELDRVLGLELGADDYLAKPFND
FT                   RELVARIRAILRRSNWSEQQQNAEQGAPTLEVDCLQLNPGRQEASFEGQPLELTGTEFT
FT                   LLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGLPWFKTLR
FT                   GRGYLMVSET"
FT   gene            86885..87373
FT                   /locus_tag="YpAngola_A0082"
FT   CDS_pept        86885..87373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07813"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87271"
FT                   /protein_id="ABX87271.1"
FT                   /translation="MRKVTTLVMASMFVLGSSAAFAADNTKVTEGYHGDGKMMMNKKGD
FT                   RGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRLDLEDREAMHKLITADKFDEAAVRAQ
FT                   AEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSSAQK"
FT   gene            87830..88006
FT                   /locus_tag="YpAngola_A0083"
FT   CDS_pept        87830..88006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87879"
FT                   /protein_id="ABX87879.1"
FT                   /translation="MPSLLASTLQISPLYECINVLTDAVTINNQETDIQQLVACKHYRV
FT                   ALMRTHAAPKSPQ"
FT   gene            88051..89010
FT                   /locus_tag="YpAngola_A0084"
FT   CDS_pept        88051..89010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0084"
FT                   /product="putative transposase"
FT                   /note="identified by match to protein family HMM PF04754;
FT                   match to protein family HMM TIGR01784"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88434"
FT                   /protein_id="ABX88434.1"
FT                   /translation="MIAQEDAHDYHRPMKTTPTPHDALFKNFMTQPATACDLLEFHLPP
FT                   ELRQLCDLSTLRLESGSFIENNLRACYSDVLYSLKTTVGDGYVYALIEHQSSPDKHMAF
FT                   RLMRYAIAAMQSHLEAGYDKLPLVIPILFYHGMVTPYPYPMSWLHAFNQPELAGQLYCG
FT                   NFPLVDVTVIPDHEIMTHRRIALLELLQKHIRQRDLSELLDQLVILIASGYTTEDQLKS
FT                   AINYIIQVGETAEPEVFIRSLAHRLPEHEESLMTIAQKLEQKGEARGIVKGRVEGRVEG
FT                   AQETALKIARTMLANGLDRATVMKMTGLSEEELTQIHH"
FT   gene            complement(89078..89200)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0085"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            complement(89316..89438)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0086"
FT                   /note="conserved domain protein; this region contains one
FT                   or more premature stops and/or frameshifts"
FT   gene            89572..90474
FT                   /gene="fieF"
FT                   /locus_tag="YpAngola_A0087"
FT   CDS_pept        89572..90474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fieF"
FT                   /locus_tag="YpAngola_A0087"
FT                   /product="cation-efflux pump FieF"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84901"
FT                   /db_xref="GOA:A9R6A2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR023783"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6A2"
FT                   /protein_id="ABX84901.1"
FT                   /translation="MDPQYARWVKAAALSATALASILLIIKIFAWWHTGSVSLLAALVD
FT                   SLVDLAASLTNLFVVRYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGFRH
FT                   LASPEPLQDPSIGIGVTLVALFSTLILVTFQRWVVRKTHSQAIRADMLHYQSDVLMNGA
FT                   ILIALALSWYGFRRADALFALGIGVYILYSALRMGYEAVQSLLDRALPDDERQQIIDIV
FT                   TSWPGVIGAHDLRTRRSGQTRFIQLHLEMEDMMPLMEAHVLAEQVEHALLYRFPGADVL
FT                   IHQDPCSVVPKERHAHWEL"
FT   gene            90692..91675
FT                   /gene="pfkA"
FT                   /locus_tag="YpAngola_A0088"
FT   CDS_pept        90692..91675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="YpAngola_A0088"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="identified by match to protein family HMM PF00365;
FT                   match to protein family HMM TIGR02482"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86207"
FT                   /db_xref="GOA:A9R6A3"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6A3"
FT                   /protein_id="ABX86207.1"
FT                   /translation="MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGL
FT                   YENRMKKLDRYSVSDMINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIGGD
FT                   GSYAGADLLTKEGGIHCVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQ
FT                   RISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAI
FT                   TEKLDDIDSLAKYIEKETGRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLQDH
FT                   DYKKGGFCVGVQNEKMVHELISVCIAPENKKSKFKEDWYDTAKKLF"
FT   gene            91896..92885
FT                   /locus_tag="YpAngola_A0089"
FT   CDS_pept        91896..92885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0089"
FT                   /product="sulfate ABC transporter, sulfate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86034"
FT                   /protein_id="ABX86034.1"
FT                   /translation="MRKWGVGLSLLVLASGAMAKDIQLLNVSYDPTREFYQEYNQAFSK
FT                   YWQQQTGDKVTVRQSHGGSGKQATSVINGIEADVVTLALAYDVDAIAERGRIDKNWIKR
FT                   LPDNSAPYTSTIVFLVRKGNPKQIHDWSDLVKPGTSVITPNPKTSGGARWNYLAAWGYA
FT                   LEHNNNDQAKAQEFVNALYKNVEVLDSGARGATNTFVERGIGDVLIAWENEALLAVNEV
FT                   GNGQFDIVTPSVSILAEPTVSVVDKVVDKRGTRDVADAYLKYLYSPEGQTIAAKNYYRP
FT                   RDPVVAAKFAKEFPQLKLFTIDEVFGGWTQAQKTHFATGGVFDEISKR"
FT   gene            complement(93135..93953)
FT                   /locus_tag="YpAngola_A0090"
FT   CDS_pept        complement(93135..93953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86344"
FT                   /protein_id="ABX86344.1"
FT                   /translation="MACLLAQYNSGDILMKYSNVIVSGLCMSMVSLATAAPTEVPSDEP
FT                   VTLRIISSMATRQFLTEVIAQFAQQSKYQVELESVGGVDATKRVEAGEAFDVVILSANA
FT                   IDKLIDSGKILPNSRIDLVKSGVAIAVKEGAQIMDVSSEETVKQAVLAANTIAYSTGPS
FT                   GVYLTEVFEHWGIAEQIKDRIVKVPPGVPVGSLVAKGEVELGFQQLSELLHLKGIIILG
FT                   PLPTDIQIMTHFSAGVPLKTNQQKAIKVLLDFLASPAATEAKIKNGMEPI"
FT   gene            complement(94029..95456)
FT                   /locus_tag="YpAngola_A0091"
FT   CDS_pept        complement(94029..95456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0091"
FT                   /product="transporter, divalent anion:Na+ symporter (DASS)
FT                   family"
FT                   /note="identified by match to protein family HMM PF00939;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM TIGR00785"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87598"
FT                   /protein_id="ABX87598.1"
FT                   /translation="MKNKIWKLCILVMIPLVIWFIPPPEGLTELSWRLSGFYLAAICGL
FT                   ILKPFSEAVVLLGVVGFAGFFLNNTSQILVGYATSTVWLVFAAFGISISFVKTGLGRRI
FT                   AFHMIRFCGSTTLRLGYVTAFLEFVISPVTPSNTARSGGIVFPIILSVVKALGSEPGDT
FT                   AKKAGSYLMSNIYFVMKVSSFMFITAMAPNLLAADFAAKILGIHLDWGVWALAMVVPGL
FT                   LLLLIVPAVGYYLDKPELKKVDNKKIADEGLAELGPITRNEKLLVGIFISALLGWALPS
FT                   LLGQLFGITLKIDATAVAIMAMALCILLGVIKWDDVLQNKGAWNTLLWFGGIIGLASAL
FT                   SKEKVFDWLANLIQNNVDFGHNPFIALTIIGFLSIIIRYFFASASSYAIAMLPVFLTVG
FT                   KVAGADPMALALVLAATNSYGGALTHYGGGSAPIIFGAGYNNVKQWWASGAVIATVCFI
FT                   VTMTVGYVWWQFLGFVK"
FT   gene            complement(95522..96235)
FT                   /gene="ligK"
FT                   /locus_tag="YpAngola_A0092"
FT   CDS_pept        complement(95522..96235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligK"
FT                   /locus_tag="YpAngola_A0092"
FT                   /product="4-carboxy-4-hydroxy-2-oxoadipate
FT                   aldolase/oxaloacetate decarboxylase"
FT                   /EC_number="4.1.1.3"
FT                   /note="identified by match to protein family HMM PF03737;
FT                   match to protein family HMM TIGR02798"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87864"
FT                   /protein_id="ABX87864.1"
FT                   /translation="MSLVNMKGVVVTNIERAELALLQRFAEYGVATVHEAQLRQGLLDE
FT                   RIKPIQQGRCIAGNAVTVLVTPGDNWMFHVAVEQCQPGDVLLVAPTSECHDGFFGDLLA
FT                   TSLLARGVVALVGDIGIRDSQTLREMNFPVWSRAVWAQGTVKASLGSVNVPVICAGQLV
FT                   NPGDIVVADDDGVVIVPREQATAIADAAQTRVDLETSKRQRLANGELGLDIYQMRAPLA
FT                   KKGLRYVNSLNALKS"
FT   gene            complement(96232..96969)
FT                   /locus_tag="YpAngola_A0093"
FT   CDS_pept        complement(96232..96969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0093"
FT                   /product="GlcNAc-PI de-N-acetylase family"
FT                   /note="identified by match to protein family HMM PF02585"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86406"
FT                   /protein_id="ABX86406.1"
FT                   /translation="MAMIPQKTALVVSAHSADFVWRAGGAIALHVEQGYQVHIVCLSYG
FT                   ERGESAKLWRKGDMTEERVKASRHTEAQAAANVLGASIEFFDMGDYPLRADKESLFRLA
FT                   DVFRRIQPHFVLTHSLADPYNYDHPLAANLAQEARIIAQAEGYRPGEAIIGAPPVYCFE
FT                   PHQPEQCGWKPDVLLDITSVWEKKYAAIQCMAGQEHLWEYYTRVALQRGVQAKRNIGIA
FT                   STKTIIHGEGYQSLFPRVTEDLS"
FT   gene            97106..98341
FT                   /locus_tag="YpAngola_A0094"
FT   CDS_pept        97106..98341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0094"
FT                   /product="substrate-binding transcriptional regulator, LysR
FT                   family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86590"
FT                   /protein_id="ABX86590.1"
FT                   /translation="MQKKNDRNSIKIMQIRAFCMTAEQGAASLAALNLFRTQSAITRSI
FT                   RDLEHTLAISLFERHAKGMLLTDLGNVILPRARSAMEELTRIPALLRRLQQRDDEGIED
FT                   LEPTWLFNERRLQIFLSLYRQQHALHVAQALDITQSAVSAALKVLEKGAGMYLFHRTPK
FT                   GMLPTPAGHEIAPCISRALNALHHIPEEITAHRGDLTGSVRVGALPLSRARLLPQAMIK
FT                   LISRHPGIKIVTNESGFTALIAELRAGDIDFIIGALRNEKMLLDIHSEILFEEELILLA
FT                   RPNHPLSDRRVKNQELKDIQWVLPRNHAPSRHLLEVAFCKMGLASPQPVVESGDPAVVR
FT                   ALLLGSDMVAAVSSHQLDFEVSEGILIPLQVNLTGTRREIGLMTRQKALNSPATDALIN
FT                   CVREVIQSSNDK"
FT   gene            complement(98573..99340)
FT                   /gene="tpiA"
FT                   /locus_tag="YpAngola_A0095"
FT   CDS_pept        complement(98573..99340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="YpAngola_A0095"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="identified by match to protein family HMM PF00121;
FT                   match to protein family HMM TIGR00419"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87610"
FT                   /db_xref="GOA:A9R6B0"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6B0"
FT                   /protein_id="ABX87610.1"
FT                   /translation="MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAI
FT                   YLNQAKHELAGSRIALGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQE
FT                   SDELIAKKFGVLKEIGLIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAV
FT                   IAYEPIWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELF
FT                   TQPDIDGALVGGASLKADAFAVIVKAAAKAKKA"
FT   gene            complement(99469..100104)
FT                   /locus_tag="YpAngola_A0096"
FT   CDS_pept        complement(99469..100104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07305"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87074"
FT                   /protein_id="ABX87074.1"
FT                   /translation="MRKEIVSMRIILLLAALLLITFMLITTINHAHADPTNDSSPPKEG
FT                   APPIAPYLLFNAPTFDLTLVKFRESYNRANPTLPINEFHAITVKEDSPPLTRAASKINE
FT                   NLYASTALEKGTGKIKTLQITYLPIKGNEEKTAKLLAINYMAALMRQFEPTLSVAQSLA
FT                   NVQKLLTEGKGSPFYAHTIGAIRYVVADNGEKGLTFAVEPIKLSLSEA"
FT   gene            100252..100686
FT                   /locus_tag="YpAngola_A0097"
FT   CDS_pept        100252..100686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05656"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88613"
FT                   /protein_id="ABX88613.1"
FT                   /translation="MTIQQWCFSFKGRIGRREFWIWMGLWLLAMLVIFTLAGKEWLPIQ
FT                   SASFALVFLLWPTAAVVVKRLHDRNKAGWWALLAVLAWMLMAGNWQMLTPIWQWGVGRF
FT                   IPTLIFVMMFIDCGAFLGTEGDNRFGPEAVPVKFFADKAK"
FT   gene            complement(101008..101754)
FT                   /gene="fpr"
FT                   /locus_tag="YpAngola_A0098"
FT   CDS_pept        complement(101008..101754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="YpAngola_A0098"
FT                   /product="ferredoxin--NADP reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="identified by match to protein family HMM PF00175;
FT                   match to protein family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87781"
FT                   /protein_id="ABX87781.1"
FT                   /translation="MAEWVSGKITHIEHWTDALFSLQVNAPVDPFTAGQFAKLALDING
FT                   ERVQRAYSYVNAPSDHNLEFYLVTVPEGKLSPRLDQLSVGGEVMITKQAAGFFVLEEIP
FT                   DCDTLWMLATGTAIGPYLSILQEGQDLERFKHLVLVHAARFAHDLSYLPLMQQLEQRYN
FT                   GKLRIQTVVSREESPGSLTGRVPALIENGALEAAVGLKIDAKDSHVMLCGNPQMVRDTQ
FT                   QLLKEQREMRKHLRRKPGHMTSEQYW"
FT   gene            complement(101909..102964)
FT                   /gene="glpX"
FT                   /locus_tag="YpAngola_A0099"
FT   CDS_pept        complement(101909..102964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="YpAngola_A0099"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="identified by match to protein family HMM PF03320;
FT                   match to protein family HMM TIGR00330"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87948"
FT                   /protein_id="ABX87948.1"
FT                   /translation="MPIFSFSIPQSTGLTMKRELAIEFSRVTEAAALAGYKWLGRGDKN
FT                   AADGAAVQAMRIMLNQVNIDGRIVIGEGEIDEAPMLFIGEHVGTGQGDAVDIAVDPIEG
FT                   TRMTAMGQANALAVLAVGDQGTFLHAPDMYMEKLVVGPAAKGAIDLNLPLEQNLCNIAT
FT                   ALNKPLADLTVITLAKPRHDGIIAAMQQLGVKVFAIPDGDVAASILTCMPESEVDVMFC
FT                   IGGAPEGVISAAVIRALDGDMQGRLLPRHQVKGDSEDNRRIGEQELLRCKSMGIEAGNV
FT                   LQLGDMARNDNVIFSATGITKGDLLEGIYRKGNMATTETLLIRGKSRTIRRIRSTHFLD
FT                   RKDPALHEFLL"
FT   gene            complement(103156..104679)
FT                   /gene="glpK"
FT                   /locus_tag="YpAngola_A0100"
FT   CDS_pept        complement(103156..104679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="YpAngola_A0100"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01311"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85490"
FT                   /protein_id="ABX85490.1"
FT                   /translation="MTTENTTQKKYIVALDQGTTSSRAVVLDHNANIVSVSQREFTQIY
FT                   PKAGWVEHDPMEIWATQSSTLIEVLAKAGINSDEIAGIGITNQRETTIVWDKVTGKPVY
FT                   NAIVWQCRRTADICEKLKKEGLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARERAER
FT                   GELLFGTVDTWLVWNMTQGRVHVTDYTNASRTMMFNIRTKEWDDRMLKALNIPRAMLPE
FT                   VRPSSEIYGKTNIGGKGGTRIPIAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNT
FT                   GEEAVQSTHGLLTTIACGPRGEVNYALEGAVFIGGASIQWLRDELKLIGDATDSEYFAT
FT                   KVKNSNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLD
FT                   AMQADSGARLKSLRVDGGAVANNFLMQFQADILGTRVERPAIRESTALGAAFLAGLATG
FT                   FWDDLDEVKSKASIEREFRPGIETTERDIRYKGWKKAVARARDWEEHDE"
FT   gene            complement(104856..105704)
FT                   /gene="glpF"
FT                   /locus_tag="YpAngola_A0101"
FT   CDS_pept        complement(104856..105704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="YpAngola_A0101"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="identified by match to protein family HMM PF00230;
FT                   match to protein family HMM TIGR00861"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85026"
FT                   /protein_id="ABX85026.1"
FT                   /translation="MSQTASSTLKGQCIAEFLGTGLLIFFGAGCVAALKLAGASFGQWE
FT                   ISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFERRKVLPYIVAQVAGAFCAAA
FT                   LVYGLYYSLFVDFEQTHQMVRGSTESLQLAGIFSTYPNPHISVVQAFLVETVITAILMC
FT                   LILALTDDGNGIPRGPLAPLLIGILIAVIGASMGPLTGFALNPARDLGPKAFSYLAGWG
FT                   DIAFTGGRDIPYFLVPIFGPIVGALLGAFGYRALIGRHLPCDVCTLEDEESTTITTERK
FT                   A"
FT   gene            106332..106571
FT                   /locus_tag="YpAngola_A0102"
FT   CDS_pept        106332..106571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06005"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85201"
FT                   /db_xref="GOA:A9R6B7"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6B7"
FT                   /protein_id="ABX85201.1"
FT                   /translation="MSFEVFEKLEVKVQQAIDTITLLQMEIEELKEKNNTLTQEVQDAA
FT                   GSREALVRENEQLKQEQHVWQDRLRALLGKMEEV"
FT   gene            complement(106779..107288)
FT                   /locus_tag="YpAngola_A0103"
FT   CDS_pept        complement(106779..107288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0103"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85313"
FT                   /protein_id="ABX85313.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            107414..107599
FT                   /locus_tag="YpAngola_A0104"
FT   CDS_pept        107414..107599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86533"
FT                   /protein_id="ABX86533.1"
FT                   /translation="MGAPMLAERGAISQMLLQDQAPYLQGQCQYFPIRAPLSRATLKIP
FT                   LWLNHPSSLIPLPVIM"
FT   gene            complement(107608..109722)
FT                   /locus_tag="YpAngola_A0105"
FT   CDS_pept        complement(107608..109722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0105"
FT                   /product="bacteriocin ABC transporter, ATP-binding/permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86112"
FT                   /protein_id="ABX86112.1"
FT                   /translation="MNDTHFNEIKNRLNFSFRRKVPQVLQTEAAECGLACLVMTCRYHG
FT                   MDIDLFNLRQRFGISSHGATLALLINISAQLKFKTRALSLDLDELRQLKTPCILHWDMS
FT                   HFVVLVAVKGTRFIIHDPAFGRRTVSLSEMSQHFTGVALELWPNSEFTRQKSRTRLSLL
FT                   SLMRNISGLPGFLTKIFCLSLMVEAINLLLPVGTQLVMDHVIIAEDHDLLALICIGLLF
FT                   FILFRTFLSMLRSWTSLVMGSLVDVQWKAGLFDHLLKLPLAYFEKRKLGDIQSRFGSLD
FT                   IIRSTLTNNVVNGIIDGLMSIGVFIMMFLYGGWLVWVVLGFTAMYMILRLATYNQYRQA
FT                   SEEQIVKNAKASSHFMETLYGISTLKALGLAATRSQFWLNLNIDTTNANIRLTKLDMFF
FT                   GGVNTLIGTIDQVVILWLGASMVIDGQMTLGMFVAFNAYRGQFSDRATNLINMVLQLRM
FT                   LALHSERIADIVFTETEKEQTPRQLLSPNQPAVFEARNIAFQYDNLSKPIFSDLNIHVE
FT                   AGESVAITGPSGIGKTTLMKVIAGLLTPSQGHILIDGLDITTVGLNNYRDCIACVLQDD
FT                   KLFAGSIADNIASFDVNKDEQRILSCANHCNIHKEIMHMPMGYETLISELGGSLSGGQK
FT                   QRLLIARALYRQPSLLFLDEATSHLDLANEAHINNAIASLKITRIFIAHRPSTIASAQR
FT                   IINLEKQNVS"
FT   gene            complement(109715..111007)
FT                   /locus_tag="YpAngola_A0106"
FT   CDS_pept        complement(109715..111007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0106"
FT                   /product="auxiliary transport protein, membrane fusion
FT                   protein (MFP) family"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87401"
FT                   /protein_id="ABX87401.1"
FT                   /translation="MSSNQIFRRDAVEYIRTKWLGKALLTSGYSTTFIAALCAIFLVLL
FT                   ITLIIYGTYTRRINVNGEVISQPHPINIFSPQQGFITKKWVEVGDIVRKGQHLYQIDVS
FT                   RTTFSGNVSLNSLEAINNQLSQIDSIINNTQKNKELTLLNLRQQLAQYQKAHKKSQELV
FT                   DNAGKGMDDMRRTMASYGTYQRQGLITKDQLTNQRSLFYQQQNAFQSLNTQLIQESLQI
FT                   AKLESEISTRASDFDNDISQYLFQKGDLKRQLAEVDASGMLLINSPSDGKIENMSVTQG
FT                   QMVNVNDSLVQLTPSDNPYYCLVLWVPNNSVPYINTGDKVNIRYDAFPFEKFGQFPGRI
FT                   ISISNVPVSQQEIASYNIAPRLPNGGLIEPYYKVIVALDDIHFRYQSKPLMLSNGLKAN
FT                   VTLFLEKRPLYQWMLSPFYDIKKSVTGPVNE"
FT   gene            111220..111459
FT                   /locus_tag="YpAngola_A0107"
FT   CDS_pept        111220..111459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87403"
FT                   /protein_id="ABX87403.1"
FT                   /translation="MKELTQTEVMEVSGAGIVSDAGKVLGSGFGALIDAGASIFGIKPN
FT                   ASATIGKIGESIGSAFDAGISGVKQFFGLSAPQQ"
FT   gene            111634..111783
FT                   /locus_tag="YpAngola_A0108"
FT   CDS_pept        111634..111783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86970"
FT                   /protein_id="ABX86970.1"
FT                   /translation="MKIAYRTIRFINLWIYAVFYSEFFGFELSHYLSTADMIFFGDYEF
FT                   ILYH"
FT   gene            112140..112673
FT                   /locus_tag="YpAngola_A0109"
FT   CDS_pept        112140..112673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88195"
FT                   /protein_id="ABX88195.1"
FT                   /translation="MIVAMTLSVSAWAISEQAKSEQATTVPNNDIVCHVAHLNARFDDK
FT                   EGLFEGASQSGTLLILRNISARACQVNAMPVISFEGAVGQQLAVFRKVPRGMRQEPVLS
FT                   PVTVAAGAEVAVQLRWVASDAFDGNNCVTPEKVVVTLLGGTLRLPFGRQMCAASGDTEF
FT                   FSQAPVGPATNEVQ"
FT   gene            complement(112790..113275)
FT                   /gene="rraA"
FT                   /locus_tag="YpAngola_A0110"
FT   CDS_pept        complement(112790..113275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rraA"
FT                   /locus_tag="YpAngola_A0110"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="identified by match to protein family HMM PF03737;
FT                   match to protein family HMM TIGR01935; match to protein
FT                   family HMM TIGR02998"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85670"
FT                   /db_xref="GOA:A9R6C5"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6C5"
FT                   /protein_id="ABX85670.1"
FT                   /translation="MKYDTSDLCDIYHEEVNVVEPLFSNFGGRTSFGGKITTVKCFEDN
FT                   GLLFDLLEENGLGRVLVVDGGGSVRRALINAELAELALKNEWEGIVVYGAVRQVDDLAE
FT                   LDIGIQAMAAIPVGAADEGVGESDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE"
FT   gene            complement(113417..114334)
FT                   /gene="menA"
FT                   /locus_tag="YpAngola_A0111"
FT   CDS_pept        complement(113417..114334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="YpAngola_A0111"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /EC_number="2.5.-.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR00751"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85783"
FT                   /protein_id="ABX85783.1"
FT                   /translation="MSLSINTSQTQAWLESLRPRTLPLAFASIVTGSALAVWLDSFKPA
FT                   VALLALLTAGLLQILSNLANDYGDAVKGSDTEERIGPLRGMQKGIISHQQMKVALIITV
FT                   ILTIISGIALIAVACEKPSDILGFLLLGLMAIVAAITYTVGRKPYGYMGLGDISVLVFF
FT                   GWLSVAGTYYLQAGHFDSIVMLPATACGLLATAVLNINNLRDIENDKANGKNTLAVRLG
FT                   PVVARYYHALLIGAAIFCLALFSILHLHSWHGWIFLLAIPLLGKHALFVLRDPTAAGMR
FT                   PMLEQMVKAALLTNILFAVGLVFS"
FT   gene            complement(114570..115901)
FT                   /gene="hslU"
FT                   /locus_tag="YpAngola_A0112"
FT   CDS_pept        complement(114570..115901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="YpAngola_A0112"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="identified by match to protein family HMM PF07724;
FT                   match to protein family HMM TIGR00390"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85146"
FT                   /db_xref="GOA:A9R6C7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6C7"
FT                   /protein_id="ABX85146.1"
FT                   /translation="MSEMTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DAAVKMVRHQSIEKMRYRAEELAEERILDVLIPPAKNNWGVPDESQEPSATRQTFRKKL
FT                   REGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTNQLQSMFQNIAGQKQKPRKIKIKEAL
FT                   KLLIEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEIDKICKRGQTSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQALTTDDF
FT                   ERILTEPSASLTEQYKALMATEGVTIEFTREGIRKIAEAAWQVNERTENIGARRLHTVL
FT                   ERLMEDISYDASESSGQSITIDAEYVGKHLDELVADEDLSRFIL"
FT   gene            complement(115972..116496)
FT                   /gene="hslV"
FT                   /locus_tag="YpAngola_A0113"
FT   CDS_pept        complement(115972..116496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="YpAngola_A0113"
FT                   /product="ATP-dependent protease HslV"
FT                   /EC_number="3.4.25.-"
FT                   /note="identified by match to protein family HMM PF00227"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85686"
FT                   /db_xref="GOA:A9R6C8"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6C8"
FT                   /protein_id="ABX85686.1"
FT                   /translation="MTTIVSVRRDGHVVIGGDGQVTLGNTVMKGNAKKVRRLYNNKVIA
FT                   GFAGGTADAFTLFELFERKLEMHQGHLTKAAVELAKDWRTDRMLRKLEALLAVADETAS
FT                   LIITGNGDVVQPEDDLIAIGSGGPYAQSAARALLENTELGARDIVEKSLSIAGDICIYT
FT                   NRFQTIEELTY"
FT   gene            complement(116596..117441)
FT                   /gene="ftsN"
FT                   /locus_tag="YpAngola_A0114"
FT   CDS_pept        complement(116596..117441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsN"
FT                   /locus_tag="YpAngola_A0114"
FT                   /product="cell division protein FtsN"
FT                   /note="identified by match to protein family HMM PF05036;
FT                   match to protein family HMM TIGR02223"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85137"
FT                   /protein_id="ABX85137.1"
FT                   /translation="MAQRDYVSRGRSGARRKSTSRKKRSAPIVSKTVMALAVALLVVFV
FT                   GGLYFITHNKPGELPLLPNHDPRTGNGLPPKPEERWRYIKELENRQIGVPMPTEPSAGG
FT                   EVNAKTELTNEQRQLLEQMQADMRQQPTQLSEVPYNQGMQQVPRSAVTIKPPATSVQPQ
FT                   PVTPPRQTTIPVQPQAPAPVRTPPAAPVTQAVTPPKVEKEKEKTQRWMVQCGSFKAVDQ
FT                   AESIRAQLAFAGIESRITSGGGWNRVVLGPYNSKAAADKALQRLQGAGQSGCIPLSVGG
FT                   "
FT   gene            complement(117507..118223)
FT                   /locus_tag="YpAngola_A0115"
FT   CDS_pept        complement(117507..118223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0115"
FT                   /product="transcriptional repressor"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86777"
FT                   /protein_id="ABX86777.1"
FT                   /translation="MKNLRLCRRIFINLIITKQIDGMLLLGSNLPFDASKEEQRNLPPM
FT                   VMANEFAPELELPTVHIDNLTAAYEAVNYLHELGHKRIACIAGPESLPLSHYRLQGYIQ
FT                   ALRRNGITVDNDYIIRGDFSYEAGAQSFAALMELPHPPTAIFSHNDVMAVGAIWQAKQL
FT                   GLRIPQDVSLVGFDDLKLSQFCDPPLTTVAQPRYQIGQQAMLLLLEQLQGHSVQSGSRL
FT                   LDTELIIRESTAAPKH"
FT   gene            complement(118296..118805)
FT                   /locus_tag="YpAngola_A0116"
FT   CDS_pept        complement(118296..118805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0116"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88637"
FT                   /protein_id="ABX88637.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(118977..119708)
FT                   /locus_tag="YpAngola_A0117"
FT   CDS_pept        complement(118977..119708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0117"
FT                   /product="hybrid peroxiredoxin hyPrx5"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM PF00578; match to protein
FT                   family HMM PF08534; match to protein family HMM TIGR02190"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86019"
FT                   /protein_id="ABX86019.1"
FT                   /translation="MFTSQEGKKVPQVTFHTRQGDQWIDVTTDDLFSNKTVIVFSLPGA
FT                   FTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVNDTFVMNAWKSDQHAENITFVPDGNG
FT                   EFTKGMNMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTMLKYL
FT                   APDFKVQESVAVFTKPGCPFCAKAKQMLQDHGLQYEEIVLGKDATTVSLRAVSGRSTVP
FT                   QIFIGGRHIGGSDDLEKYLPA"
FT   gene            119855..120772
FT                   /gene="oxyR"
FT                   /locus_tag="YpAngola_A0119"
FT   CDS_pept        119855..120772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="YpAngola_A0119"
FT                   /product="hydrogen peroxide-inducible genes activator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88364"
FT                   /protein_id="ABX88364.1"
FT                   /translation="MNIRDLEYLVALAEFRHFRRAADSCHVSQPTLSGQIRKLEDELGI
FT                   MLLERTSRKVLFTQAGLLLVEQAKTVLREVKVLKEMASLQGESMSGPLHIGLIPTVGPY
FT                   LLPQIIPMLHKTFPKLEMYLHEAQTQNLLAQLDSGKLDCAILALVKETEAFIEIPLFDE
FT                   PMNLAIYADHPWANRERVEMHELAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTHFRAT
FT                   SLETLRNMVAAGSGITLLPALAVPNERQRDGVCYLECYKPVPKRTIALVYRPGSPLRGR
FT                   YEQLAEAIRDHMQERMAPSLEQAI"
FT   gene            complement(120755..122155)
FT                   /gene="sthA"
FT                   /locus_tag="YpAngola_A0118"
FT   CDS_pept        complement(120755..122155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sthA"
FT                   /locus_tag="YpAngola_A0118"
FT                   /product="soluble pyridine nucleotide transhydrogenase"
FT                   /EC_number="1.6.1.1"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF02852; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87424"
FT                   /db_xref="GOA:A9R6N5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR022962"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6N5"
FT                   /protein_id="ABX87424.1"
FT                   /translation="MQQHFHFDAIVIGSGPGGEGAAMGLVKQGARVAVIERYNNVGGGC
FT                   THWGTIPSKALRHAVSRIIEFNQNPLYSDNARTIKSSFADILNHADRVINQQTRMRQGF
FT                   YDRNHCHMFSGDASFIDANTVNVRYADGTSDTLQADNIVIATGSRPYRPVNVDFNHERI
FT                   YDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDA
FT                   LSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLE
FT                   NIGLEADSRGLLKVNSMYQTALSHVYAVGDVIGYPSLASAAYDQGRIAAQAMIKGEANV
FT                   HLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMDTGSLKIL
FT                   FHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTLEYFVNTTFNYPTMAEAYRVAA
FT                   LNGLNRLF"
FT   gene            122373..123008
FT                   /locus_tag="YpAngola_A0120"
FT   CDS_pept        122373..123008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0120"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87828"
FT                   /db_xref="GOA:A9R6N6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023764"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6N6"
FT                   /protein_id="ABX87828.1"
FT                   /translation="MGVRAQQKERTRRSLIEAAFSQLSAERSFASLSLREVSREAGIAP
FT                   TSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIGNNPN
FT                   AFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLELENHMPRSFTEAQAEAMVTIVFS
FT                   AGAEVLDVDIEQRRQLEERLVLQLRMISKGAYYWYRREQEKLAASRVE"
FT   gene            123021..123428
FT                   /locus_tag="YpAngola_A0121"
FT   CDS_pept        123021..123428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07226"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87066"
FT                   /protein_id="ABX87066.1"
FT                   /translation="MEQSSRRETGTLLLALITGLAINGVCAALFSALVPFSVFPLLTLI
FT                   LAVYCLHQRYLNFAMPQGIPVLASACFLLGILLYSAIVRVEYPAIGSNFVPAVLSVVLV
FT                   FWILFKLRTRKSVQTHTDADIDINNSDQPQQ"
FT   gene            complement(123562..124665)
FT                   /gene="trmA"
FT                   /locus_tag="YpAngola_A0122"
FT   CDS_pept        complement(123562..124665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="YpAngola_A0122"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="identified by match to protein family HMM PF05958;
FT                   match to protein family HMM TIGR02143"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86986"
FT                   /db_xref="GOA:A9R6N8"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6N8"
FT                   /protein_id="ABX86986.1"
FT                   /translation="MTPNILPIESYDHQLAEKSARLKAMMLPFQAPEPEIFRSPADHYR
FT                   MRAEFRVWHDEDDLYHIMFDQQTKQRIRVEQFPVASRLINRLMDALMTAIRAEPLLRRK
FT                   LFQIDYLSTLSGKLIASLLYHRQLDEEWQQKALELRDQLRAQGFDLQLIGRAAKTKIML
FT                   DHDYIDEVLPVAGREMIYRQVENSFTQPNAAVNIHMLEWALDVTQGATGDLLELYCGNG
FT                   NFSLALARNFERVLATEIAKPSVAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREFN
FT                   RLKGIDLGSYNCETIFVDPPRSGLDHETVKLVQAYPRILYISCNPETLCANLEQLQHTH
FT                   KISRLALFDQFPYTHHMECGVLLEKRH"
FT   misc_binding    124804..125029
FT                   /bound_moiety="cobalamin"
FT                   /note="cobalamin riboswitch"
FT   gene            125127..127022
FT                   /gene="btuB"
FT                   /locus_tag="YpAngola_A0123"
FT   CDS_pept        125127..127022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuB"
FT                   /locus_tag="YpAngola_A0123"
FT                   /product="TonB-dependent vitamin B12 receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01779"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87429"
FT                   /protein_id="ABX87429.1"
FT                   /translation="MIIKNTMTIKKYTLLTALSVTAFSGWAQGNNTTDNNDEMVVTANR
FT                   FPQPKSSVLAPVDVVTRADIDRWQSTNINDVLRRLPGVDIAQDGGMGQRSSLFIRGTNS
FT                   SHVLVLIDGVRLNQAGITGASDLSQIPISLVQRIEYIRGPRSAVYGSDAIGGVINILTG
FT                   RDKPGTTLSAGLGSNGYQTYDGSTQQKLGEDTTVTLAGNYTYSKGYDVVAGMPGAGGPR
FT                   QPDRDGFMGKMLWAGLEHQFNEQFNGFARVYGFDNRSDYDGYTNYSNPLALIDTRKLSS
FT                   RTYDTGLRYKNGIYASQFIASYNRTKDYNYSPLFGQHDITASLDEAEQYNLQWGNTFQL
FT                   TNGMISAGADWQEQRTERKSSNQNTTADFTQHNTGIYLTGQQQISDVTLEGAVRSDDNS
FT                   QFGWHSTWQTSAGWEFIDGYRLIGSYGTAYKAPNLMQLYSAYGGNANLKPEESKQWEGG
FT                   VEGLTGPLTWRLSAYRNDIDQLIDYSNLTNGYFNINKATIKGVEWTGSFDTGPLSHQVT
FT                   LEYLDPRNADTHEILVRRAKQQVKYQLDWQVADLDWSVTYQYLGQRYDKDYSTYPEETV
FT                   ELGGVSLWDLAVSYPVTSHLTVRGRIANLFDKDYEMVYGYQTPGREYYFTGSYNF"
FT   gene            127108..127830
FT                   /gene="murI"
FT                   /locus_tag="YpAngola_A0124"
FT   CDS_pept        127108..127830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="YpAngola_A0124"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="identified by match to protein family HMM PF01177;
FT                   match to protein family HMM TIGR00067"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87574"
FT                   /protein_id="ABX87574.1"
FT                   /translation="MPDLHYIYAFDNVAFPYGEKSGEFIVERVLEIVTAVQQRHPLAIV
FT                   VIACNTASTVSLPALRERFAFPVVGVVPAIKPAVRLTRNGVVGLLATRATVHASYTLDL
FT                   IARFATDCKIELLGSSELVEVAETKLHGGVVPLEVLKKILHPWLSMREPPDTIVLGCTH
FT                   FPLLTEELAQVLPEGTRMVDSGAAIARRTAWLISSQENVISSQDENIAYCMALDEDTDA
FT                   LLPVLQSYGFPKLQKLPI"
FT   gene            complement(128096..128242)
FT                   /locus_tag="YpAngola_A0125"
FT   CDS_pept        complement(128096..128242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86313"
FT                   /protein_id="ABX86313.1"
FT                   /translation="MLKDYFLQIGILTEVKMFTALVTLQDLILFLPAETGGDIVLRVPT
FT                   QIV"
FT   gene            128311..129788
FT                   /gene="rrs"
FT                   /locus_tag="YpAngola_A0126"
FT   rRNA            128311..129788
FT                   /gene="rrs"
FT                   /locus_tag="YpAngola_A0126"
FT                   /product="16S ribosomal RNA"
FT   gene            129931..130009
FT                   /locus_tag="YpAngola_A0127"
FT   tRNA            129931..130009
FT                   /locus_tag="YpAngola_A0127"
FT                   /product="tRNA-Ile"
FT   gene            130059..130136
FT                   /locus_tag="YpAngola_A0128"
FT   tRNA            130059..130136
FT                   /locus_tag="YpAngola_A0128"
FT                   /product="tRNA-Ala"
FT   gene            130354..133260
FT                   /gene="rrl"
FT                   /locus_tag="YpAngola_A0130"
FT   rRNA            130354..133260
FT                   /gene="rrl"
FT                   /locus_tag="YpAngola_A0130"
FT                   /product="23S ribosomal RNA"
FT   gene            133370..133485
FT                   /gene="rrf"
FT                   /locus_tag="YpAngola_A0131"
FT   rRNA            133370..133485
FT                   /gene="rrf"
FT                   /locus_tag="YpAngola_A0131"
FT                   /product="5S ribosomal RNA"
FT   gene            133820..134086
FT                   /locus_tag="YpAngola_A0132"
FT   CDS_pept        133820..134086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0132"
FT                   /product="isrso12-transposase orfa protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88282"
FT                   /protein_id="ABX88282.1"
FT                   /translation="MKKTRYTEEQIAFALKQAETGTRVEEVCRKMGISEATFYNWKKKF
FT                   GGMGVTELRRLRQLEDENQRLKRLVADLSLDKEMLQDVIRKKF"
FT   gene            134110..134919
FT                   /locus_tag="YpAngola_A0133"
FT   CDS_pept        134110..134919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0133"
FT                   /product="transposase B"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86932"
FT                   /protein_id="ABX86932.1"
FT                   /translation="MEYLLAAYRIGVRRGCRLMMQSRTVYNYRSHRDDRAITQRIREIA
FT                   ETRIRYGCPRIHILLRREGWLVNHKKTHRIYCLEGLNLRSKRPRWHVTARHRHASPEVT
FT                   ALDQCWSMDFVADNLFNGRRVRALTIVDNFSRECLAIEVGQGLRGDDVVAVMDRLKHSL
FT                   GRIPQRLQTDNGSEFISKSMDRWAYENRVSMDFSGPGKPTDNAFIESFNGSLRDECLNV
FT                   HGFLSLEDAQEKIEQWRQEYNHFRPYSSLNNLTPAEFARSHQKGPDL"
FT   gene            135389..135574
FT                   /locus_tag="YpAngola_A0134"
FT   CDS_pept        135389..135574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85319"
FT                   /protein_id="ABX85319.1"
FT                   /translation="MAYQKEAITENNLPVFYPQLKQQMNYQSSWLAGKYTDFALWRSCQ
FT                   RRMKSDPLISPPTAQY"
FT   gene            complement(135584..136363)
FT                   /locus_tag="YpAngola_A0135"
FT   CDS_pept        complement(135584..136363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0135"
FT                   /product="putative transposition helper protein"
FT                   /note="identified by match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87762"
FT                   /protein_id="ABX87762.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(136363..137385)
FT                   /locus_tag="YpAngola_A0136"
FT   CDS_pept        complement(136363..137385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0136"
FT                   /product="transposase for insertion sequence"
FT                   /note="identified by match to protein family HMM PF00665;
FT                   match to protein family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86147"
FT                   /protein_id="ABX86147.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            complement(137399..138028)
FT                   /locus_tag="YpAngola_A0137"
FT   CDS_pept        complement(137399..138028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86443"
FT                   /protein_id="ABX86443.1"
FT                   /translation="MDFTSLNNQHSDLNNPVFSRIKAKRIDLENPDLASDGFNKQDFAN
FT                   KVAASVDHNASDLHLCTGFHPVLRIDGELKTFTDWPKVTAGWLNGLRRHMLSDAQESRL
FT                   QQQGQVDCAYTTVGSQRLRANIFQQRQGQSIAFRIIPAICPSLTQLAAPPILNQLIQQD
FT                   NGLILVTGATGSGKSTTLSAMISVTNGAIVIHTQRLKSDPGGNLLS"
FT   gene            138018..138746
FT                   /locus_tag="YpAngola_A0138"
FT   CDS_pept        138018..138746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0138"
FT                   /product="conserved hypothetical protein TIGR00044"
FT                   /note="identified by match to protein family HMM PF01168;
FT                   match to protein family HMM TIGR00044"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88591"
FT                   /protein_id="ABX88591.1"
FT                   /translation="MKSISNSWVHMSTIQQNLQDVRARIATAAHNCGRSPEEVTLLAVS
FT                   KTKPVAAIEKAIAAGQYAFGENYVQEGVDKIHSFVDNKTLEWHFIGPLQSNKSRLVAEN
FT                   FAWCHTVDRLKIAQRLSAQRPAAMPALNVLIQINISDEQSKAGISLSELPALADSISTL
FT                   PNLCLRGLMAIPAPEHDYQRQLAVFTQMNQAFLTLKARYPQIDTLSMGMTDDMDAAISA
FT                   GSTLVRIGTAIFGARVYNAD"
FT   gene            138879..139700
FT                   /gene="proC"
FT                   /locus_tag="YpAngola_A0139"
FT   CDS_pept        138879..139700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="YpAngola_A0139"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by match to protein family HMM PF03807;
FT                   match to protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87807"
FT                   /protein_id="ABX87807.1"
FT                   /translation="MQHRNITFIGAGNMARAIIAGLVAGGYPAKMISVCAPSAKNRDAL
FT                   ATEFGVISSDDNIRESQKAEVVVLAVKPQLMADVCQQLQKQVDFSDKLVLSIAAGVQVA
FT                   RFYALLGNKLNLVRIMPNTPSLVGKGMSGLYAPEQVSAADRDFTTELMSAIGKVCWVDN
FT                   EDGINSIIAAAGSSPAYFFLFMEAMQQETERLGFDSETARQLVQQAASGACALVEANPH
FT                   VPLSALREQVTSKGGTTAEAIRVFNEQHLPEMVANAMRAAIARAKEMEKLF"
FT   gene            139988..140542
FT                   /locus_tag="YpAngola_A0140"
FT   CDS_pept        139988..140542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0140"
FT                   /product="putative YggT family membrane protein"
FT                   /note="identified by match to protein family HMM PF02325"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85350"
FT                   /protein_id="ABX85350.1"
FT                   /translation="MLTLTFLAKTVIDLYVMVLLLRIWMQWVHSDFYNPLSQFVVKITQ
FT                   PIVGPLRRVVPSMGPIDSASLLLAFLLMTIKYPLLLLIDSGSLSLSIYNLLFGLIALVK
FT                   AVGYLIFWVMIIRALMSWISQGRSPVDYLLLQLTEPLMAPIRRILPAMGGIDFSAMVVI
FT                   LILYLLNFLGMDLFGAMWVML"
FT   gene            140527..140829
FT                   /locus_tag="YpAngola_A0141"
FT   CDS_pept        140527..140829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0141"
FT                   /product="conserved hypothetical protein TIGR00251"
FT                   /note="identified by match to protein family HMM PF02594;
FT                   match to protein family HMM TIGR00251"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85077"
FT                   /protein_id="ABX85077.1"
FT                   /translation="MGHAVSAVLSTENGLILKLYIQPKASRDQIVGLHGDELKVAITAP
FT                   PVDGQANTHLVKFIAKQFRVAKSQVIIEKGELGRHKQIKVINPQQIPPEVTILLE"
FT   gene            140863..141522
FT                   /gene="rdgB"
FT                   /locus_tag="YpAngola_A0142"
FT   CDS_pept        140863..141522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="YpAngola_A0142"
FT                   /product="non-canonical purine NTP pyrophosphatase RdgB"
FT                   /note="identified by match to protein family HMM PF01725;
FT                   match to protein family HMM TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86517"
FT                   /protein_id="ABX86517.1"
FT                   /translation="MSAQQTALNTDSRQPIKIQDSSMQKIVLATGNPGKVRELANLLAD
FT                   FGLDVVAQTELGVESAEETGLTFIENAILKARHAAQTTGLPAIADDSGLAVDALGGAPG
FT                   IYSARYAGTDASDQENLEKLLVALQNVPDEKRGAQFHCVLVYMRHAEDPTPLVFHGQWP
FT                   GVIAHQPAGAAGFGYDPIFYVPALGKTAAELTREEKHAVSHRGQALKLMLDALRDA"
FT   gene            141515..142645
FT                   /locus_tag="YpAngola_A0143"
FT   CDS_pept        141515..142645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0143"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969; match to protein
FT                   family HMM TIGR00539"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87600"
FT                   /protein_id="ABX87600.1"
FT                   /translation="MLKLPPLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVEHVLA
FT                   DLDADVPLVSGREISTIFIGGGTPSLLSAEAMQQLLDGVRARLPVASDAEITMEANPGA
FT                   VEADRFSGYQRAGINRISIGVQSFSAQKLTRLGRIHGPDEARRAAELATSLQLRSFNLD
FT                   LMHGLPDQTLEEALDDLRQAIALNPPHLSWYQLTIEPNTGFSSRPPILPDDDALWDIFQ
FT                   QGHQLLSAAGYLQYETSAYAKPGYQCQHNLNYWRFGDYLGIGCGAHGKITFNDGRILRT
FT                   IKTKHPRGFMQGKYLDKQYEVAAVDRPFEFFMNRFRLLEAAPRADFYHFTGLTESTIRP
FT                   QLDEAIAKEYLIETTEYWQITEKGKLFLNSLLELFL"
FT   gene            complement(142814..144022)
FT                   /locus_tag="YpAngola_A0144"
FT   CDS_pept        complement(142814..144022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0144"
FT                   /product="IS285, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88114"
FT                   /protein_id="ABX88114.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            complement(144158..153472)
FT                   /locus_tag="YpAngola_A0145"
FT   CDS_pept        complement(144158..153472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0145"
FT                   /product="putative phage minor structural protein"
FT                   /note="identified by match to protein family HMM PF00353"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85398"
FT                   /protein_id="ABX85398.1"
FT                   /translation="MAGFYIDKLSLSQRLSIVSETYDRVNKNNKKEKLKYSYDDIEMIK
FT                   KRFVKYIDAQLYSLIREGLSVPATLTQEEKIKITDLAIDAALFNDYERFNELIIYISSL
FT                   GISVTPPLPQEEGGSRLYIYFSGDIHAYMDVWRGDLLLGSGTELSDIQSITGLRFMIDM
FT                   AESLKLNIINPADKAMVDLINHLRYEMISYASSFCATYSAERGGTVYLSSPDGLRINNY
FT                   FWNSELPVLRALQKKGLIGDIRILHKPLEFYKDTPLDELGDLLTAKDISMTVEYQFLPV
FT                   WLQEKLLVDIYQQWLDEEFQPSLLAVRKEIINTIDIDRHAPEVELLRYFLRKIHEQLDE
FT                   ITEFKVLKEAERIDSIKKKLAVGSEIESWLDNVPAIDVNERKIILESLLQKESLLFSNV
FT                   RDIKKSIIPLDFNSDVININTSLLKNTFIPFNLLRESWDVIISDRSLVEGTLTIHFSVG
FT                   RKIMIKVDANRNQLKQMATLERFLLANFTPRNTPQDLKIIDNVIMSGDVVLAERRDDKG
FT                   WHNDQQMIEKVKLSEFDYFLKSNDLGVKINDNGFVLYLISDPEDNRDVIIKPNDDYNLK
FT                   SIKDFIENNYLFFDDVPEYLIVKKNVENKECIFAHDEGETYQVAYRDGEAWVLLSKMNT
FT                   SDQIKNLNEITMSVNLNNAESRSVALILSLLNKHARLVSILPDTHPKVMENFLDIDSLL
FT                   KNSTHPFEHPLYRKLLNSISNDINKYMESLNEIKDSYHLLPFDVRPGQYMNTWSKIDRD
FT                   TVIEYSFKQNDKNHHPQFIVLLQDDSLSKRVGEIIASYNNNKSIVLQFDARSSEARIAY
FT                   GTQNNITEMGKFELSFVTHGTTDGVYSFSVANVIEIYKLTINSFALPPPVKIRLVICSI
FT                   ADNGQGAQGFNGTNPALGIVNMMHQEGFDIPILAYTTKVGVSVEHPGELVVFNSEKPGE
FT                   VLKNIDDYQVLYHYKNNILLTDGVPVVELLLKDVRNKIKSVDQLIESYSQYLVPFFSDD
FT                   NGVVDRELLELTINDFDTYSKFENFLDIIRQRPELRNSDNWQLVVANNATGFLITTLDE
FT                   PVVKYPDIVKVNEWDLPAIANIDKTATASQYDMQIVFQCENNPTVNRAATRLAGKHAKN
FT                   SIIIQLDVDNNHRAFIIDDNTHAEWREISHNELVTKLKIQPENGKIRWQVVGHGRSEGG
FT                   NDKHPTLAGQRPEQLTARLNQFSDYLQTEHQINISPQQVSLVGCAMSSSDRYTSFAHKF
FT                   MSHLNENGIRTNVSASTKAIEVDPQGHKHDVDTPDIDSYNNKYLSSIKGTEKLYWNRWG
FT                   EITTERKKDINGRLNNIDSLLDKLITRQLSVNQLNKKQQRKLAEIFPQLTDKKLNKGEL
FT                   LLTLHDSWRMQALKYDLLFLQKISDRPDFDTELWRVTDRWRITETDGNTLQDVRIKSGS
FT                   QHKTDLATYPHSITSDPDLKTSAPELKTSNPKARTAIFGRFGYGMQGYGFISALRLSAD
FT                   YQRWMSNGDLTEKQEEEIQLQLAMAWGGIGANLATDGLQYAFGKWGIGYLQKLVSKGGR
FT                   LSPALLSQLTLLKRNPALLLAPGFLKDLRKLALNQFAHGAARFSMPLLSALTSGIDIYQ
FT                   AYHAFSQLATETDPHVRRDLIASGVFSTINATIGLGVAFAMAMGGTAATAAGPAGIALA
FT                   FTMIIVGDIYSAVSQIERIRDIVPDMTGSQRFENGLRLFLKFGLTPGLDNQIRYNQTME
FT                   SVYQRQRDYYEALLASKQGVDTLFYSRGEAVLKAIPFIKRDERSQTERDLEKISIFSGD
FT                   PFTNAKIYTTYAEMGKHEYYELDKINDVDDYVIADFFEDNNRSVVKLQNKNLHQAFSEL
FT                   DIDSTYSPFILSADVDRNGLNDFIVINEKYNTTIASRKNSVGMTVIDDYVSRWHYELYT
FT                   WLAQPDGSYLKIDTRLEWEKLFHAIEVDKFNEVVFPVLGDFNGDNVFELVIFHDDKMTT
FT                   YHYDSLDFNQSGKDNHNVINIGDFIEPVRLAFEGEKSKNYPYSLVGDINNDGFDDILLL
FT                   NKSGDMLHLMGNSSGVFRQHKTKLSSELTSLLSSSNLHRSQLQLTDLNKDGGLDLVIIL
FT                   NDGIYYQALGDKIDGEYHFDTPSMVNKITIKNEGGDSVRYQQNRLSQIDKHKIIAISPS
FT                   DQGENRLISLSDSGELLAHPLREIKENDVAALFDLGGGDDVAKGYHKKKNIFTIGSGFK
FT                   QYQGGENADTFILTSAVASKSHILSGGEGNDTVALGEVLGNEIDSIIDISNGYYSQVNG
FT                   GVEKQVALLYDFENILGHENVNDTIIGNDVDNYLNGMGGDDKIWGNGGNDLLALQSGLA
FT                   QGGTGLDSYHILKSTHEKSLQIRIEEVSENNNTDMQISNIFLEHKLNQIKSIELDNIDV
FT                   LININNDNGFMTQIRLVGVYNINNNQKQQVLNFTIQTVDGFTMVPLWPSYLNEITEFSP
FT                   NMVAYYSSLVDRNYKELVGKGDPDDIVVRFSLDNGYQQQQVTHLQRVEGEKDIVLRQAI
FT                   LPDFIRLSPQEHSMLMGFLPRYELLGDNKDNLLQVLSGEGLLEGRGGQDTYLIQEKEGS
FT                   PTDIIINNFDDSLASDNLVLSSWLLCDVIVERSDDDLLLRYRDQPEKHQSIRLVNYMND
FT                   ERYRHLKITDKSGQSQYRDPVTGTFIDYQINLDKNGHPFIAAQQAPVVSSGNDEVVITS
FT                   ATFLPGNYIDTGDGNDAIIYIRGHEGTMLKGGGGDDTYYYSAGSGAINIADTSGLDHLY
FT                   LDKHILLHTLSAERRENNLVLNIADNTSGRIIFVDWYLADENKVEFIWVEDSQITFDEL
FT                   FSLRPYSDEYYQLCQHLKSMGLSLTVRQLADLDSQDGYNTLNQLRTIKAWVTKNPIYDV
FT                   ADLDYLVAMSSIAWRGNARNTDPLPLIEQKIDAFFQPLIAERISLTEEHVTWIQREEFD
FT                   TVDIAKWVKNYHLRSQNEINYLLEQLGLLKESPLSDKALDFTFKNRIDLAQADIELCQQ
FT                   ECGINRQSLINLAMKYHVTGRGHFELLISNIQVLKEYGVVVSESEQPLVLRKPIDLRQY
FT                   FNQKNLTKDHVGRLAEHDMSFDELTLLLDKNIPIEQAFTQRLQTQLGPLKLFNDERVFN
FT                   KGDVFDQDISQLAEAMGGLESTESYSLPLERQTVMAITTHQFVSDSIAAY"
FT   gene            complement(153986..154719)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0146"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(154831..155757)
FT                   /locus_tag="YpAngola_A0147"
FT   CDS_pept        complement(154831..155757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0147"
FT                   /product="glutaminase"
FT                   /note="identified by match to protein family HMM PF04960"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87344"
FT                   /protein_id="ABX87344.1"
FT                   /translation="MVTTLDNALLNDILQQVRPLIGQGKVADYIPALAEVPANKLGIAV
FT                   CTLDGQIFQAGDADERFSIQSISKVLSLTLALSRYSEQDIWQRVGKEPSGQPFNSLVQL
FT                   ELEKGKPRNPFINLGALVVCDMLQSRLSAPKQRLLEVVRQLVKDDSISYDPRVARSEFE
FT                   HSDRNAAIAYLMKSFGNFDNDVLTVLQTYFHYCAMRMSCVELARCFVYLANQGRSISGS
FT                   ESLITPMQARQINALMITSGMYDGAGEFAFRVGMPGKSGVGGGIIAIVPDEFCIAVWSP
FT                   ELDHAGNSLAGTAALERLAQQMGRSIF"
FT   gene            complement(155868..156194)
FT                   /locus_tag="YpAngola_A0148"
FT   CDS_pept        complement(155868..156194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04320"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86774"
FT                   /protein_id="ABX86774.1"
FT                   /translation="MAKNRSRRLRKKMHIDEFQELGFSVQWAFDEGTSVDVIDETVDAF
FT                   IDEVIEANGLAFDGSGYLQWEGLICLQEIGHCTDEHRALVTKWLEARKLKNVETSELFD
FT                   IWWD"
FT   gene            complement(156194..156913)
FT                   /gene="trmB"
FT                   /locus_tag="YpAngola_A0149"
FT   CDS_pept        complement(156194..156913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="YpAngola_A0149"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88424"
FT                   /protein_id="ABX88424.1"
FT                   /translation="MINDVISPEFDENGRALRRIRSFVRRQGRLTKGQQLALDSYWPVM
FT                   GVEYQAAPVDLNTLFGREAPIVLEIGFGMGTSLVTMATNNPQQNFLGIEVHSPGVGACL
FT                   SSAHDAGLSNLRIMCHDAVEVLENMIPEASLDMVQLFFPDPWHKARHNKRRIVQTPFVE
FT                   LVKSKLKVGGVFHMATDWQPYAEHMLEVMSGVSGYLNLSEQNDYVPRPDSRPLTKFELR
FT                   GQRLGHGVWDLMFERKE"
FT   gene            156897..157013
FT                   /locus_tag="YpAngola_A0150"
FT   CDS_pept        156897..157013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88550"
FT                   /protein_id="ABX88550.1"
FT                   /translation="MTSFIISAFYLLVVHMNAHYAKMRQFINYERHKYKIKR"
FT   gene            157248..158366
FT                   /gene="mutY"
FT                   /locus_tag="YpAngola_A0151"
FT   CDS_pept        157248..158366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="YpAngola_A0151"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01084"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85717"
FT                   /protein_id="ABX85717.1"
FT                   /translation="MMQAQQFAHVVLDWYQHFGRKTLPWQLDKTPYQVWLSEVMLQQTQ
FT                   VATVIPYFQRFMLRFPDIQALAAAPLDDVLHLWTGLGYYARARNLHKAAQMVVEHHQGE
FT                   FPTTFDQILALPGIGRSTAGAILSLSLGQHFPILDGNIKRVLARCYAVDGWPGKKEVEG
FT                   RLWQISEDVTPANGVGQFNQAMMDLGAMVCTRSKPKCELCPLNIGCMAYANHSWARYPG
FT                   KKPKQTLPEKTAWFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQEELIHWLQKQGIP
FT                   ANETQQLTAFRHTFSHFHLDIVPIWLNTASVRGCMDDGAGLWYNLAQPPSVGLAAPVER
FT                   LLHQLLKDPLAKDELTQQQLTKQSPTQPALFD"
FT   gene            158544..158816
FT                   /locus_tag="YpAngola_A0152"
FT   CDS_pept        158544..158816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0152"
FT                   /product="putative Fe(2+) trafficking protein YggX"
FT                   /note="identified by match to protein family HMM PF04362"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85300"
FT                   /db_xref="GOA:A9R6R1"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6R1"
FT                   /protein_id="ABX85300.1"
FT                   /translation="MSRTIFCTFLKKDAEGQDFQLYPGEIGKRIYNEISKEAWSQWITK
FT                   QTMLINEKKLSMMNIEDRKLLEQEMVNFLFEGQDVHIAGYTPPSK"
FT   gene            158999..160075
FT                   /locus_tag="YpAngola_A0153"
FT   CDS_pept        158999..160075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0153"
FT                   /product="membrane-bound lytic murein transglycosylase C
FT                   (Murein hydrolase C)"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86561"
FT                   /db_xref="GOA:A9R6R2"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023664"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6R2"
FT                   /protein_id="ABX86561.1"
FT                   /translation="MKKILALLVIAPLLVSCSGNKNQVENEVFVKDTNGFEILMGQFAH
FT                   NIENIWGLKEVLIAGPKDYVKYTDQYQTRSHINFDAGTITIETIATTNPAAHLRQAIIT
FT                   TLLMGDDPGSIDLYSDVNDIQISKEPFLYGQVLDNNGEPIRWEWRAAHFADYLLQNKMQ
FT                   TRTSGLHVISFVTIQLVPNHLDKRAHKYLPLVRKSAARYGVEESLILAIMQTESSFNPY
FT                   AVSRSDALGLMQVVQHTAGKDVFKLKGKSGQPSRSYLFDPENNIDAGTAYLSILQNTYL
FT                   GGIQNATSRRYAVITSYNGGAGSVLRVFHSDKNKAVGIINTMSPGDVFQTLTTKHPSGE
FT                   SRRYLVKVNSAQKNYRRY"
FT   gene            160357..161457
FT                   /locus_tag="YpAngola_A0154"
FT   CDS_pept        160357..161457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0154"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86143"
FT                   /protein_id="ABX86143.1"
FT                   /translation="MRLLLLIFLLCTWAVSAKTITDITGQRIEIPDNPQRIVLGESRML
FT                   YTLALLEPGYPAARVVGWPLDLKKYDPQSWALYTDKFPQMTHIPALGSTGLRDINPEKV
FT                   LELAPDLVILPVLAKTTHEEIALISLLKQAHIPVIRVDLRVDLLNHTIPSLRLLGEALN
FT                   RQDRAEAFISLYQSHMDRIHQRIAAYQGPHPSVLLQLHLGRGDECCTTTLKGNLGQLLE
FT                   FAGGNNIAAAQVKGVFGQLSEEYVLARSPEIYIATGMATAGSQAKTLALGPQVSTAQAQ
FT                   ESFRRVIATQSKLQHLPAIQNGHAWGLWHNFYLSPLHVVAAEFFAKTLYPHLFADVSPQ
FT                   DTLQTIYQQFLPLDFTGTFWSHLDNE"
FT   gene            161546..163579
FT                   /locus_tag="YpAngola_A0155"
FT   CDS_pept        161546..163579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0155"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87436"
FT                   /protein_id="ABX87436.1"
FT                   /translation="MLAEDTIIVERNRSQTDSYQATTSVTANRSPANIIDTPQNVTVVT
FT                   HPVLEDYDVTNLGEALYFVSGITQSNTLGGTQDALIKRGFGNNRDGSILHDGIRSIQAR
FT                   NFTPTSERVEVLKGPSSMLYGMNEPGGLINVISKKPQLDPHVHLEANASSFKGGGGQLD
FT                   VTGPLGESGFAGRLIIDHQETDYWRNFGRNRQTVVAPSLDWYGENTTVHLAWERMEYLV
FT                   PFDRGTVIDPRTGKPVDTPRDRRFDESYNATRGDQDTVTFSINHDLNEFWSTQLNYAFS
FT                   RNSYSDNQARATAFNAETGVLTRQSDATANAKSHSQAVQWVVNGDLDWGFTHHQLMFGI
FT                   DYEARRVFRGDMIRGSKNNGFNVYDPIYGTLPPSTAVSAADSDQRENIDSRALFIQDSM
FT                   RLNEHWLLLGGLRYDSFDVMAGKGRPFKKNTDSSDSRLVPRAGVVYNLNDWSSLYVSYT
FT                   ESFKPNVSIATAIDALPPEYGKSWEAGYKIDINNRVTGTLAVYDIHKRNIMVSELVDGE
FT                   TVTRTAGKARSRGLELDMAGKVTDSLSLIGSYAYTDARLTEDPDNNGNDLPNVARHTAA
FT                   LFLSRDFGSTSLISGDEVKAGIGARYVGKRAGDAANSFWLDNYTVADAFIAWKMPLSGY
FT                   QLKWQLNVKNLFDKTYYPSSANNLRIAIGEPRQVVLQGSIDF"
FT   gene            complement(163662..164642)
FT                   /locus_tag="YpAngola_A0156"
FT   CDS_pept        complement(163662..164642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0156"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87014"
FT                   /protein_id="ABX87014.1"
FT                   /translation="MGSIVKEVDDVRQVSLMKRTALFLLDNSTTVVFIVMLIAAGFFSD
FT                   RFYSGDNITNVLRQSVPLGLAALGMLFVILTGGIDLSIGSIMAFVSVLVGLLIPEFGLW
FT                   PALIAGVGIATLMGAFSGFLVTWFNIAPFIATLAMMTIARGVALIISKGQPVFIDNDAF
FT                   VNFGTGYFLGIPLPVYVFLGFAIIFQLVYKNSVFGRLVVSIGSNETATRFAGIRVNNYK
FT                   LAVYAISAFACGAAGIISATRTGVGSPVLSIGFELDVIAAVVVGGASLAGGHGNVVNTI
FT                   IGVFILSIISNLMNLMNISGYNQQVVKGVIIIAVMVQSLKSRSKA"
FT   gene            complement(164675..166174)
FT                   /locus_tag="YpAngola_A0157"
FT   CDS_pept        complement(164675..166174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0157"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87413"
FT                   /protein_id="ABX87413.1"
FT                   /translation="MDQYAIEVIQVTKSFGGIHALKSINLQIRTGSIHAIIGENGAGKS
FT                   TLMKILSGIYTKDSGRIMIHGEEKNFTSPIHSKESRIGIIYQELALSPDLTVAENIFLD
FT                   DLGFGTGMINWKRLNEKASLILNELGFQIDPRARVGDLSVAYQQMVEIAKSLAKDVNIL
FT                   ILDEPSAVLSGKEVAILFTQLRKLKARGVTIIYISHRLEELMVIADVITVIKDGETVKT
FT                   LDPQSCSEDEIITSMVGRKLESLYPEKNVPGNEVVLEVKALSTRALLHGINLTLHKGEI
FT                   VGLAGLVGAGRSEVARCLFGIDKIAGGTVSKAGTPIQINHPSQAMSHGIGLVPESRKEQ
FT                   GAILVRPIRENMTLSNLKAVSGWMGFIRRRQERETSQKLQQKLAIKLGSVEDPIASLSG
FT                   GNQQKVVIAKWLNTDCHILILDEPTRGVDVGAKAEIYNIIHQLAERGYSILVISSEMVE
FT                   VINLCHRIYVMSEGRITKELQHDEISEENIMRYAIPKRETI"
FT   gene            complement(166220..167179)
FT                   /locus_tag="YpAngola_A0158"
FT   CDS_pept        complement(166220..167179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0158"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85080"
FT                   /protein_id="ABX85080.1"
FT                   /translation="MKKRLIGLLLAGVTISMSVSAAEPLKIGFANRTLNGAFFNGLTEY
FT                   MKIHAKEKGYTLITTDARGDLNKQIADVEDMLSQGINYLILNPQDPQAGLRITEIAKRA
FT                   GVPTVILDSDIALEAPVITRVQANNAKNNNLIGEYAVGQFGDKPMNCIFLSGNQGNLVG
FT                   QARRDNFLLGVAEAQLRKYNRTNVNFLSQGWGNWDQQGGLKAMEDIIVAQGDKINCVYS
FT                   EMDDMALGAIRALKAANKLDNVKVYAHDGYKKGLEAVKKGELQATASNNPDLLTSTVLE
FT                   VIGQYQAGQTSFPDYVYIPSILITKDNVDKYYKEDSIF"
FT   gene            complement(167735..169897)
FT                   /gene="speC"
FT                   /locus_tag="YpAngola_A0159"
FT   CDS_pept        complement(167735..169897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speC"
FT                   /locus_tag="YpAngola_A0159"
FT                   /product="ornithine decarboxylase, constitutive"
FT                   /EC_number="4.1.1.17"
FT                   /note="identified by match to protein family HMM PF01276;
FT                   match to protein family HMM PF03709; match to protein
FT                   family HMM PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88465"
FT                   /protein_id="ABX88465.1"
FT                   /translation="MTLLKIATSARLASYVETQRGVVYLNQTDFTDVAAVVMSVEDANA
FT                   GILSMLHDLGFAIPAFIAVTAEQTVSADYLPLIKGVITLGEANKAFYNAQVEAAASEYQ
FT                   KNLLPPFFSTLKKYVEMNNSTFACPGHQGGEFFRKHPAGRQFFEFYGETIFRSDMCNAD
FT                   VKLGDLLIHEGAAKDAQKYAAKVFNADKTYFVLNGTSAANKVVTNALLTRGDLVLFDRN
FT                   NHKSNHHGALIQAGATPVYLETARNPFGFIGGIDAHCFNEDYLRQQLREVAPERAEEAR
FT                   PFRLAIIQLGTYDGTVYNARQVVDSIGHLCDYILFDSAWVGYEQFIPMMKDFSPLLLEL
FT                   NENDPGIIVTQSVHKQQAGFSQTSQVHKKDNHIKGQKRHCNHKRFNNAFMLHASTSPFY
FT                   PLFAALDVNAKIHSGDSGRRMWMDCVKLGIETRKSLLARCSMLRPFIPPVVGGKNWQDY
FT                   ATDVIANDARFFNFVPDERWHGFEGYNQDQYLVDPCKLLLTTPGIDASTGRYTSFGIPA
FT                   AILATFLRENGIVPEKCDLNSILFLLTPAENTAKMAHLVDMLVQFERYVEQDAKLCDVL
FT                   PTIYRKNEERYHGYTLRQLCQEMHDLYVSHDVKQLQKDMFRKASFPQVVMNPQDANIQF
FT                   IRDNIELIPIAEAEGRIAAEGALPYPPGVLCVVPGEVWGGAVQRYFLALEEGINLLPGF
FT                   SPELQGVYIEKGDVSWRRIFGYVITQ"
FT   gene            complement(169917..170069)
FT                   /locus_tag="YpAngola_A0160"
FT   CDS_pept        complement(169917..170069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86103"
FT                   /protein_id="ABX86103.1"
FT                   /translation="MVDAETSSPITQACISAGETCAFNDINLPALHQCSALCDVIDMPK
FT                   WQPHT"
FT   gene            170554..170679
FT                   /locus_tag="YpAngola_A0162"
FT   CDS_pept        170554..170679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85683"
FT                   /protein_id="ABX85683.1"
FT                   /translation="MRPVARIAQSVEQGIENPRVLGSIPSPGTIIQNLFVKDKYS"
FT   gene            170565..170642
FT                   /locus_tag="YpAngola_A0161"
FT   tRNA            170565..170642
FT                   /locus_tag="YpAngola_A0161"
FT                   /product="tRNA-Phe"
FT   gene            complement(170894..171040)
FT                   /locus_tag="YpAngola_A0163"
FT   CDS_pept        complement(170894..171040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0163"
FT                   /product="site-specific recombinase, phage integrase
FT                   family, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87242"
FT                   /protein_id="ABX87242.1"
FT                   /translation="MKSPDRNLKVVQTLLGHSSIAVTLEYVEGDIDSLRLALEETFERK
FT                   EVF"
FT   gene            complement(171226..171861)
FT                   /locus_tag="YpAngola_A0164"
FT   CDS_pept        complement(171226..171861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0164"
FT                   /product="Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88638"
FT                   /protein_id="ABX88638.1"
FT                   /translation="MQPAISLLKSAQEQMEAISADAQTATASPADLQAQISLLQQNLTE
FT                   LKQAVLLLSAPKGIALSSGEHLQMSASDNLIATAGKNADVSVAKNFFIGVGNTLSIFVR
FT                   KLGMKLIANQGSITVQAQNDLMELLARKAITITSTEDEIKITVKKRITLNAGGSYITLD
FT                   ENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAAKAKPPTQKYPFS"
FT   gene            complement(172469..172825)
FT                   /locus_tag="YpAngola_A0165"
FT   CDS_pept        complement(172469..172825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0165"
FT                   /product="IS1 family transposase orfB"
FT                   /note="identified by match to protein family HMM PF03400"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88042"
FT                   /protein_id="ABX88042.1"
FT                   /translation="MGNKKQQRWLWYAWESRLKRIIAHVFGRRSKKTFRQLLGLLSGFN
FT                   IVFWCTDNFSAYEMLPDEKHIRSKLYTQRIERENLNIRNRLKRLNRKTLGDSKSAEMHD
FT                   RIIGTFIEREHYLV"
FT   gene            complement(172891..173013)
FT                   /locus_tag="YpAngola_A0166"
FT   CDS_pept        complement(172891..173013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0166"
FT                   /product="IS1 family transposase orfA"
FT                   /note="identified by match to protein family HMM PF03811"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85562"
FT                   /protein_id="ABX85562.1"
FT                   /translation="MKEQIVDLAMNNAGIRDTARALHISINAVMRTLKNSRRSV"
FT   gene            complement(173262..174029)
FT                   /locus_tag="YpAngola_A0167"
FT   CDS_pept        complement(173262..174029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0167"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85064"
FT                   /protein_id="ABX85064.1"
FT                   /translation="MINIKKLTLKYFYILFFTPHLAHATYYNEVSFDDYIVLLDKNENA
FT                   ILHVKKNHTDIQCVIKNWNIKYNNGAGVISLTTDKKAILLANTQAYLYVDEVINCKEGG
FT                   VSLHKVPVPNSPPFGTVIDLNFDKKIYLSVVLEDIRTLSYTAIVSKFDSNKNIINAKGF
FT                   ENKQTTNKDNSFYLEGSSGGYGGKISINGKYIFPVNLDCSSDSFPGVWDLENKKRVVFS
FT                   SHKNSSITIDEKCHKLFNGVASLEELGGELVSK"
FT   gene            complement(174016..176313)
FT                   /locus_tag="YpAngola_A0168"
FT   CDS_pept        complement(174016..176313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0168"
FT                   /product="M23 peptidase domain protein"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87430"
FT                   /protein_id="ABX87430.1"
FT                   /translation="MIISPLFLKDKSNSEDDASWVSRMMPVDPERGFPLNSHRSWHGGI
FT                   HIPHTDSGGTPEKIRAIADGTVHSLRQPVGDKKGIPPYNYNGATDCGYVLLKHETEIGS
FT                   GENAKVVYFSLYMHLASIDAAVKTGEKIYRKDPIGTVGQVDGGNAVHFQIFCDDTNLTK
FT                   LVGRTTPELDLTKNGRTDAVYGDMYFYLPTGTKFYSHAPANNATTTTEAETYTSTEPLF
FT                   VSMSFDKGKCTMLTRKKGVFSIGKYSEVGEKLENTDGADYEYNVYAQAKKLYPQSQSAG
FT                   YELLRFGRVINTDYETLVPADAPLWRTISYPGGKGVVNLALPAVKKFSDGDFPHWTGWQ
FT                   LIDDDTDENSQCNSEQVLCRIGDDMQGLICHLPLEWDASTLEKRLSWLKTTVINESLAN
FT                   QKASHQVDDTGNNASGYAFDNINPDMSVLNAQSTPSFEQAAKDTAMAEADWNALIEHAK
FT                   ALCFDVSGLPVGRVWHFNPISFIAHFRKCGWLDPEKIKSILTSALNKKRNVRKITLIEK
FT                   ASDSNYTFLNLAMRKYNILTPNRQSHFLGQGAVESDSLTAMQEVSQEQVIVNGKQTGGG
FT                   IVIKSTLNESELGHWYGSEPSELDIYYSGNKYNKNGGLIAGSYSWSNGNCGDVDAQKFR
FT                   GRGFKMLTGRDKYADYWVYRGWLLKSSFDAYWWDDVKYKSKNLKAMKKRPAIIDDPHKI
FT                   TASPYNCIDSGSFFITCFRRSTVKEIDKDQAESADDSVVTKVTQAINGGDIGLSQRKVM
FT                   TNNAKGKLNDKY"
FT   gene            complement(176329..178677)
FT                   /locus_tag="YpAngola_A0169"
FT   CDS_pept        complement(176329..178677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM TIGR01646; match to protein
FT                   family HMM TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86855"
FT                   /protein_id="ABX86855.1"
FT                   /translation="MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDI
FT                   QFTSADKAIDPATMLMHDASLTLAAPMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEEC
FT                   RYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILRERHDMRGQDFVFTLAREYPRREQ
FT                   VMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQGLTLQAVPPSGM
FT                   HDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYADN
FT                   YLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALSPGQELKVTGNDVPAQ
FT                   FGKGVIVTRITSHARRDRSYEVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTVN
FT                   DTYGHIDKDGRYRVNLMFDRDSWEQGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAF
FT                   EDGNPDRPYIASVLHDSAHGDHVTISNYKRNVLRTPSNNKLRLEDERGKEHIKLSTEYG
FT                   GKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGIFISADGQAKAQGQVLEMQPAI
FT                   SLLKSAQEQMEAISADAQTATASPANLQVQISLLQQNLTELKQAVLLLSAPKGIALSSG
FT                   EHLQLSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVRKLGIKLIANQGRITVQAQN
FT                   DLMELLARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYY
FT                   GRLDKAKLPTEFPALAAKTEDPIKRWLFS"
FT   gene            complement(178674..181322)
FT                   /locus_tag="YpAngola_A0170"
FT   CDS_pept        complement(178674..181322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0170"
FT                   /product="ATPase, AAA family"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02861; match to protein
FT                   family HMM PF07724; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR03345"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86016"
FT                   /protein_id="ABX86016.1"
FT                   /translation="MTTHSAHLLRRLNPYCAQALAGAATLCQTRAHAEITVEHWLLKLL
FT                   EQGEGDITVIARRYEWDMDSLWQGLLAYLDTLPRTVQGKPQLSAALQQLIKSAWLDASL
FT                   QENADAVRSVHLMAALINSPSLLAADAAWPLLSLSTTQLHRLLPLLDSQSDERPEIQQA
FT                   AALADSPVNLTDEAATVTSASGQPQLNDALQAALDKFTLDVTAKARANQIDPIFGRDSE
FT                   IRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDSLKTVSVRTLDLGLL
FT                   QAGAGVKGEFEQRLKNVIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALA
FT                   RGELRTIAATTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGV
FT                   HILDAAITAAVTLSRRFLTGRQLPDKAVDLLDTAGARVRMSIDTLPTALMAINAELAAL
FT                   AMEQQAIEQDLLLLPNVSSTRLPEIEQRRAALAVGQHTLEQQYKEEKRLTTLIIEARQD
FT                   IANVAHLVALQEELVQIQGNAPLLSLDVDVCTVAAVIADWTGVPLSSLLKDEQTDLLQL
FT                   ENHLATRVVGQDTALGALAQRLRAAKTGLTSENGPLGVFLLVGPSGIGKTETALALADS
FT                   LFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVE
FT                   KAHRDVLNLFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHLMQLLDEQPEATHSD
FT                   LHELLRPILRDHFQPALLARFQTLIYRPLNAIALRTIVEMKLAQVAKRLNKHYGLHCTI
FT                   EESLYDTLVAACLLPDTGARNIDSLLNQQILPVLSQQLLSRMSEQQRTTSLTLGWDEAD
FT                   GITLEFEGGEK"
FT   gene            complement(181740..182231)
FT                   /locus_tag="YpAngola_A0171"
FT   CDS_pept        complement(181740..182231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05638;
FT                   match to protein family HMM TIGR03344"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87384"
FT                   /protein_id="ABX87384.1"
FT                   /translation="MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDN
FT                   NTGKLTGTSIHTPFVFTKEIDASTPYLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNT
FT                   KLENVKVVKVAPKMHDVKDPAKEKHNHLELVELRYEKITWTFKDGNIIHSDSWNERATA
FT                   "
FT   gene            complement(182235..183971)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0172"
FT                   /note="OmpA domain protein; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF00691"
FT   gene            complement(183971..184657)
FT                   /locus_tag="YpAngola_A0173"
FT   CDS_pept        complement(183971..184657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03349"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86651"
FT                   /protein_id="ABX86651.1"
FT                   /translation="MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQR
FT                   CVADIERVHQALKDAGHSEQSCQHIRYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHF
FT                   FNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLMLGFLGGYASPAASEREQLIDQLS
FT                   VQVPAFSVAPSRGILASAASRNRLGIWLRYWPVRLGLAALMVALLWWGLDHWLSGLLAT
FT                   LLPEPV"
FT   gene            complement(184654..186006)
FT                   /locus_tag="YpAngola_A0174"
FT   CDS_pept        complement(184654..186006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05936;
FT                   match to protein family HMM TIGR03353"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85744"
FT                   /protein_id="ABX85744.1"
FT                   /translation="MKIERPLWTRGVLISPQQFQQQASWEAWTNECIAQMAVMHPWGVL
FT                   QATFELDALAQGRLKAARLHVRFQDGVLVDTECADVLPPTLTLAASLPVEASDATVMLA
FT                   IPQLYANGGNCLQPDERGERPVRHRQAWRDVQNQFGDDKKQVAVMYHQLTLRLDTQENG
FT                   DYQVCPVARLLRDAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQLRARLQRLMGMR
FT                   RESNARMADFAVADVSLFWLLNALNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLTF
FT                   SLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEASLPSRVVAIELVHEPRINQWRATLR
FT                   DPRLREGADFYLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPLSHVP
FT                   AAIPLRLENQYFSLDLSHPAATQMMETGACVFYVPGTLGEIQLELFAVLRA"
FT   gene            complement(186018..187556)
FT                   /locus_tag="YpAngola_A0175"
FT   CDS_pept        complement(186018..187556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05943;
FT                   match to protein family HMM TIGR03355"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85242"
FT                   /protein_id="ABX85242.1"
FT                   /translation="MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIE
FT                   AFQNNDALAEATTDERVTAAVSVFLDLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLD
FT                   AVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELLDISKDHLVQDFEDAPEISQSGLY
FT                   AQTYIQEYDPPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAAHMPFIGSVGPEFFG
FT                   KENMEDVAAIKDIANYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVRS
FT                   FNYVEQVKGPDHDRYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYD
FT                   LGTGNQVKIPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADA
FT                   TANSRINARLPYIFLLSRIAHYLKLIQRENIGTTKDRRLLELNNWVRGLVTEMTDPGDD
FT                   LQASHPLRDAKVTVEDIEDNPGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA"
FT   gene            complement(187605..188105)
FT                   /locus_tag="YpAngola_A0176"
FT   CDS_pept        complement(187605..188105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05591;
FT                   match to protein family HMM TIGR03358"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86893"
FT                   /protein_id="ABX86893.1"
FT                   /translation="MFSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNS
FT                   QEQRPLSEREKLNINKNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEP
FT                   ENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRELENILKDDALSDELRAELAALAP
FT                   KEG"
FT   gene            189360..189488
FT                   /locus_tag="YpAngola_A0177"
FT   CDS_pept        189360..189488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0177"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88362"
FT                   /protein_id="ABX88362.1"
FT                   /translation="MPDSDNVNAHGSAAHVFFTEPVLKNQIFYINISHKNPSDKNE"
FT   gene            complement(190049..190312)
FT                   /locus_tag="YpAngola_A0178"
FT   CDS_pept        complement(190049..190312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0178"
FT                   /product="IS1, transposase orfA"
FT                   /note="identified by match to protein family HMM PF03811"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86750"
FT                   /protein_id="ABX86750.1"
FT                   /translation="MACINVHCPRCDSALVYRHGQNPKGQSRFRCRECRSVFQLTYTYQ
FT                   ARKPEVKGQIVDIAFSGTGVWDTARTLKIGINTVIRTLKNSC"
FT   gene            complement(190380..190568)
FT                   /locus_tag="YpAngola_A0179"
FT   CDS_pept        complement(190380..190568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0179"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87093"
FT                   /protein_id="ABX87093.1"
FT                   /translation="MPVGSGLVLTSDNPERPPGRDELVIKGIPVISGDITFRVSGALFS
FT                   SADKGYFGKEYKLKIAE"
FT   gene            190663..190794
FT                   /locus_tag="YpAngola_A0180"
FT   CDS_pept        190663..190794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0180"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85583"
FT                   /protein_id="ABX85583.1"
FT                   /translation="MGSTSACFISRGLSIIPQPPREIANKFIDIILKNLFIIIYDIF"
FT   gene            complement(191226..191648)
FT                   /locus_tag="YpAngola_A0181"
FT   CDS_pept        complement(191226..191648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0181"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86001"
FT                   /protein_id="ABX86001.1"
FT                   /translation="MQDMLIPGLALLGLTAIFQFFGQPEPWVESLLQPSTFTQILLVIT
FT                   ICVFAPISEEIIFRGFLLNAGIGFGRRGRLLAVVITSLLFALVHTQYLYPATFVSLFVF
FT                   SAILCEVRIRTGSLLMPMVLHSANNIASVAWVLTLS"
FT   gene            193174..193701
FT                   /gene="ytbI"
FT                   /locus_tag="YpAngola_A0183"
FT   CDS_pept        193174..193701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytbI"
FT                   /locus_tag="YpAngola_A0183"
FT                   /product="N-acylhomoserine lactone synthase YtbI"
FT                   /note="identified by match to protein family HMM PF00765"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84884"
FT                   /protein_id="ABX84884.1"
FT                   /translation="MEFDEYDNSDTRYLLGIYQGQLICSVRFIELHLPNMITHTFNALF
FT                   DDVALPKRGYIESSRFFVDKTRAKLLFGNHYPISYLFFLSIINYSRHNGYTGIYTIVSR
FT                   AMLTILKRSGWQVEVIKEAHITEKERIYLLHLPIDRDNQARLLLQVNQRLQDPCSVLST
FT                   WPISLPVMPESA"
FT   gene            complement(193682..194425)
FT                   /locus_tag="YpAngola_A0182"
FT   CDS_pept        complement(193682..194425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0182"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF03472"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88431"
FT                   /protein_id="ABX88431.1"
FT                   /translation="MHSVFNRSNEVIETLRDYIDRKLTIYDSPKYTYMVINKKNPGDIF
FT                   IVTSYPNEWAELYTNNNYQNIDPVVLIAFRRFSPFSWDENITVLSELKLSKIFTLSKKY
FT                   NIVNGFTFVLHDTMNNLAMLSLIMDDSALNGVESRVLNDRDRLQMLLIETHEKMLTLSQ
FT                   RNMNIQERQGKGMPGKAILSPRENEVLYWASMGKTYQEIAIITNITPRTVKYHIGNVVK
FT                   KLGVINAKQAIGLGVELEIIKPILA"
FT   gene            complement(194705..195913)
FT                   /locus_tag="YpAngola_A0184"
FT   CDS_pept        complement(194705..195913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0184"
FT                   /product="IS285, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87330"
FT                   /protein_id="ABX87330.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            196310..197650
FT                   /locus_tag="YpAngola_A0185"
FT   CDS_pept        196310..197650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86649"
FT                   /protein_id="ABX86649.1"
FT                   /translation="MLTRRKFLMMSAGAGLLLSVPMLARTGVQPAQAATAITQVFGDGI
FT                   RLTAVAVEYPTEVSAEGLNPADFHVEGRTVTGVWTSTSTNPADIAPSGRYMIIALSPDD
FT                   KNATLAEQVQPNSKNNSNKSANGRGGPGNAGDIPAYDTVYRTAQATVLRLPSVHTASGD
FT                   TLPASEKALTTQYVENLIVDDFQQLEFYDEKTGKKLKYNLFIPKDYSPDKAWPLVLFMH
FT                   DAGATSDVTRTTLYQGLGAIAWASPEDQAQRPCFVLAPQYEEIIADDDSKTSDMLDTTI
FT                   DLINVLSEQYNIDKSRIYATGQSGGCMMTIAMNIKYPDFFAASFLVAGQWDPALVKPLA
FT                   QQKLWILVSQDDNKAWPGQNAIIDVLEKEGVQISRAIWDGTWNEEQFRQAFEQIEAEKS
FT                   PINYVAFREGTVIPEGQSTEGASGHRNTWRIAYTISPIREWIFRQQR"
FT   gene            197851..197970
FT                   /locus_tag="YpAngola_A0186"
FT   CDS_pept        197851..197970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85265"
FT                   /protein_id="ABX85265.1"
FT                   /translation="MKFIIFFIKKDNKNTIKNIFSFNYIDFEWLFLKATEGMH"
FT   gene            198027..198860
FT                   /locus_tag="YpAngola_A0187"
FT   CDS_pept        198027..198860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0187"
FT                   /product="dioxygenase family protein"
FT                   /note="identified by match to protein family HMM PF00775"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85694"
FT                   /protein_id="ABX85694.1"
FT                   /translation="MTNKIMPKVNREGRRSFLQKSIAVVATGVVTHAFSAPNITLEKDT
FT                   KPQPGTCILSVEQMAGPYIKSNMPIRRNIAENENGVPLLLKITVIDSNSCRPLEYYYVD
FT                   IWQCNARGRYSGWSYVDPDKDAPSGEVASINRTDEKSFLRGSQVTDSHGLVRFTSIYPG
FT                   FYAGRAVHIHFAIKPPKASPQEVDKYSFISQLYFPEEFNSEIEQRAEYSLRKIKRLINS
FT                   DDEIFNEANGENAVLAVSKINENDINDGVLAEITIAINKDILSKRIDPKDILKIT"
FT   gene            complement(199150..200373)
FT                   /locus_tag="YpAngola_A0188"
FT   CDS_pept        complement(199150..200373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0188"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87460"
FT                   /protein_id="ABX87460.1"
FT                   /translation="MRISSESDARSSGLTSSTHWPLAFCVGLLGIGQNGLLVVLPVLVS
FT                   RTHLSLSVWAGLLTLGSMLFLVGSAWWGRQSEIRGCKFVVIMALAGYLLSFVLLALAVW
FT                   GLSAGWLSEMAGLGWLIVARIIYGLTVSGMVPASQTWALQRAGYEQRMAALATISSGLS
FT                   CGRLLGPLCAALALSIHPIAPLWLMAIAPLIALLVVYRQYNDPPLPPVVHQQNRLRLNM
FT                   LPYLLCALLLAATVSLMQLGLAPHLSRLFSHSATTVSHHVAILLSIAAGCTLLAQFLVV
FT                   RPQRFTPPQLLLVAALLMVLGLGLMCVQPLVLFYLGCALASFGAAMATPGYQLMLNDRL
FT                   STGKGSGVIATSHTLGYGMSALMVPVVAKFYGESQLVAAAFMMAILLGGISGWLWCQHR
FT                   TTAHSVGE"
FT   gene            200282..200413
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0189"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of sequencing error"
FT   gene            200513..202284
FT                   /pseudo
FT                   /gene="iucA"
FT                   /locus_tag="YpAngola_A0190"
FT                   /note="aerobactin siderophore biosynthesis protein IucA;
FT                   this gene contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            202268..203218
FT                   /gene="iucB"
FT                   /locus_tag="YpAngola_A0191"
FT   CDS_pept        202268..203218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iucB"
FT                   /locus_tag="YpAngola_A0191"
FT                   /product="aerobactin siderophore biosynthesis protein IucB"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88136"
FT                   /protein_id="ABX88136.1"
FT                   /translation="MGPHAKLIHSGGSFYCEHLGKALTLGLGLDGSAVLHLPGPLPPGW
FT                   LVQALDQLFIAAPQLTGIALPYAEWRDAPQAMALFALISSDYVAREIFYQLPLWLGAER
FT                   NRTAGQMQYDTERHLWYPQRPPRPDGEVYRRFDPNIKRTLSFRLPEVDHDAPQFTRWMN
FT                   SPRVDAFWEMSGPLDVQAAYLQRQLDSPYCYPLLGCFDDQPFGYFEVYWAAEDRIGRHY
FT                   RWQPFDRGLHMLVGEENWRGAQYIHSWLRGLTHYLYLDESRTTRVVAEPRIDNQRLFHH
FT                   LPAAGYHTLKEFDFPHKRSRLIMNQRADFFREGTR"
FT   gene            203215..204963
FT                   /gene="iucC"
FT                   /locus_tag="YpAngola_A0192"
FT   CDS_pept        203215..204963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iucC"
FT                   /locus_tag="YpAngola_A0192"
FT                   /product="aerobactin siderophore biosynthesis protein IucC"
FT                   /note="identified by match to protein family HMM PF04183"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85408"
FT                   /protein_id="ABX85408.1"
FT                   /translation="MITTDYANWQQVNRHMIAKILSELEYERTLHAELHGETGRITLPG
FT                   AVYTFNGKRGIWGWLHIDPATLRCEGVPLAADHMLRQLALVLKMDDSQVAEHLEDLYAT
FT                   LRGDMQLLSARHGMSAEALIALNDDALQCLLAGHPKFIFNKGRRGWGLTALQHYAPEYQ
FT                   GQFRLHWVAAKRGSFIWCVDAEYPLDNLLNSAMDPAERQRFDRRWRECQLNDDWVPVPL
FT                   HPWQWQQKIALHFLPQLAEGELIELGEFGDHYLAQQSLRTLTNVSRRVPFDIKLPLTIY
FT                   NTSCYRGIPGKYISAGPAASRWLQQVFAQDRTLHESGAEILGEPAAGYMLHQTYATLAK
FT                   APYRCQEMLGVIWRENPSCYLREGEHAILMATLMETNNQGHPLIAAYIARSGLSAEAWL
FT                   EQMFRVVVVPMYHLMCCYGVALIAHGQNITLVMKDHAPQRILLKDFQGDMRLVDKDFPQ
FT                   AASLPNVVKDVTVRLSADYLIHDLQTGHFVTVLRFISPLMQACNLSEYRFYQLLAQVLE
FT                   RYMAQHPDLADRFTLFNLFKPQIIRVVLNPVKLTYSEQDGGSRMLPDYLQDLDNPLYLV
FT                   TKELAQ"
FT   gene            204960..206289
FT                   /pseudo
FT                   /gene="iucD"
FT                   /locus_tag="YpAngola_A0193"
FT                   /note="aerobactin siderophore biosynthesis protein IucD;
FT                   this gene contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            206361..208541
FT                   /locus_tag="YpAngola_A0194"
FT   CDS_pept        206361..208541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0194"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85977"
FT                   /protein_id="ABX85977.1"
FT                   /translation="MKHKHLWVLNPCLLVMLTPAAWAEDQLVVSANRSHRSVAEMAQTT
FT                   WVIEGQELEQQVQGGLEIKDILAQLIPGIDVSSQGRTNYGMNMRGRSIMVMIDGVRLNS
FT                   SRSDSRQLDSIDPFNIAHIEVISGATSLYGGGSTGGLINIVTKKGQEGKQVELQIGGKT
FT                   GFNSHNDHDENISAAMSGGTERAFGRFSVSYQRYGGGYDGKGNEVLIDNTQTGLQYSNR
FT                   LDVMGTGTLNIDENQQLQLTTQYFNSESDGKHGLYLGQNFSAVTGTGQASNSAALNSDR
FT                   IPGTERHLINLQYSNTDFWGQDLVAQVYYRDESLTFYPFPTLKDGKVSTIGASQQKTDF
FT                   YGSKLTLNSEPIDSLTLTYGIDLEHESFNANQQFFNLAKAQQSGGMTLENAYNVGRYPS
FT                   YTTTNLAPFLQTRYDINPIFTLSGGVRYQYTENKVDDFVGYAQQQAIASGSATSADPVP
FT                   GGKTDYNNFLFNAGLLAHLTESQQTWFNFSQGFEIPDLAKYYGSGSYTLVNGHYQLQNS
FT                   VNVNDSKLEGIKVDSYELGWRYTGDNLRTQMAGYYSLSDQTISINKTDMTINVLPDKRR
FT                   IYGVEGAVDYFFDNSEWSAGATFNLIKSETKVSGKWQKLTIDAASPSKATAYIGWAPGD
FT                   WNLRVQSQQTFDVSDSKGDKIDGYNTIDFLSSYALPVGKLSFSIENLLDKEYTTVWGQR
FT                   APILYSPTYGSPNLYSYKGRGRTFGVNYSVLF"
FT   gene            complement(208800..210224)
FT                   /gene="gph1"
FT                   /locus_tag="YpAngola_A0195"
FT   CDS_pept        complement(208800..210224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph1"
FT                   /locus_tag="YpAngola_A0195"
FT                   /product="sugar (Glycoside-Pentoside-Hexuronide)
FT                   transporter"
FT                   /note="identified by match to protein family HMM TIGR00792"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86059"
FT                   /protein_id="ABX86059.1"
FT                   /translation="MSLDSQHLCSLKDEGDKRLKINMNNSGMKIPMKELASYFGYGMGQ
FT                   CFSFGLVGTFILFFYTDIMGISPVAASMIFLIARVWDAIHDPLIAGVMDTINMRRGKFR
FT                   PYLLFTPFLIFLVTVAAFYNIEASLMTKTIYAGVTYILWGTLYALSDIPFWSMSTVMTD
FT                   EPQERAKTATCAMLGVNAGIGATMILFPYISGLFAENSADRGYFAGVVILMVLGVILML
FT                   NGFFNTKERVNVTVTEKVTLKQTFIVVWQNKPLFFILSAFFMNVFSNIVNTFYIFFFTY
FT                   NMGDAELVSVIGLITFTCALACLGTPFLTRHFKKRDLFITLCVLEIIARVGFWFTGYNN
FT                   VVSVMVWLTVITAIFMMTNPLISAMIADTVEYSYYHTGKRCAAITFSGQTFVGKLSVAV
FT                   AGGVSGLILSILGYMPNVAQSTWTLNGLFFCISLLPAVGAVVRILIMRKYKFTEDEHAI
FT                   LREELKQGRFHSSVGK"
FT   gene            complement(210472..211257)
FT                   /locus_tag="YpAngola_A0196"
FT   CDS_pept        complement(210472..211257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0196"
FT                   /product="Integrase core domain protein"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87813"
FT                   /protein_id="ABX87813.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDS
FT                   ATVLKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   gene            complement(211311..211826)
FT                   /locus_tag="YpAngola_A0197"
FT   CDS_pept        complement(211311..211826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0197"
FT                   /product="transposase, IS3 family"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88223"
FT                   /protein_id="ABX88223.1"
FT                   /translation="MKHPFSTRLAAVQHYLSGKATLRETARQFSVGKSPLTRWIRAFRR
FT                   QGEAGLEHHLSRTYTPEFRLCVVRYMMANRCSAADASAHFNIPNETIIQNWMKRYREGG
FT                   KEALNPSKTGPTMPKDKYEHDSKPFSEMTHAELEKELEYLRAENAYLKKRKALREEKAL
FT                   REQQKKPE"
FT   gene            212997..213465
FT                   /pseudo
FT                   /gene="pcP"
FT                   /locus_tag="YpAngola_A0198"
FT                   /note="outer membrane lipoprotein PcP; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(214396..214869)
FT                   /locus_tag="YpAngola_A0199"
FT   CDS_pept        complement(214396..214869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0199"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86536"
FT                   /protein_id="ABX86536.1"
FT                   /translation="MIYQLTKKQDVFLDGEKVDLSNITLWQRLKSITGGKITTKDSQEV
FT                   KFAYVLDYAGSEFAAVPIQGLRLEGNTNYFYKKFTKEYKISTPKLLHYGSDTIKNITLH
FT                   GRSNVSFFMDNGGRNAPTAAAKYNKNTGEISLIKSMHELSKSMQDIKNSGART"
FT   gene            complement(215452..216363)
FT                   /gene="motB2"
FT                   /locus_tag="YpAngola_A0200"
FT   CDS_pept        complement(215452..216363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB2"
FT                   /locus_tag="YpAngola_A0200"
FT                   /product="flagellar motor protein B"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87454"
FT                   /protein_id="ABX87454.1"
FT                   /translation="MRNHASGGATTIIKRANRKKHHVRHSGAWKVAFADFTLAMMALFM
FT                   VLWIVGVVSEEERQEIVAQLNGKTIFAQQSFISIPSKSKSGGGKLSNSIDGKEQAKETK
FT                   SNLAIEVPEPEQSLEEVVDKSRHEMEELSRIIMQITSAYNAQSNLQMEVVPQGLRILIQ
FT                   DDQQRDMFQRSSAVLTPFFSRLLGELAPAFNEMDNKIIITGHTDASRYRDQLLYNNWNL
FT                   SGERALMAHKALVNGGLDEGRVLQINAMADQMLLDPTDPLAAKNRRIEIMVLTKTASDT
FT                   LYQFFGHHGENVVKPAAEKAEK"
FT   gene            complement(216363..217229)
FT                   /gene="motA2"
FT                   /locus_tag="YpAngola_A0201"
FT   CDS_pept        complement(216363..217229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA2"
FT                   /locus_tag="YpAngola_A0201"
FT                   /product="chemotaxis protein MotA"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86832"
FT                   /protein_id="ABX86832.1"
FT                   /translation="MQKLFGLLVIMGCVIGGYLMSGGSLSSFWQPGEIIIIFGSGIGAL
FT                   ILGNPGSVLQEMWHQILAVARRSEYTVEFQQQLLLLLYELLEMVDEGGLKRLDEHIEIP
FT                   ANSSVFQRYPLILQDLHLITFISDNFRLMAMGKINQHELESILEQELSAVEEELLVPSR
FT                   SFQRIGEAMPGFGICAAVLGIIITMQSIDGSIAMIGIKVAAALVGTFLGVFICYCLMDP
FT                   LSNAMEQEIKKKLALFECVRMVLVNHVAGKPSLLAVDAGRKMLPMDNKPTFATLDSWIN
FT                   KLITAGV"
FT   gene            complement(217245..217940)
FT                   /gene="fliA2"
FT                   /locus_tag="YpAngola_A0202"
FT   CDS_pept        complement(217245..217940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliA2"
FT                   /locus_tag="YpAngola_A0202"
FT                   /product="flagellar operon sigma factor , sigma-28"
FT                   /note="identified by match to protein family HMM PF04539;
FT                   match to protein family HMM PF04542; match to protein
FT                   family HMM PF04545; match to protein family HMM PF08281;
FT                   match to protein family HMM TIGR02479; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87123"
FT                   /protein_id="ABX87123.1"
FT                   /translation="MENREFEACLTLTAEEEGKYLNAYLPLVKRIVRQLSFQADSVIGK
FT                   EDMQQIALMGLLEALRRYGHPDGQFAAYAVHRIRGSILDQLREHDWRPRRLRQKTHKTN
FT                   EAIRQIAKRLGHEPNFEEISAELNLTADEYQEYLLLENAGAMESLDEILALEAHNDILQ
FT                   SRDLEENIIIEDNLKQAISTLDEREQMILHLYYQQELSMKEIAQVLDLTEARICQLNKK
FT                   LVQKIKSFF"
FT   gene            complement(217946..218416)
FT                   /locus_tag="YpAngola_A0203"
FT   CDS_pept        complement(217946..218416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0203"
FT                   /product="putative flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87778"
FT                   /protein_id="ABX87778.1"
FT                   /translation="MKTKKKVFSPKIRAFLLLISGMAAVFLFSRESVLKQMGYQPATVS
FT                   QSFTRGNKAVQFVEIKNMVITLKDNNTERYLQLELGMATGDDKDIKNVIAMVPVIQATT
FT                   VNLLSSMDYQAVRHTSILDLRRQLMNEYKQDFAGLNVPMPFDDVVISRMVFQ"
FT   gene            complement(218455..219540)
FT                   /gene="fliK2"
FT                   /locus_tag="YpAngola_A0204"
FT   CDS_pept        complement(218455..219540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliK2"
FT                   /locus_tag="YpAngola_A0204"
FT                   /product="flagellar hook-length control protein"
FT                   /note="identified by match to protein family HMM PF02120"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88271"
FT                   /protein_id="ABX88271.1"
FT                   /translation="MITLNTTTLNTLSQVTDSFAPTKEEIKVPATARPEGVSVSNLANF
FT                   DAVLSQALVPHQPISLSPAAVEEVIAAFDAEGTVDSHEADLTLSADEQNQQLLDTLLQT
FT                   QPANVSPMALKPAVQSQAFQPVRSEGEQPTPLSDSVPVSLSTPERSLTQNESLFPLLRN
FT                   GPSASQVQIDSPVQIGSPVQIDSPVQIDRHVQINSPIQIGSPVLNGSHETSTASRIDSP
FT                   LTLANNREEWPQQLRMALGERLQVQADNRVQHATIRLDPPDMGKIDISIHFEGGKLQVN
FT                   INANQGEVYRALQQSSAELRQTLIGQNSTEVNVQVSANSQQQQQQPRHSNHHGQADILA
FT                   AQHFESQAEINADDGTLLITI"
FT   gene            complement(219542..219868)
FT                   /locus_tag="YpAngola_A0205"
FT   CDS_pept        complement(219542..219868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0205"
FT                   /product="putative flagellar protein lafD"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87829"
FT                   /protein_id="ABX87829.1"
FT                   /translation="MTILATAEALSGELESASQSKDWPRLLLLDERVAHLLVSIAKQKL
FT                   SSDCVQSLKLLQQSHQRAIQRCQAYQQVLKADMEQMRNRQEGISAYAAMAIRAYQDMAQ
FT                   EEGR"
FT   gene            complement(219870..220250)
FT                   /gene="fliS1"
FT                   /locus_tag="YpAngola_A0206"
FT   CDS_pept        complement(219870..220250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS1"
FT                   /locus_tag="YpAngola_A0206"
FT                   /product="flagellar protein FliS"
FT                   /note="identified by match to protein family HMM PF02561;
FT                   match to protein family HMM TIGR00208"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88278"
FT                   /protein_id="ABX88278.1"
FT                   /translation="MMYDEPMAGLYQQTDIAIQAAATPHKLVMMLFDGLRDELICAKGH
FT                   IEAGRYEHKVKSINKCINILNGLTSVLNYEDGGDLSVTISKLYDYCVYRLYEASNLLSI
FT                   EIIAEVEGILAALYQGWEGMKH"
FT   gene            complement(220260..221537)
FT                   /gene="fliD1"
FT                   /locus_tag="YpAngola_A0207"
FT   CDS_pept        complement(220260..221537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD1"
FT                   /locus_tag="YpAngola_A0207"
FT                   /product="flagellar hook-associated protein 2"
FT                   /note="identified by match to protein family HMM PF02465;
FT                   match to protein family HMM PF07195; match to protein
FT                   family HMM PF07196"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87755"
FT                   /protein_id="ABX87755.1"
FT                   /translation="MITVEPEKQAAFSADKTVFRKRNRLEAQQKQINSQKVSSNKLQTS
FT                   VTDFRSALNQLNQRDSGLLKIKTTSSDDKLVSASATAQAVKGKYHLFVEQLAKTDQIAL
FT                   KGITDNQLTLAAGPIDLSVGKTTLTVDLTSVNSLEELANAINNASDKAKNSDGQGITAS
FT                   LVRTGSDVVLTLSSNKSGAAHKLDVSKLTTKISAATEQQLAAGQDAIVWLGEQNKGIKI
FT                   THDTNVLDKAIQGLTLSLQKEKVAVEVGVEIDNEASEEQLKTFVSKFNQLQKLVESSSS
FT                   VPNASAISTLLNNIIRSPIDGERIYAFGVTSGRDGELTIDSKQLQQTLSSNTQHFNEFF
FT                   NGKNGVVNKLTEALEPYINVTSGLFKLDNDRLSLDITAIEKELKVVKDDYDNAYDKYLV
FT                   VYTGIRNMLTKMNATLELFKPEKEQK"
FT   gene            221948..223156
FT                   /locus_tag="YpAngola_A0209"
FT   CDS_pept        221948..223156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0209"
FT                   /product="IS285, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86667"
FT                   /protein_id="ABX86667.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            complement(223119..224285)
FT                   /locus_tag="YpAngola_A0208"
FT   CDS_pept        complement(223119..224285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0208"
FT                   /product="lateral flagellin"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM PF00700"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85268"
FT                   /protein_id="ABX85268.1"
FT                   /translation="MSLSIHTNASAKTAINSLSNAGLANAKSSQRLSTGFRINSPADNA
FT                   AGLQITNRMEKFLNSAGQAKQNIQESIAMLQIADGGLAESVKTLNAMKKLATQAANDTN
FT                   SAADREAIQKEFSELGKELQNALNNTEYNSEKLFADGGKMRKELNFQSGTDAESSLKLD
FT                   LNSVIAELTESVTKQAPKITGKSSSATGSLEKQAYDLDKAVTDTKSLVAGAEGVQKTLE
FT                   HDFAASGNKAVAEIKIPEYKDALGKTVPEVVIALGAVITSANSNQMKDAVAALKTTHDA
FT                   AVKAEATFQAKNSTGGGVMNMQLADKDLAMKADKKLSDVIDAYGAFRATLGANQNRLQS
FT                   SSNNLDNMISNTAQALGSIKDTDFASLSIILCNCHRIKGDRSGGHRTR"
FT   gene            complement(224567..225766)
FT                   /locus_tag="YpAngola_A0210"
FT   CDS_pept        complement(224567..225766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0210"
FT                   /product="lateral flagellin"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM PF00700"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86102"
FT                   /protein_id="ABX86102.1"
FT                   /translation="MSLSIHTNASAKTAINSLSNAGLSNAKSSQRLSTGFRINSPADNA
FT                   AGLQITNRMEKFLNSAGQAKQNIQESIAMLQIADGGLAESVKTLNAMKKLATQAANDTN
FT                   SAADREAIQKEFSELGKELQNALNNTEYNSEKLFADGGKMRKELNFQSGTDAESSLKLD
FT                   LNSVIAELTESVTKKATPVKADVAGSTLEKEADVLDKATKAAKKAKEAAEGVQKTLETD
FT                   FAVAGNKASAKITIPEYKDALGKTVPEVVINSGTAITPANSTQMKDAVAALKATHDAAV
FT                   KAEATFQAKNSTGGGVMNMQLADKDLAMKADKKLSDVIDAYGAFRATLGANQNRLQSSS
FT                   NNLDNMISNTAQALGSIKDTDFADEMKNHAQSEMLMQSSVMMLKKANAATQLISTLLQG
FT                   "
FT   gene            complement(226279..227475)
FT                   /locus_tag="YpAngola_A0211"
FT   CDS_pept        complement(226279..227475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0211"
FT                   /product="lateral flagellin"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM PF00700"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87629"
FT                   /protein_id="ABX87629.1"
FT                   /translation="MSLSIHTNGSAKTAINSLSKAGLANAKSSQRLSTGFRINSPADNA
FT                   AGLQITNRMEKFLNSAGQAKQNIQESIAMLQIADGGLAESVKTLNTMKKLATQAANDTN
FT                   SAADREAIQKEFTELGQELQNALNNTEYNAEKLFADGGKMRKELNFQSGTDANSSLKLD
FT                   LNKVIEELTESVTEERKKVTGTSASATGSLEKQAFDLNEATTKANTALKEAEILQEKIT
FT                   TNLTKTFPASVDIPGYINAKGVPVAHEIIPSGTPINTGHIGKIQTAVAALRATHDTAAK
FT                   TEDEFQAEHSTGGGVMNLLLRNKDRAMEADKKLSDVIDAYGAFRATLGANQNRLQSSSN
FT                   NLDNMISNTTQALGSIKDTDFADEMKNHAQSEMLMQSSVMMLKKANAATQLISTLLQG"
FT   gene            227807..227968
FT                   /locus_tag="YpAngola_A0212"
FT   CDS_pept        227807..227968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0212"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86852"
FT                   /protein_id="ABX86852.1"
FT                   /translation="MGILPKRAFRGRPCPLTLPSLLVGNIPDCAQHQNQNPICKFWFYL
FT                   LILKTHLS"
FT   gene            complement(228034..229239)
FT                   /locus_tag="YpAngola_A0213"
FT   CDS_pept        complement(228034..229239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0213"
FT                   /product="lateral flagellin"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM PF00700"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88332"
FT                   /protein_id="ABX88332.1"
FT                   /translation="MSLSIHTNASAKTAINSLSNEGLANAKSSQRLSTGFRINSPADNA
FT                   AGLQITNRMEKFLNSAGQAKQNIQESIAMLQIADGGLAESVKTLNAMKKLATQAANDTN
FT                   SAADREAIQKEFSELGKELQNALNNTEYNSEKLFADGGKMRKELNFQSGTDAESSLKLD
FT                   LNSVIAELTESVTKPGLKANSGGTAEEKELARLEGLAKDAKSTAATTKSAETTLLVDDA
FT                   TGKGGKGGNASIDIIIPAHKDTTGKDVAEKKIASGTAITPANITSMADAKAYWDKQEIE
FT                   TPKAVNEYVVKHSADSGVMNMQLADKDLAMKADKKLSDVIDAYGAFRATLGANQNRLQS
FT                   SSNNLDNMISNTAQALGSIKDTDFADEMKNHAQSEMLMQSSVMMLKKANAATQLISTLL
FT                   QG"
FT   gene            229864..230910
FT                   /locus_tag="YpAngola_A0214"
FT   CDS_pept        229864..230910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0214"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85453"
FT                   /protein_id="ABX85453.1"
FT                   /translation="MHTIIEKNMNKQSHIVNGWLIDLTSGFITHQETREKKRLGEYQLK
FT                   LINVLLEHAGEILSRDELTNLVWKRRVIGNNSLPNAIHTLRVALGDENKQQRIIQTIPK
FT                   IGYLLDASFCEIIDATKETETAEQTALAQTDDEEIVAPLNGVTLHEAVAASASDIAHSR
FT                   IAETNEEPADTAINAPLPPTQTGPVVMTRQHVTASQRPPWNIFSYWSRVAIALLVLITA
FT                   VAFYRLFPQNKGVSYTAIEQDQEAYSNIRLFQLVDSALSLQQEEKLNQRLKDTLYAINK
FT                   QSKAKSMSINIYYYVSLRRLDFTFSVESQCENKQLGMTIYHWRQNSQLLNNLIYREMER
FT                   KINEMVNC"
FT   gene            230891..231337
FT                   /locus_tag="YpAngola_A0215"
FT   CDS_pept        230891..231337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85047"
FT                   /protein_id="ABX85047.1"
FT                   /translation="MKWLTASNGILLSILGLFLSLAALASSEGKKKPTLADAQLQMGFY
FT                   DLLSQQKEIYDARITATQGGVISTITSPNDNRFIFKGKFTEQTTQNSQLSFSYSPIFFN
FT                   NPTSGRMIEGFLDYLMHNTVFMTPMVVEGQPLLVGQSGIVLGEK"
FT   gene            complement(231501..232514)
FT                   /locus_tag="YpAngola_A0216"
FT   CDS_pept        complement(231501..232514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0216"
FT                   /product="putative flagellar hook associated protein lafW"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85843"
FT                   /protein_id="ABX85843.1"
FT                   /translation="MQVGLNRPQWEVANKTSLPDFDRLQGANSLSLIKKEVDFPESPFI
FT                   SSQPLRYNVQLNRQLTALQRAEGYLHTTERQVAQLQRALQQERAETEIKPLALKTLHWL
FT                   QQRTAMSGNAVDRQLNFVPEQRTEVNFALHGAEQLLQPAESETLLFSLTGNGYNVVAVN
FT                   LPAYASPAQNLLRLNNGLGRLGIHGRLDPQGNAQFHVDEKRWAEIESHLQVRGGGGRFA
FT                   KESFQPLKLQPEVVLEDRVRDIAAKPQEAKKHLAGIQQAMGQITGQMRKLSEHKRNTGV
FT                   QINSMSSFSAPNSALMAAEALAEKLLQGRSQYAMWANMLTAQGNARSAMVRNLLGG"
FT   gene            complement(232526..233449)
FT                   /gene="flgL2"
FT                   /locus_tag="YpAngola_A0217"
FT   CDS_pept        complement(232526..233449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL2"
FT                   /locus_tag="YpAngola_A0217"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="identified by match to protein family HMM TIGR02550"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85534"
FT                   /protein_id="ABX85534.1"
FT                   /translation="MRVSTPTMSSTMNRFITQHNEKLEKINKQMMTQQRITLPSEDPIA
FT                   STRLLQINREQANIKQYSSNISGLSNSLTNQTGHVSAINKQLVSIKSSLVSINGNIKSN
FT                   KDIAGVADELNYMLESVVAGLNAKNSEGRYLFAGTASNKQPITFDSAKNKYTYVGNSDN
FT                   RQTGVGEGVKITENVHLQSGFTDTSGDLATLNKLKKLCDNIKKTILPAAVASHTAAIDE
FT                   MMGLIDNASDHMGVTLTELGIRQKHSQLLQKNHEEMELSNATIQENLVGLDLAESYMEL
FT                   MNLMAVTNANYTTFKQINSLSLFNLI"
FT   gene            complement(233478..234839)
FT                   /gene="flgK2"
FT                   /locus_tag="YpAngola_A0218"
FT   CDS_pept        complement(233478..234839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK2"
FT                   /locus_tag="YpAngola_A0218"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR02492"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86957"
FT                   /protein_id="ABX86957.1"
FT                   /translation="MNFIRTAFSGMQATQAHLNATSMNIANMHTPGYSRQRAEQSAIGA
FT                   DGQGGVNAGNGVNVDGIRRLSQQYVVMQEWRANSQQQYYDAGEQYLNAVELMVSNESTS
FT                   LATGLNNFFSSLSAATQLPDSPPMRQQIIESANAMALRFNNVNNFIVQQKKSIGQQRDI
FT                   TVKEINSLTRSIADYNQQILKNRSDGNNINDLLDKQELQIKKLSGLIETQVNQAEDGTY
FT                   RISVKQGQPLVNGAVAAELAVDTSSVDTKITLHFSGATQGMNMSCGGQLGGINDYELTT
FT                   LKKLQDSTQEMAKTVADKFNDQLGKGTDFTGAPGQDLFVFNPSDPNGMLQLSAITAEQL
FT                   ALAAHGKPAGDNSNLFELLDIRKTPVTGMKNVPLDDAATALVGYIAITSNRNHSELENA
FT                   ENTLNQATRYHESFSGVNNDEEAMNLMEYQRAYQSNMKVIATGDKLFSDLLALV"
FT   gene            complement(234952..235245)
FT                   /locus_tag="YpAngola_A0219"
FT   CDS_pept        complement(234952..235245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0219"
FT                   /product="putative lateral flagellar peptidoglycan
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86619"
FT                   /protein_id="ABX86619.1"
FT                   /translation="MIEAINKSSPVIPGSFVGDLQPQDLEQAAVQFEAVFMRTLLQQMR
FT                   KAAEVLAADDDPFNSKQQRMMRDFYDDKLASTLASQRSSGIANLLIQQLGSK"
FT   gene            complement(235255..236430)
FT                   /gene="flgI1"
FT                   /locus_tag="YpAngola_A0220"
FT   CDS_pept        complement(235255..236430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI1"
FT                   /locus_tag="YpAngola_A0220"
FT                   /product="flagellar P-ring protein FlgI"
FT                   /note="identified by match to protein family HMM PF02119"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87618"
FT                   /protein_id="ABX87618.1"
FT                   /translation="MFLNRIHFSALMRFFSVSIRFLSVLIKTRHCFVLLGLWLVLPTAS
FT                   AQPLGSLVDIQGVRGNQLVGYSLVVGLDGSGDKNQVKFTGQSMANMLRQFGVQLPEKMD
FT                   PKVKNVAAVAISATLPPGYGRGQSIDITVSSIGDAKSLRGGTLLLTQLRGADGEVYALA
FT                   QGNVVVGGIKAEGDSGSSVTVNTPTVGRIPNGASIERQIPSDFQTNNQVVLNLKRPSFK
FT                   SANNVALALNRAFGANTATAQSATNVMVNAPQDAGARVAFMSLLEDVQINAGEQSPRVV
FT                   FNARTGTVVIGEGVMVRAAAVSHGNLTVNIREQKNVSQPNPLGGGKTVTTPESDIEVTK
FT                   GKNQMVMVPAGTRLRSIVNTINSLGASPDDIMAILQALYEAGALDAELVVI"
FT   gene            complement(236444..237109)
FT                   /gene="flgH2"
FT                   /locus_tag="YpAngola_A0221"
FT   CDS_pept        complement(236444..237109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH2"
FT                   /locus_tag="YpAngola_A0221"
FT                   /product="flagellar L-ring protein FlgH"
FT                   /note="identified by match to protein family HMM PF02107"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87089"
FT                   /db_xref="GOA:A9R6X4"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R6X4"
FT                   /protein_id="ABX87089.1"
FT                   /translation="MKRFLILTPMVLALCGCESPALLVQKDDAEFAPPANLIQPATVTE
FT                   GGGLFQPANSWSLLQDRRAYRIGDILTVILDESTQSSKQAKTNFGKKNDMSLGVPEVLG
FT                   KKLNKFGGSISGKRDFDGSATSAQQNMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQGD
FT                   EYMRVTGLVRADDVARDNSVSSQRIANARISYAGRGALSDANSAGWLTRFFNHPLFPI"
FT   gene            complement(237144..237929)
FT                   /gene="flgG1"
FT                   /locus_tag="YpAngola_A0222"
FT   CDS_pept        complement(237144..237929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG1"
FT                   /locus_tag="YpAngola_A0222"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR02488"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88673"
FT                   /protein_id="ABX88673.1"
FT                   /translation="MNSALWVSKTGLAAQDAKMGAISNNLANVNTDGFKRDRVVFADLF
FT                   YQNQRTPGAPLDQNNTTPSGIQFGSGVQIVGTQKQFTVGNIKVTKGDMDVAITGQGFFQ
FT                   IETADGGIAYTRAGNLTTNADGVLVNAQGMPLIPQIELPTGSKQLHIGKDGTVTATVGG
FT                   ETEPVEVGQITLVNFINPAGLEAIGGNLYRETAASGEAVEGVPGEEAFGQLEQGALEGS
FT                   NVQVVEEMVDMITVQRAYEMNAKMVSAADDMLKFVSQKL"
FT   gene            complement(237997..238728)
FT                   /gene="flgF1"
FT                   /locus_tag="YpAngola_A0223"
FT   CDS_pept        complement(237997..238728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF1"
FT                   /locus_tag="YpAngola_A0223"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM TIGR02490"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88117"
FT                   /protein_id="ABX88117.1"
FT                   /translation="MDKLLYTAVSGANRSLSQQQIHANNLANSNTQGFRADLEKATATQ
FT                   VMGGGYSSRVAVLSQNAGVDMTPASLQETGRDLDIALKNQGLIAVLSGGREAYTRNGQM
FT                   DVSAEGALTINGLPVLGDGGPIVLPPYSALSIADDGTIAIIPQAGGSKTPEEIERIKLV
FT                   DIPANQLRKNNRGLLVSNRGPAARDETVQVVNKHLESSNVSAISEMIASISLSRQFEAQ
FT                   IKMMKVAEDLAQAGNRMIRGS"
FT   gene            complement(238728..239969)
FT                   /locus_tag="YpAngola_A0224"
FT   CDS_pept        complement(238728..239969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0224"
FT                   /product="flagellar hook protein"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM PF07559"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87844"
FT                   /protein_id="ABX87844.1"
FT                   /translation="MSFSIANTALNAHTEQLNTISNNIANSATKGFKASRTEFSSMYAQ
FT                   SQPLGVAVSGVSQNISKDGQKEKTGMGLDLAISGGGFFVVRESSGDKAYTRAGMFRSDV
FT                   DGYLVNGQGMKLQGYPADAAGNIQAGIISDLKINNAGVPAKASEQLDFMANLNASVTAP
FT                   SVSVFNPTNEKSYNFTTTSTVYDSLGREHAVAHYFVKSTTPPAGSVASEWAVHHTVDGG
FT                   TATPPLTLQFTDTGALIPGIPAAGSGMKGSAINLHGTFNPAGAADYDIDIDYTGTTQLS
FT                   QGFTTTRNKSDGYTSGVKNAERIESDGSVYATFSNGERVLQGKVVLANFASPSGLVTQN
FT                   GTSWSESNKSGAALLGTPGTGLLGSLESGALENSNVDITAELVGLMTAQRNYQASTKII
FT                   STNDSMMNALFQVL"
FT   gene            complement(240024..240680)
FT                   /gene="flgD2"
FT                   /locus_tag="YpAngola_A0225"
FT   CDS_pept        complement(240024..240680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD2"
FT                   /locus_tag="YpAngola_A0225"
FT                   /product="basal-body rod modification protein FlgD"
FT                   /note="identified by match to protein family HMM PF03963"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87685"
FT                   /protein_id="ABX87685.1"
FT                   /translation="MQINESRNSANVGNQSPAPEGGLPGGEQLNNQFMTLLVAQIKNQD
FT                   PLNPADGTEFVSQMAQLSQVQATENMAKLLKSNTVQMAKMQTMATANLVGQQVMVEGHE
FT                   ITLGKDPVAGRLTLKQPAPTLLLHITDILGQEKVIDLGKQPAGPVNFTLDPAAAKLQPG
FT                   QYQLSAVSGSGEELIPLEVAGKVNNVRISPQGGAPQLNITGLGEVSYSQITQFGA"
FT   gene            complement(240683..241108)
FT                   /gene="flgC2"
FT                   /locus_tag="YpAngola_A0226"
FT   CDS_pept        complement(240683..241108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC2"
FT                   /locus_tag="YpAngola_A0226"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="identified by match to protein family HMM PF06429;
FT                   match to protein family HMM TIGR01395"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85715"
FT                   /protein_id="ABX85715.1"
FT                   /translation="MSFNQIYRVAGSAMTAQTIRLNTIASNLANAESPAASAATVYKAR
FT                   SPVFSAVYSARTAADPRGVQSAQVQVLDVVEVGGSVQRYEPNHPMANPQGYVFYPAVNV
FT                   VSEMADMMSASRSFETNVEVLNSVKSMQQSVLKLGER"
FT   gene            complement(241111..241557)
FT                   /gene="flgB"
FT                   /locus_tag="YpAngola_A0227"
FT   CDS_pept        complement(241111..241557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="YpAngola_A0227"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM TIGR01396"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85293"
FT                   /protein_id="ABX85293.1"
FT                   /translation="MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDF
FT                   AAEMQRAKRGNGVMAAPDRSSAQMLSTQMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQP
FT                   SLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK"
FT   gene            241615..242463
FT                   /locus_tag="YpAngola_A0228"
FT   CDS_pept        241615..242463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0228"
FT                   /product="flagella basal body P-ring formation protein
FT                   FlgA"
FT                   /note="identified by match to protein family HMM PF08666;
FT                   match to protein family HMM TIGR03170"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86545"
FT                   /protein_id="ABX86545.1"
FT                   /translation="MQLTCQVYNIIINSIFYFYCSPKWKVNFRLSVTFSIRVRHCLQSL
FT                   LICGALLCANTISAAENNTRKQVYTQALHAATADIAQTAKNKNWQGYSVKMNIFIPAEI
FT                   SRYKPCQKALQVALPTAETQHLSRLRYEISCPDGQGWEVVATVKPDIYLPIWVAKQTLE
FT                   RGRKVQADDIELKKKNITGVQGGYITDPDEILGLTIKRRIRQLQAVIPSQLEQPVLVTR
FT                   NQHVLMLAAQDGIEAQMLGIAQKNGRKGELIKVKNLSSGRVVTATVDGSGRVRMLGLST
FT                   P"
FT   gene            242965..243390
FT                   /locus_tag="YpAngola_A0229"
FT   CDS_pept        242965..243390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0229"
FT                   /product="putative flagellar protein FlgN"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86111"
FT                   /protein_id="ABX86111.1"
FT                   /translation="MEPTQRVKQLLIDIQEDRKRYIALEKLLIKQRELMIGHKTEALEA
FT                   LNPQLTELYSVLDNTATERRLLMQQLQLPANKEGIHQLLSRLPAHYREHAGALWADLRL
FT                   RAHACHQQNHHNGMLLTQQIALLSSLAEQPTEFLYAG"
FT   gene            complement(243718..244155)
FT                   /gene="fliJ2"
FT                   /locus_tag="YpAngola_A0230"
FT   CDS_pept        complement(243718..244155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliJ2"
FT                   /locus_tag="YpAngola_A0230"
FT                   /product="flagellar export protein FliJ"
FT                   /note="identified by match to protein family HMM TIGR02473"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86369"
FT                   /protein_id="ABX86369.1"
FT                   /translation="MSDMIDTLQQLQQLRQRSLNQVTSQLTQQKQLCQRYQRNINALNA
FT                   LTLSEEAFPGVSALQMANHAGYQRHIQRLIDWQKQEQALADIEVGNLQTQMQQQARREK
FT                   IVAVVLEQQQEEYQREQGRLAQKNTDALATQCWQRQQAGDI"
FT   gene            complement(244159..245328)
FT                   /locus_tag="YpAngola_A0231"
FT   CDS_pept        complement(244159..245328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0231"
FT                   /product="flagellum-specific ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM TIGR01026"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85822"
FT                   /protein_id="ABX85822.1"
FT                   /translation="MSESPALDHALKSIENIHLARVAGRLVRVTGLLLESVGCRLAIGQ
FT                   RCRIESVDETFIEAQVVGFDRDITYLMPFKHPGGVLGGARVFPSEQDGELLIGDSWLGR
FT                   VINGLGEPLDGKGQLGGSTPLQQQLPQIHPLQRRAVDTPLDVGVNAINGLLTIGKGQRV
FT                   GLMAGSGVGKSVLLGMITRYTQADVVVVAAPADESPLMRIKATELCHAIATYYRDKGHD
FT                   VLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFSIIPRLAESAGNSSGNGTMTAIY
FT                   TVLAEAGHYPAIDISQSISRCMSQVIGSQQAKAASLLKQCYADYMAIKPLIPLGGYVAG
FT                   ADPMADQAVHYYPAITQFLRQEVGHPALFSASVEQLTGMFPSFAPTDEA"
FT   gene            complement(245321..246037)
FT                   /gene="fliH1"
FT                   /locus_tag="YpAngola_A0232"
FT   CDS_pept        complement(245321..246037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH1"
FT                   /locus_tag="YpAngola_A0232"
FT                   /product="flagellar assembly protein FliH"
FT                   /note="identified by match to protein family HMM PF02108"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87717"
FT                   /protein_id="ABX87717.1"
FT                   /translation="MLIKNTPRAGAVKLRVHQFPPLRKVRQVAPSAADQTLDPAEYQKQ
FT                   LMAGFQEGISQGFDKGLAEGKEEGYQEGVRLGHDDGLKKGRIEGRQSELASFNDVIKPF
FT                   SGYITQLHTYLETYEQRRRDELLQLVEKVTRQVIRCELALQPAQLLTLVEEALAALPMV
FT                   PQQLKVYLNPAEFGRINDVAPEKVQAWGLAADPDMVGGECRIVTETTEIDVGCQHRLDQ
FT                   CIGALHSSFLTEPHHE"
FT   gene            complement(246042..247085)
FT                   /gene="fliG2"
FT                   /locus_tag="YpAngola_A0233"
FT   CDS_pept        complement(246042..247085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG2"
FT                   /locus_tag="YpAngola_A0233"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="identified by match to protein family HMM PF01706"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87192"
FT                   /protein_id="ABX87192.1"
FT                   /translation="MNESNLNLNDDSSVKSDTKGRSRLEQASILLLSIGEEAAAMVMQQ
FT                   LSREEVVCVSQMMSRLHNIKLDQARQALDDFFQDYREQSGINGASRSYLQAILNKALGN
FT                   DIAKSVINGIYGDEIRHRMTRLQWVDTPQLVALIDQEHLQLQAVFLAFLPPDVAAAVLA
FT                   YLDKDRQDDILYRIAKLDDVNRDVVDELDRLIERGVAVLSEHGSKVIGIKQAANIVNRI
FT                   PGNQQQLLDQLGERDEEVLNELKDEMYEFFILSRQSEATLQRLMDLIPMSDWAIALKGT
FT                   EPALRQAIYDVLPKRQIQQLQNATQRTGAVPVSRVEHIRKVIMAQVRELAEAGEIQVQL
FT                   FAEQTME"
FT   gene            complement(247057..248697)
FT                   /gene="fliF2"
FT                   /locus_tag="YpAngola_A0234"
FT   CDS_pept        complement(247057..248697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF2"
FT                   /locus_tag="YpAngola_A0234"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="identified by match to protein family HMM PF01514;
FT                   match to protein family HMM PF08345; match to protein
FT                   family HMM TIGR00206"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84912"
FT                   /protein_id="ABX84912.1"
FT                   /translation="MLDKIKQKLSPGQLGENTKTILMSAVALLVTAAIIFSLWRSSQGY
FT                   TALFGSQENIPITQVVEVLEGEAIAYRINPDNGQVLVAENQLGKARILLAAKGITATLP
FT                   IGYELMDKESMLGSSQFIQNVRYKRSLEGELAQSMMALSAVEYARVHLGMSEASSFAIS
FT                   NHADNSASVVLRLRYGQTLSTEQVGAIVQLVAGSIPGMKPANVRVVDQHGELLSQAYQA
FT                   NSEGVPSVKSGTELAHYLQSTTEKNIANLLNSVIGANNYRISVSTQLDMSRIEETAEHY
FT                   GPDPRINDENIQQENSNDDMAMGIPGSLSNQPIPQSQAGQTPAAVSRSQAQRKYIYDRN
FT                   IRHVRYPGYKLEKMTVAVVLNKSLPVLEQWTPEQQEELKRLIEDAAGIDVKRGDSLTIN
FT                   MMAFAVPTLIDEPVMPWWQEPSTFRWAELLGIGLLSLLVLWFGVRPLMKRYSRKGSENL
FT                   PLAISSASADEALDHVDTGVDGAESSPRTENAFSASSLWKSDDLPEQGSGLETKIAHLQ
FT                   QLAQSETERTAEVIKQWINSNERIKSQPE"
FT   gene            complement(248707..249087)
FT                   /gene="fliE2"
FT                   /locus_tag="YpAngola_A0235"
FT   CDS_pept        complement(248707..249087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE2"
FT                   /locus_tag="YpAngola_A0235"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="identified by match to protein family HMM PF02049"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88281"
FT                   /protein_id="ABX88281.1"
FT                   /translation="MDNIDSINMPRSQSPVMLEMRQMAAMAGSGLEFGTIQPAATNSPF
FT                   FPVEKGANNLSFSQVLNGAIKSVDQLQHVASEKQTAMDMGISDDLTGTMLASQKASVAF
FT                   SAMVQVRNKLTSALDDVMNTAL"
FT   gene            complement(249104..250132)
FT                   /locus_tag="YpAngola_A0236"
FT   CDS_pept        complement(249104..250132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0236"
FT                   /product="sigma-54 dependent transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88083"
FT                   /protein_id="ABX88083.1"
FT                   /translation="MMNINVDVFPKNDHGFVANAPSSVSVFSLARRVAEFNVPVLVTGE
FT                   TGTGKECVAKYIHQKAMGDASPYIAVNCAAIPESMLEAILFGYEKGAFTGAIASVAGKF
FT                   EQANGGTLLLDEIGDMPLALQVKLLRVLQEQEVERLGGHKPIPLDIRIIASTNKDLSVE
FT                   IAEGRFRQDLYYRLSVVPIHILPLRERPEDILPLVKAFINKYQSFLNVKIDITAEAQCE
FT                   LYKYTWPGNVRELENVIQRGIIMSNNGVIELPSLGLPMAQGISSPVGETSLPFSTIQPP
FT                   DGENNIKLRGRLAQYQYIVDLLQRHQGNKSKTAAFLGITPRALRYRLANMREDGIDIEC
FT                   HS"
FT   gene            250655..251555
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0237"
FT                   /note="lateral flagellar export/assembly protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            251548..251961
FT                   /gene="fliN2"
FT                   /locus_tag="YpAngola_A0238"
FT   CDS_pept        251548..251961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN2"
FT                   /locus_tag="YpAngola_A0238"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM TIGR02480"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86581"
FT                   /protein_id="ABX86581.1"
FT                   /translation="MTDQQIELNNDLDFTLALDESAISPTEHFDSVINSPEIINTPEKT
FT                   ATKTDEQKRKMSLFSRIPVTLTLEVASVEIPLSELLTVNNDSVIELDKLAGEPLDIQVN
FT                   GIMFGQAEVVVINEKYGLRIININSQNLGELAL"
FT   gene            251958..252728
FT                   /gene="fliP1"
FT                   /locus_tag="YpAngola_A0239"
FT   CDS_pept        251958..252728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP1"
FT                   /locus_tag="YpAngola_A0239"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="identified by match to protein family HMM PF00813;
FT                   match to protein family HMM TIGR01103"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84896"
FT                   /protein_id="ABX84896.1"
FT                   /translation="MSRSLRAITPVTIISRGLLVGGLLYSPLLLAQEGGITLFNTVQTA
FT                   TGQDYNVKIEILILMTLLGLLPIMMLMMTCFTRFIIVLAILRQALGLQQSPPNKVLTGI
FT                   ALALTLLVMRPVWTKIHQDAVIPFQQDEITLSQALGRAEAPLKNYMLAQTSTKSLDQMM
FT                   AIAQVSGEPQQQDLSVVTPAYVLSELKTAFQMGFMIYIPFLVIDLIVASILMAMGMMML
FT                   SPLIVSLPFKLMLFVLCDGWTLMVGTLTASVQGL"
FT   gene            252730..253002
FT                   /gene="fliQ2"
FT                   /locus_tag="YpAngola_A0240"
FT   CDS_pept        252730..253002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ2"
FT                   /locus_tag="YpAngola_A0240"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="identified by match to protein family HMM PF01313;
FT                   match to protein family HMM TIGR01402"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86474"
FT                   /protein_id="ABX86474.1"
FT                   /translation="MMTTDIAGDIIAMGLHLVLMISIVAIVPSLLIGLLVSIFQATTQI
FT                   NEQTLSFLPRLVMTMLVLIFAGKWMMIKLSDFTVSIFQQAAQLVG"
FT   gene            253003..253782
FT                   /gene="fliR2"
FT                   /locus_tag="YpAngola_A0241"
FT   CDS_pept        253003..253782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR2"
FT                   /locus_tag="YpAngola_A0241"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="identified by match to protein family HMM PF01311;
FT                   match to protein family HMM TIGR01400"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86254"
FT                   /protein_id="ABX86254.1"
FT                   /translation="MPMGIDIHAMTAPLFALWLPFVRILSFLHFCPVIRHKAFTRKAKI
FT                   GTALLLAILITPMISQPVVSGELLSIENLLLAGEQILWGWLFGSMLHLVLAALEAAGQI
FT                   LSMNMGLGMAMMNDPTSGASTAVISQIIFTFSVLIFFTLNGHLLFVTILLKSFSSWPIG
FT                   EAINDFSLRSLALSLGWILSSATLLALPTTFIMLIVQGSFGLLNRISPTLNLFSLGFPI
FT                   GMLFGLLCLLLLAINIPDHYLHLTNEILTQFERMKVH"
FT   gene            253782..254915
FT                   /gene="flhB2"
FT                   /locus_tag="YpAngola_A0242"
FT   CDS_pept        253782..254915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB2"
FT                   /locus_tag="YpAngola_A0242"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="identified by match to protein family HMM PF01312;
FT                   match to protein family HMM TIGR00328"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87668"
FT                   /protein_id="ABX87668.1"
FT                   /translation="MSNSSGEKSEKPTAGKLSKARKKGDIPRSKDVTMAAGLVTSFILL
FT                   SLFLPYYKALVSQSFVSVAQLASQLDDQGALEQFLLANLFIFAKFLATLIPIPLFSMLA
FT                   TLIPGGWNFTPVKLIPDLKKLSPLAGIKRIFSASNGTEVLKMLAKCSIVLYTLYLVVHS
FT                   SLDDLLHLQTLPLEEAITQGFAQYHHILLYFIAIVVVFAAIDIPLSHHLFTKKMKMTKQ
FT                   EVKQEHKNNDGNPEIKSRVRQLQRQYAIGQINKTVPSADVIITNPTHFSVALKYAPEKA
FT                   SAPYIVAKGKDDIALYIRSIAQKHKIEIVEFPPLARAIYHTTKVNQQIPAQLYRAIAQV
FT                   LTYVMQIKSWRSGQASKPVLNTHLGLPKEMQRFHDET"
FT   gene            254902..256998
FT                   /gene="flhA2"
FT                   /locus_tag="YpAngola_A0243"
FT   CDS_pept        254902..256998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA2"
FT                   /locus_tag="YpAngola_A0243"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="identified by match to protein family HMM PF00771"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86507"
FT                   /protein_id="ABX86507.1"
FT                   /translation="MMKHKLYDISRLLKETHIAVPVLLLCVLAMVILPLSPLVLDILFT
FT                   FNIVMAVLVLLVSVNSKRPLDFSILPPILLIATLMRLTLNVASTRVVLLNGHEGADAAG
FT                   KVIEAFGQVVIGGNFVVGFVVFIILMIINFVVVTKGAERVSEVSARFTLDALPGKQMAI
FT                   DADLNAGLINQEQASIRRKEVASEADFYGAMDGASKFVRGDAVAGMMILVINVIDGICI
FT                   GIFKYDLSASQSFQQYVLLTIGDGLVAQIPSLLLATAAAIIVTRVSDGGDMTDEVKDQL
FT                   LAKPTILYAAAFVMFILAIVPGMPHLAFLSFTGLLLFAARQQSKKIQQADLNPDFTALN
FT                   PVISDENALSISWDSIPAVEPIGLNLGYKLVTLVDESKGKPLNQRLRGVRQIISESSGV
FT                   LLPEVRVRENFRLKPSQYTININGVRIAGGEVHVDKLMAIPTTQQYGEVDGILATDPTY
FT                   GLAIVWIDPQEKPQALNLGYQVVDCASVVATHVNKVVREHLSELFNYDDITLLHQRLAA
FT                   LSPRLAEDLVTTLNFSQLLKVYRQLLTENVSLKDIVTISTTLLDSVTVTKDALLLTSDV
FT                   RYALRNGIVNSINGDDKDLAVYTINNELENMLLSSLNQAQQAGKVVLDNFPVDPNILTQ
FT                   LQQNLPIIKEQMKAENHQPILLVTPQLRPLISRYARLFCSGLNVLSYNEIPDDMNLNVI
FT                   GVLE"
FT   gene            257573..257752
FT                   /locus_tag="YpAngola_A0244"
FT   CDS_pept        257573..257752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0244"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86839"
FT                   /protein_id="ABX86839.1"
FT                   /translation="MITPARTGNTTQYKTMLLGLSPGGKVLVWLQDEGGPQNNRVPIVN
FT                   INTLSGDKLAICKS"
FT   gene            complement(257844..258551)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0245"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(258592..258840)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0246"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            259084..259212
FT                   /locus_tag="YpAngola_A0247"
FT   CDS_pept        259084..259212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0247"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88091"
FT                   /protein_id="ABX88091.1"
FT                   /translation="MIEKQSFSPYFYVKYIFTNNHAITIDLLNVIYTLINFQRTCY"
FT   gene            259476..259595
FT                   /locus_tag="YpAngola_A0248"
FT   CDS_pept        259476..259595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0248"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88464"
FT                   /protein_id="ABX88464.1"
FT                   /translation="MTYPINSLEMNNKKILLLIMMFITIISLYCPRRTLRAMS"
FT   gene            259695..260774
FT                   /locus_tag="YpAngola_A0249"
FT   CDS_pept        259695..260774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0249"
FT                   /product="ferrienterobactin-binding periplasmic protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85025"
FT                   /protein_id="ABX85025.1"
FT                   /translation="MFLYMTYIERKIRHSLFISLGCLGLILSLSGCEPAEETNFHPFPI
FT                   DENHSTSSPWSRTVDTVKGPVTLTHKPARIVSTSITITGTLLAINAPIIASSATEPNTT
FT                   LADNKGFFTQWSDIARARHLIPMYQTEPNIKAVAKMRPDLIIISATGDDSTLELYDQLS
FT                   AIAPTLVINYDDKSWQELTLQLGQATGHEGDAEQVIDKFARRLNEVKQKITLPPQPVSA
FT                   FVYQEVSGSAKLWTENSAQGRLLLELGFTLANVPDTLKDNTHTEHRKDIIQLGGDELAQ
FT                   GLNGKTILLFSGVHSAIDALKSNKFLTNLPAIQHDNVYAAGYDTFRLDYYSANNLLTRI
FT                   ESMFKGKKDSEPTYHESRT"
FT   gene            complement(260986..262092)
FT                   /locus_tag="YpAngola_A0250"
FT   CDS_pept        complement(260986..262092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0250"
FT                   /product="fimbrial family protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86163"
FT                   /protein_id="ABX86163.1"
FT                   /translation="MKKNIFLTLRSERYKAGLLLLLLLLLCTTSKPSFAALQVNSCSLA
FT                   VSGAGGETPFVIKALPVTLTNGFVLGSMNFSVVTTFTKTGTTADYLYLGGWSMLAGGAV
FT                   MPVSTGVPGVKMSVNVSDALFGGYEWGNTEKATQSLFVPGTKITIANRVTVQLIVTDAS
FT                   VYQGGVINWFNVARSFALVSGNAQVWSTKSVATGGSRCGDMVTFNIGSTNIVLPPPTVA
FT                   TCDLGATDIVVALDPIDTSSLQTQGDRAGGQAFSIPLGSCAKDAKPYITFTDSSNKANR
FT                   TNILSLSPSSTATGVGLVLEKSDGNLVTFGAENASVSASNVGQFLIGTSTAAGGSMPLN
FT                   LTARYIRAEGVLKSGNVKADAIFTVAYP"
FT   gene            complement(262117..262836)
FT                   /gene="papD"
FT                   /locus_tag="YpAngola_A0251"
FT   CDS_pept        complement(262117..262836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="papD"
FT                   /locus_tag="YpAngola_A0251"
FT                   /product="chaperone protein PapD"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85860"
FT                   /protein_id="ABX85860.1"
FT                   /translation="MKKLSLIALTSTVVFTSYTANAAIALDRTRIIYNGQDKSISLNIS
FT                   NENKTLPYLAQAWIENEQQQKVTTPLVATPPVQRVEAGKKSAVRISATPEALKLPQDRE
FT                   SLFYFNLREIPPRSEKSNVMQIALQTKIKLFYRPEGITPATGQIWQEQLVLHKTAQGFR
FT                   LENPTPYYITVVGLAEKGKSSADSNFQPLMVAPKSSAELKSASFTAPVLTYINDYGGRP
FT                   ELSFSCSGSTCRAAKAI"
FT   gene            complement(262854..265334)
FT                   /locus_tag="YpAngola_A0252"
FT   CDS_pept        complement(262854..265334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0252"
FT                   /product="fimbrial usher protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86506"
FT                   /protein_id="ABX86506.1"
FT                   /translation="MRIIKKIPIAMTTSLIMLSGAVSAIDFNTDAMDANDKQNIDLSHF
FT                   TNVGYIMPGEYRLEINVNNHRIPEQVIAFYARDDEPNSSEVCLPEAVVEQFGLKPDVLQ
FT                   KITFWHEGQCADLRELAGLTTEVDLATSTLAINVPQDWMEYSDSNWVPSSQWDEGIPGS
FT                   LLDYNVNSLFSKPKESGSTRNISLNGTSGLNAGPWRLRGDYQGNYSHNSGEQNSSTSTF
FT                   DWSRIYMYRAIKSLAATLSVGENYFASSLFDTFRYAGASLSSDERMLPPNLRGYAPEVS
FT                   GIARTNAKVTVSQQGRILYQTTVASGPFRIQELSDSVSGRLDVSVEEQDGTVQTFQVET
FT                   AAVPYLTRPGAIRYKTSVGQPSTLNHGTEGPVFASGEFSWGVSNRWSLFGGAIGSGDYN
FT                   AVSVGVGRDLYAFGAISTDITQTRASGLPNQETQSGKSLRVRYAKRFDELNSDISLAGN
FT                   RFFEREFMSMNQYLGTRYFDNDLGRNKEMYTVTASKNFPDIQTNINFSYSYQNYWDQPT
FT                   SNSYSATVSHAFDAFSLKDMTVNLSASRSKNNGVNDDVLYLSFSVPLGNQQTLSYSGQH
FT                   NGQGNNQTVNYSNSSAIDSSYRLSAGVNNSNDNGARGQFSGFYIHRSSIAETSLNVAYA
FT                   QDDFTSTGVSMRGGATVTAKGAALHGPGMSGGTRLMVNTDDIAGVPLEERNIRSNRFGI
FT                   AVLNNINSYYRTDTRIDINQLADDVEVKQSAVEFALTEGAIGYRRFAMMKGEKVLATIS
FT                   LTDSSHPPFGSLVISAKGQELGIVSDDGFTYLSGVEPGETLDVVWSGAKQCQVAIPAVI
FT                   QPQAQILLPCISVN"
FT   gene            complement(265687..266196)
FT                   /locus_tag="YpAngola_A0253"
FT   CDS_pept        complement(265687..266196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0253"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87868"
FT                   /protein_id="ABX87868.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            266486..266767
FT                   /locus_tag="YpAngola_A0254"
FT   CDS_pept        266486..266767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0254"
FT                   /product="type IV prepilin peptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88421"
FT                   /protein_id="ABX88421.1"
FT                   /translation="MHHTVSIIIPIVALFIGYIIFHFNVMGGGDVKLITVLLLALTAEQ
FT                   SLNFIIYTAVMGGVVMVVGLLINRVDIQKRGVPYAVAITAGFLSSVLI"
FT   gene            266819..267685
FT                   /locus_tag="YpAngola_A0255"
FT   CDS_pept        266819..267685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87893"
FT                   /protein_id="ABX87893.1"
FT                   /translation="MNRKFLILFSLLIVAIGISGILLNPDKEIPELLTQTEKRKERNIV
FT                   LAQTRHDLTAGTLISKEDYSLQNITVDESNDLVKNDLSHGHRIDGDSIADDRTHDHKLD
FT                   GHLLKNNILAGSYIIDEMLISPDSREFSRLNLKHGEIIYKFYITEKNEYLLNTLNPGDF
FT                   LSFQLLTLETNKTKGMENGIAIDSKSMSSKQRQKYSLNNVIPDMPILSIKTYSPEELSV
FT                   KNNKNNKTEEYSLGYIEVIMKIQDLEFIHTVEKAGEVFLTPKSGDHKRIDLDDIIPTLQ
FT                   TIRELRG"
FT   gene            267682..268536
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0256"
FT                   /note="type II/III secretion system protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            268551..269000
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0257"
FT                   /note="outer membrane secretin family protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            268997..269287
FT                   /locus_tag="YpAngola_A0258"
FT   CDS_pept        268997..269287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86187"
FT                   /protein_id="ABX86187.1"
FT                   /translation="MKWIFIIMAILFSTRGITAFTIKPSANEYSYVLIGEYFTNKTEKH
FT                   PFPLKLNNSLPLELNCNYMKNDYRNKNNDVHGCAVYKNRHYAIIESWNKHL"
FT   gene            269298..270425
FT                   /locus_tag="YpAngola_A0259"
FT   CDS_pept        269298..270425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86728"
FT                   /protein_id="ABX86728.1"
FT                   /translation="MQLILNKDLINKKDNREKSAVVIISTRKGLKDKISEYVRLADIKN
FT                   IKEIDDDIFSAASILIPDNVKGIIIDINENHDINTILDLMKVHTPRDCWCILVGDIDSI
FT                   SIAQQFIERGILYLHIQSQLADLTQNLLKGIQIESDRKAFFISILGCRGGIGTTLLSYQ
FT                   LAHVITQIKKSPTLLLQGNQGSQDLDLITEKKMGEDITGYQKNFDLMRGNERKLSEVNE
FT                   HNNKKHNFIIFDQPIHNARKEKTLDYISNSNCIILLIDHSMMSVRVAKEFIDTLKRFKR
FT                   DNRQAIRLFICLNENRPITKDMLTTSDIQSLLGHSIDTAIPYINNAKNSLNSPDYFGRK
FT                   KTKVVELAKQSLGININLSSHTNMWIREKLNKLFK"
FT   gene            270437..271723
FT                   /locus_tag="YpAngola_A0260"
FT   CDS_pept        270437..271723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0260"
FT                   /product="type II/IV secretion system protein"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85116"
FT                   /protein_id="ABX85116.1"
FT                   /translation="MIVPLKIQELMRERMLANIDINKVELLVGDRNKLIGLLSQTFDDL
FT                   FNNNEYNLTTQAQKYIIEMIADEITGFGPLRELMEDDSISDIMVNGPERIFIERYGLLK
FT                   LTDRRFVNNTQLTDIAKRLMQKVNRRIDEGRPLADARLIDGSRINVAISPIALDGTALS
FT                   IRKFSKNKRRLEDLVDMGAMSSDMANFLIIAASCRVNIIISGGTGSGKTTLLNALSKYI
FT                   SEDERVITLEDAAELNLEQPHVVRMETRLAGLENTGQITMRDLVINSLRMRPDRIIIGE
FT                   CRGEETFEMLQAMNTGHNGSMSTLHANTPRDAVARLESMIMMGPVNMPLITIRRNIASA
FT                   INLIVQVSRMNDGSRKIRNISEIMGMEGEHVVLQDIFTFQPASTRDDQGRIQGEFINHG
FT                   LFNRSSVRINADIHNLANELNSVFSTVSK"
FT   gene            271720..272595
FT                   /locus_tag="YpAngola_A0261"
FT   CDS_pept        271720..272595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0261"
FT                   /product="type II secretion system protein F domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85619"
FT                   /protein_id="ABX85619.1"
FT                   /translation="MIYYVVALSGILLLVLNNLKWMKIKRSISNTKKSKAKSTSSITIL
FT                   IKKIFFEWIDYVSTHSKSTPHILLPICSLVIVYYINSTWINVNYSFVFIINIIFIIVLQ
FT                   LKYARSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRL
FT                   NLGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQK
FT                   KAVMTAQIRMSVNIISIMPMLFSFLLYLLDPTTIEFVWQHPTGRFIIYYIIISEVIGIL
FT                   IIRKMLGKSL"
FT   gene            272592..273425
FT                   /locus_tag="YpAngola_A0262"
FT   CDS_pept        272592..273425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0262"
FT                   /product="type II secretion system protein"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87860"
FT                   /protein_id="ABX87860.1"
FT                   /translation="MRIIFFTLLILLGLIIILKVNSRSRRISVYNKINSRENKSKEANN
FT                   DTKDKPTVLSDFIKLPVFLSNILYLKVLIVIFILSILTILAIFNVVNINQKTLLTIGLL
FT                   SIISTLYLPRMIIKNALTKRTNNLLKSLPFFIDITAACVQSGMTIENSLNYTTQKFQTI
FT                   NTDLCLIMSKVTKRAEINGLENAIKELQYYSPAIEMKMFCSTLQYSISFGSTVYEQLTH
FT                   LSQDMREMQLLMTEESISKLSTKLTLPLFLFILIPFVLLVISPSILELLNYVKNI"
FT   gene            273409..274179
FT                   /locus_tag="YpAngola_A0263"
FT   CDS_pept        273409..274179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0263"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87957"
FT                   /protein_id="ABX87957.1"
FT                   /translation="MLKIFNTIIIIPVMIFLLSGCLSQQGLSSQGLSTKEFSYRESILI
FT                   KANNQIGLIKLYRESLKNKEDESIRVKLANAYYLSGDSHSSLYYLQPISHKPNVSIYLL
FT                   QIKNLINEGYNSGATTVLHRLLSIAPHNPEAHNLKGIILANRGDTAGARTAIVQSQALF
FT                   IQEDIARNNIAVISMLDNRYEDAVKILLPDYLSGKRNNLILHNLVFALIKMGDTRYAKN
FT                   IIEAERLSDNADELVLALSQVDSFPQEQSFIREK"
FT   gene            274179..274649
FT                   /locus_tag="YpAngola_A0264"
FT   CDS_pept        274179..274649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0264"
FT                   /product="TadE-like family protein"
FT                   /note="identified by match to protein family HMM PF07811"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85608"
FT                   /protein_id="ABX85608.1"
FT                   /translation="MRDTILRLLPANRGSIAVEFTLIFILFIFMLLLVAETSRLFYTSA
FT                   NLDFALSEAAKTAKNRDAENVLSYQQLFEHNFNRQVTVLGSLINTAPSAELTVNFSHSV
FT                   ADLINGNSEENNHTLPLAHYQVRLHYQPIFLPFPQAWVNTLLSREVIFVQEK"
FT   gene            274633..275205
FT                   /locus_tag="YpAngola_A0265"
FT   CDS_pept        274633..275205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0265"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85158"
FT                   /protein_id="ABX85158.1"
FT                   /translation="MFRKNNTLINNQGGAIIVEFAFVTFIIVLFIKLLIAIAEYQSISG
FT                   KLDRLSYSAAGIIRERGRLYPHDPELNQQQVDQLRDLVQRALLNSGVPADNLRMRVETL
FT                   HFNPIEPPGSRQQQIDEHKSLSFSTGDCSPVQPLRGLVALSPLSQSERWVPLYQVTICL
FT                   PPPQRYRDLISVSPLPTLKSSAITIGR"
FT   gene            275230..276786
FT                   /locus_tag="YpAngola_A0266"
FT   CDS_pept        275230..276786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86727"
FT                   /protein_id="ABX86727.1"
FT                   /translation="MQKKTMITFILEKYEFFIKNRQGAILLSFMALIPVFIGLIFLSFE
FT                   FSHFIQKRAKLSDALEQASLALSTENNYRNDRASNNRNNYLVTSYAQSYLPSERFSQPR
FT                   VVNTYNESLGYTEYNASLQMNYQLALLNSYLKQTPSPTWDVNENGAARKYLSSIAEPID
FT                   VVFVTDFSGSMDLPFGDIERNNRITKLDELKAIFVKLNNRIFSNDGINTIGFVPFSWGT
FT                   KRISANGQVSSTYCHFPYSPKKIDGNGHYLQRYTASNLKNIPGLDNLSGIDNLAYGQLD
FT                   EDKHHAILSEIEKKHRDNEIPTKTRDQAKNFLDKAYKVNQISTITKIVEEHIDYKETIN
FT                   SIDRNGETIDIPMDDILDPFFCLKETNAKSLNFDPNSKGDINEILNMKAEGGTLASSGI
FT                   LVGNKMLTESQNNNKLMIILSDGDDNTQKMSSPHDQKAGIINITQKLITEGMCQKIKDN
FT                   GIKMVFIGIGYVPDNNIIDWEKDCVGTGNFYLAKNAHELEISIERALVVDDEVGRNIPK
FT                   S"
FT   gene            complement(276883..277314)
FT                   /gene="exbD"
FT                   /locus_tag="YpAngola_A0267"
FT   CDS_pept        complement(276883..277314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD"
FT                   /locus_tag="YpAngola_A0267"
FT                   /product="tonB system transport protein ExbD"
FT                   /note="identified by match to protein family HMM PF02472;
FT                   match to protein family HMM TIGR02803"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86309"
FT                   /protein_id="ABX86309.1"
FT                   /translation="MAMRMNDSLDESGELHEINVTPFIDVMLVLLIIFMVAAPLATVDI
FT                   KVDLPASSAVPQPRPEKPVFLTVKADNQLYVGDQPVDRETLATALDKVTQSNKETTIFF
FT                   QADKVVDYETLMSVMDALRKSGYLKVGLVGMEAGSSGAK"
FT   gene            complement(277318..278310)
FT                   /gene="exbB"
FT                   /locus_tag="YpAngola_A0268"
FT   CDS_pept        complement(277318..278310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB"
FT                   /locus_tag="YpAngola_A0268"
FT                   /product="tonB-system energizer ExbB"
FT                   /note="identified by match to protein family HMM PF01618;
FT                   match to protein family HMM TIGR02797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85888"
FT                   /protein_id="ABX85888.1"
FT                   /translation="MQGRVMKGVMVLLLATGLAGHAQAAPGNGSAVAATVTAPTAATST
FT                   PLPAPEITSVAAIPESTPESVLTSALTSESIPAPMVQPVTAPVPQKLAMDLSVWGMYQN
FT                   ADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLRQEHEVIGAVTDLDTASERAED
FT                   FGQGSVSSLLLHEALNERLLSIESNDNNGIKERTAFRLERRVAAIGRQMGKGNGFLATI
FT                   GAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVIAPGIAEALLATALGLVAAIPAVVIY
FT                   NIFARQIGNYRAQVGDVAAQVLLLLSRDLDLASSAEVKSPRHPHQLRAG"
FT   gene            278828..280039
FT                   /gene="metC1"
FT                   /locus_tag="YpAngola_A0269"
FT   CDS_pept        278828..280039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC1"
FT                   /locus_tag="YpAngola_A0269"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM TIGR01324"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87380"
FT                   /protein_id="ABX87380.1"
FT                   /translation="MAVNKAIPEKLETALVSAGRSKKFTQGSVNTVIQRASSLVFESVK
FT                   AKKHATINRGNGELFYGRRGTLTHFSLQEAMTELEGGAGCVLYPCGAAAISNAILSFVA
FT                   TGDHVLMTGSAYEPAQSFCDKILSRMNITTTYFDPMIGAGIASLITPKTKVIFLESPGS
FT                   ITMEVQDIPAMVAAIRAVAPDVVIMMDNTWAAGVLFKALDFDIDISIQSGTKYIIGHSD
FT                   AMLGIAVANARCWEQLREDSYLMGQMVDADTAYLASRGLRTLSVRLKQHEKNSIEIANW
FT                   LAERPEVAVVYHPALPGCKGHEFYKRDFNGCNGLFSFELKEELTQQQLENYLDHFTHFS
FT                   MAFSWGGFESLILGYQPKDIRAIRKYDAEGIKGTLFRLHIGLENVQDLQDDLAAGFERI
FT                   QAVK"
FT   gene            280232..280894
FT                   /locus_tag="YpAngola_A0270"
FT   CDS_pept        280232..280894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0270"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87772"
FT                   /protein_id="ABX87772.1"
FT                   /translation="MDVLREILHALWQQDFSKLADPNVIWVIYGILFTTLFLENGLLPA
FT                   SFLPGDSLLLLAGALIAKGVMGFLPTLIILTTAASLGCWLSYLQGRWLGDTSVVKRWLL
FT                   QLPLQYRQRAHTLFVRHGLAALLVGRFLAFVRTLLPTLAGISGLNSIRFQLFNWLSGLL
FT                   WVGSVVGLGFALSHIPLVKQYENQVMTALMILPIVLLLAGLVGTLILVWCKRKSTTE"
FT   gene            281232..282389
FT                   /locus_tag="YpAngola_A0271"
FT   CDS_pept        281232..282389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0271"
FT                   /product="alcohol dehydrogenase, iron-containing"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85553"
FT                   /protein_id="ABX85553.1"
FT                   /translation="MQNFTLHTPTKVLFGTGQIAQLTQEIPADARILITYGGGSIKQNG
FT                   VLDQVHQALKGFDFLEFGGIEPNPTYETLMKAVELCRTEGINFLLAVGGGSVLDGTKFI
FT                   AAAVNYPQDPWHILETTGRDITEALPMGSVLTLPATGSEANNGAVISRRSTGDKQHFFS
FT                   PHVQPLFAVLDPVVTYTLPPRQVANGVVDAFVHTIEQYLTYPVDAKVQDRFAEGLLLTL
FT                   IEEGPKALKDPENYNVRANIMWSATMALNGLIGAGVPQDWATHMLGHELTARHGLDHAQ
FT                   TLAVVLPALLVAKKQQKRAKLLQYAERVWGLREGSEDQRIDAAIEATRHFFESLGVATR
FT                   LSAYKLDGSSIPDLIKKLEEHGMTKLGEHSDITLADSKRIYEAAV"
FT   gene            282808..283641
FT                   /gene="dkgA"
FT                   /locus_tag="YpAngola_A0272"
FT   CDS_pept        282808..283641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgA"
FT                   /locus_tag="YpAngola_A0272"
FT                   /product="2,5-diketo-D-gluconic acid reductase A"
FT                   /EC_number="1.1.1.274"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85044"
FT                   /protein_id="ABX85044.1"
FT                   /translation="MTMQPLIKLYDGRLMPQLGLGVWQASIQETELAVSKALEVGYRSI
FT                   DTAAIYKNEEGVGKALKAAAVARDELFITTKLWNDDQHNPQQALENSLQKLQLDYVDLY
FT                   LIHWPDPKQDHYVSAWRELVTLKEQGLIRSIGVCNFHIPHLQRLIDETGIAPTVNQIEL
FT                   HPLLQQRQLHAWNATHHIATESWSPLAQGGKGVFDQEIIRKLAQQYNKTPAQIVIRWHL
FT                   DSGLIVIPKSVTPARIRENFEVFDFKLQKEELLAITKLDCGKRLGPDPEVFGSDR"
FT   gene            complement(283663..286007)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0273"
FT                   /note="radical SAM domain protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(286315..287739)
FT                   /locus_tag="YpAngola_A0274"
FT   CDS_pept        complement(286315..287739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0274"
FT                   /product="SufI protein"
FT                   /note="identified by match to protein family HMM PF07731;
FT                   match to protein family HMM PF07732; match to protein
FT                   family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88606"
FT                   /protein_id="ABX88606.1"
FT                   /translation="MSLSRRQFIQAAGLALGAGSLPLRAQASSTQQPQLPVPPLLESRR
FT                   GQPLFLTLQRAHWAFSGNKKAAVWGINGMYLGPTVRVFNGDDVKLIYSNRLTEPVSMTI
FT                   SGLQVPGTLMGGEARMIRPGEDWSPVLPVRQPAANCWYHANTPNRMAPHVYNGLAGMWL
FT                   VEDAVSKAMPLPSHYGVDDFPLIIQDKRLDNFGVPEYNPPAKGGFVGDTLLVNGAQSPF
FT                   VEVSRGWVRLRLLNASNARRYTLQLSDGRPLYVVASDQGFLPAPVAVQQLSLAPGERRE
FT                   VVIDMSQGNEVSITAGESAGIMDRLRGLFEPSSILISTLVLTLKPTGLLPLVTDNLPMR
FT                   LLADQIIEGSVIRSREFQLGDNLPGINGAIWDMNRVDVQAQQGTWERWIIHADMPQAFH
FT                   IQGVSFLVKSVNGAAAMAEDRGWKDTVWVDGTVELWVYFNQVSSPQFPFLFYSQTLEMA
FT                   DRGSAGQLVTVAAPTL"
FT   gene            complement(287918..288649)
FT                   /locus_tag="YpAngola_A0275"
FT   CDS_pept        complement(287918..288649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0275"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="identified by match to protein family HMM PF01553;
FT                   match to protein family HMM TIGR00530"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88164"
FT                   /protein_id="ABX88164.1"
FT                   /translation="MLLILRTVLAVLYCFLVCVFGSIYCLFSPRNPRHVATFSHLFGRM
FT                   SVLFGITIEQRIPAEAAKYGNCIYIANHQNNYDMVTMSNVVQPGTVTVGKKSLLWVPLF
FT                   GPLYWLTGNLLIDRDNRAKAHSTIAQVVEQVQKRNISIWMFPEGTRSRGRGLLPFKTGA
FT                   FHAAIAAGVPIVPICVSSTNGIKLNRWSNGKVIIEMLPPIDTSGYTKERVRELSEHCRN
FT                   LMLAKIEQLDAEVAQQSVAKK"
FT   gene            complement(288938..291211)
FT                   /gene="parC"
FT                   /locus_tag="YpAngola_A0276"
FT   CDS_pept        complement(288938..291211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="YpAngola_A0276"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01062"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85767"
FT                   /protein_id="ABX85767.1"
FT                   /translation="MSDLTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPV
FT                   QRRIVYAMSELGLNNSAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSKYAEVLLGELAQGTVDWVPNFDGTMQEPKMLPA
FT                   RLPNILLNGTTGIAVGMATDIPPHNVREIAQAVLALIDKPTTSLDELLEFVQGPDFPTE
FT                   AEIITPRDDIRKIYQNGRGSVRMRAVWKKEDGSAVITALPHQVSGAKVLEQIANQMRAK
FT                   KLPMVEDLRDESDHENPTRLVIVPRTNRVDLDQVMSHLFATTDLERSYRINMNMIGLDN
FT                   RPSVKGLLEILTEWLVFRRQTVRNRLNFRLEKVLKRLHILEGLLIAFLNIDEVIHIIRT
FT                   EDDPKPLLMQRFSISETQAEAILELKLRHLAKLEEVKIRGEQDELAKERDQLQALLASE
FT                   RKLNTLIKKEIQADAAAYGDDRRSPLTERGEAKAMSEHDIVPSEPVTIVLSEMGWVRSA
FT                   KGHDIDPSGLSYKAGDSFRAAARGMSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTG
FT                   KLTPPPGATIEHVLMAPDSQKLLMASDAGYGFVCTFNDLVAKNRAGKTMITLPENAKVL
FT                   PPLEIYGPDDMLLSITAVGRMLMFPVADLPELSKGKGNKIVSIPAAQAAAGEDRLAWLF
FT                   VLPPQTSITLHFGKRKLTLRPEDLQKFRAERGRKGSPLPRGLQRIDRIDVDAPPRAIAT
FT                   ESEE"
FT   gene            291515..292099
FT                   /locus_tag="YpAngola_A0277"
FT   CDS_pept        291515..292099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0277"
FT                   /product="putative NADH-quinone reductase mdaB"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84908"
FT                   /protein_id="ABX84908.1"
FT                   /translation="MSNVLIINAMKEFAHSKGALNLTLTNVAADFLRESGHQVKITTVD
FT                   QGYDIESEIENYLWADTIIYQMPAWWMGEPWILKKYIDEVFTDGHGRLYQSDGRTRSDA
FT                   TKGYGSGGLIQGKTYMLSVTWNAPREAFTDPEQFFHGVGVDGVYLPFHKANQFLGMKPL
FT                   PTFMCNDVIKQPDIEGDIARYRQHLAENVNS"
FT   gene            complement(292157..293068)
FT                   /locus_tag="YpAngola_A0278"
FT   CDS_pept        complement(292157..293068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0278"
FT                   /product="substrate-binding transcriptional regulator, LysR
FT                   family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86397"
FT                   /protein_id="ABX86397.1"
FT                   /translation="MKVTLEELQAFTSVVDCGSITAAAEQRSQTTSGISRALSRLEQKL
FT                   ATTLLRRTTRRLELTEEGALFLSHARQIIGAVDDAEEQIALRRLKPAGRLRVNAAAPFM
FT                   QHVIVPMITGFRALYPQITLELNTDDLNIDLLEQRTDIAIRIGALRDSTIHARLLGASR
FT                   VRLLASPNYLQRHGTPHIIEALADHSLLGFTQPEFLNQWSLPHLPGGRSSIIPNLAASS
FT                   GETLRLLALQGEGIAELSDFMTREDQLAGRLVEVLADQILETWQPINAVYYRNTQLAAR
FT                   ITCFLDYVSEQIKLQGSHWLRI"
FT   gene            complement(293072..294967)
FT                   /gene="parE"
FT                   /locus_tag="YpAngola_A0279"
FT   CDS_pept        complement(293072..294967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="YpAngola_A0279"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR01055"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87032"
FT                   /protein_id="ABX87032.1"
FT                   /translation="MTESSYNADAIEVLSGLEPVRRRPGMYTDTSRPNHLGQEVIDNSV
FT                   DEALAGHARRIDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNK
FT                   NYQFSGGLHGVGISVVNALSKRVEVTVRRDSQIYSIAFENGDKVQDLQVIGTCGKRNTG
FT                   TSVHFWPDVSFFDSPRFSVSRLSHLLKAKAVLCPGVEIVFKDQVNNTEQRWCYADGLTD
FT                   YLMEAVNGFITLPEAPFVGSFAGDTEAIDWALLWLPEGGELLTESYVNLIPTMQGGTHV
FT                   NGLRQGLLDAMRDFCEYRNILPRGVKLSADDIWERCAYVLSVKMQDPQFAGQTKERLSS
FT                   RQCAAFVSGVVKDAFSLWLNQNVQAAEQLAELAISSAQRRMRAAKKVVRKKLTSGPALP
FT                   GKLADCTSQDLSLTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLA
FT                   SQEVHDISVAIGIDPDSEDLSQLRYGKVCILADADSDGLHIATLLCALFVRHFRALVRN
FT                   GHVYVAMPPLYRIDLGKEVFYALDEEEKAGVLEQLKRKRGKPNVQRFKGLGEMNPLQLR
FT                   ETTLDPNTRRLVQLTISDDDIDHTLAVMDMLLAKKRSEDRRNWLQEKGDTAEIEV"
FT   gene            complement(295069..295650)
FT                   /gene="yqiA"
FT                   /locus_tag="YpAngola_A0280"
FT   CDS_pept        complement(295069..295650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiA"
FT                   /locus_tag="YpAngola_A0280"
FT                   /product="esterase YqiA"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF05728"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88231"
FT                   /protein_id="ABX88231.1"
FT                   /translation="MSTLLYIHGFNSSPSSAKATAFKEWLQQHYPHIEMLTPQLPPYPA
FT                   PAAEMLENIVMDKAGQSIGIVGSSLGGYFATWLSQRFGIPAVVVNPAVRPYELLSDYLG
FT                   KNENPYTGQQYVLESRHIYDLKAMQIEKLESPDLLWLLQQTGDEILDYRQAVAYYTPCR
FT                   QTVESGGNHAFIGFDHYFSPIVTFLGLANT"
FT   gene            complement(295650..296549)
FT                   /locus_tag="YpAngola_A0281"
FT   CDS_pept        complement(295650..296549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0281"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF08413"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87803"
FT                   /protein_id="ABX87803.1"
FT                   /translation="MALPADSHNTHNYLVGGRQKQGYHLESLFKLPMASGARVRILQIT
FT                   DTHLFAGEHETLLGVNTFHSYRAVLDAIIAEQHPFDLVVATGDLAQDHSVAAYQNFAKG
FT                   ISRLPVPCVWLPGNHDFQPAMFDALAEAGIAPSKQVLAGEHWQILLLDSQVFGVPYGEL
FT                   SDYQLEWMERCLIAYPERYTLILLHHHPMPSGCTWLDQHSLRNAHMLAAILTRYPRVTT
FT                   LLCGHIHQDLDLDWYGKRLLASPSTCVQFKPHCTNFTLDAVAPGWRYLDLLPDGGLETE
FT                   VHRLDSDEFCPDMDSDGY"
FT   gene            complement(296558..296983)
FT                   /locus_tag="YpAngola_A0282"
FT   CDS_pept        complement(296558..296983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06853"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85773"
FT                   /protein_id="ABX85773.1"
FT                   /translation="MSKRYTPDFPEMMRLCEINYAQLRRLIPRINEVGESVAYQIKEVS
FT                   YRLTIIESTRYTSVVEIVQTAPAASHWSLPSMVVRLYHDAMVAEVCASQQISRFKASYD
FT                   YPNKKLHQRDEKHQINQFLADWLRYCLAHGAVAVPVC"
FT   gene            complement(297017..297649)
FT                   /locus_tag="YpAngola_A0283"
FT   CDS_pept        complement(297017..297649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0283"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM TIGR00052"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85987"
FT                   /protein_id="ABX85987.1"
FT                   /translation="MTSKQSSPVTFDKNDVEIIARESLYRGFFSLNSYRFRHRLFNGEM
FT                   SGEVKREIFERGHAAVLLPYDPQRDEVVLVEQLRIAAIDSAVSPWLLEMVAGMIEEGES
FT                   VEEVARREAEEEAGIQVGRCKPVLSYLASPGGTSERLSIMVGEVDATTASGIHGLAEEN
FT                   EDIRVHVVSREQAYRWVEEGVIDNAASVIALQWLALHHQALRAEWQR"
FT   gene            298045..299442
FT                   /locus_tag="YpAngola_A0284"
FT   CDS_pept        298045..299442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0284"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01844"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86524"
FT                   /protein_id="ABX86524.1"
FT                   /translation="MKKLLPLLIGLSLAGFSTMSQAENLLQVYKQARDSNPDLRKAAAD
FT                   RDAAYEKINEVRSPLLPQLGLSAGYTHANGFRDASNSPDSNATSGSLKLTQTIFDMSKW
FT                   RALTLQEKAAGIQDVTFQTSEQQLILNTATAYFNVLRAIDSLSYTEAQKQSVYRQLAQT
FT                   TQRFNVGLVAITDVQNARASYDTVLAAEVAARNNLDNALESLRQITGVYYPELASLNVE
FT                   RLKTQRPDAVNNLLKEAEKRNLSLLSARLSQDLAREQIKSAETGYMPTVDLTASSSITN
FT                   TRYSGGTPSSQQVNNDSGQNQIGVQFSLPLYSGGATNSAVKQAQYNFVGASELLESAHR
FT                   NMVQTLRSSFNNISASISSINAYQQVVISNQSSLDAMEAGYQVGTRTILDVLTATTNLY
FT                   QSKQQLADARYNYLINQLNIKSALGTLNMNDLMALNAVLDKPVPTSAAALAPENTTRQT
FT                   VTTPRAQ"
FT   gene            299604..300113
FT                   /locus_tag="YpAngola_A0285"
FT   CDS_pept        299604..300113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0285"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86867"
FT                   /protein_id="ABX86867.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            300453..301139
FT                   /locus_tag="YpAngola_A0286"
FT   CDS_pept        300453..301139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87402"
FT                   /protein_id="ABX87402.1"
FT                   /translation="MMKRTKNINQETFRKSWRSYRLAPVALAVSAVFMLAGCEKTDETV
FT                   SLYQNADDCSQANPSQSAECTTAYNTALQEAVKTAPKYATREDCVAEFGESQCTQAPAQ
FT                   AGMVPTSSSETTAAAPQQSGSMWMPLMAGYMMGRMMGGGASQPLFTSKAPNSPANGKFV
FT                   DASGKNFGAATTGRTMTVPKTALAPKPAVTKTITRGGFGESVAKQSSMQRSAATSSKTT
FT                   TRSMGG"
FT   gene            301149..302309
FT                   /locus_tag="YpAngola_A0287"
FT   CDS_pept        301149..302309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0287"
FT                   /product="putative glutathionylspermidine synthase"
FT                   /note="identified by match to protein family HMM PF03738"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88649"
FT                   /protein_id="ABX88649.1"
FT                   /translation="MKRLAISERPDWREKATEFGFRFHTMHGEPYWCEDAYYEFTLAQI
FT                   EELEETTAELHQMCLQVVEKVINSDQLLTKCRIPKHCWEFVRHSWRSNQPSLYSRLDLA
FT                   YDGKNPAKLLENNANTPTSLYEAAFFQWLWLEDQISAGNLSTDSDQYNSLQEKLIERFV
FT                   ELRDNHGFSLLHLACCQDSEEDRGTVQYLQDCALEAGLPTEFMFMEEIGLGEKGQFTDL
FT                   DNQVISNLFKLYPWEFMFREIFSTKLEDAGVRWLEPAWKSIISNKALLPLLWEMFPNHP
FT                   NLLPAYFAEDDHPPLDHYVIKPLFSREGANIQIVENGKEVAKVDGPYGEEGMIIQQFHP
FT                   LPKFGDSYTLIGSWLVNDQPCGIGLREDRELITQDLSRFYPHIILG"
FT   gene            complement(302593..303375)
FT                   /locus_tag="YpAngola_A0288"
FT   CDS_pept        complement(302593..303375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0288"
FT                   /product="extradiol ring-cleavage dioxygenase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02900"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88317"
FT                   /protein_id="ABX88317.1"
FT                   /translation="MNTFRMPALFLGHGSPMNVLEENSYTQAWRTLGETLPRPKMILAI
FT                   SAHWYTRGTAVTAMEHPRTIHDFGGFPQALFDIQYPAPGSPELAAHIQQLLAPTPVRAD
FT                   TGEWGLDHGSWGVLIKMYPEADIPVVQLSIDGTQPAAYHYELGQKLAALREQGVMIVAS
FT                   GNVVHNLRLGKWQGESSPYPWAESFNQFVRDNLSYQGDDHPLVNFMQHEGAALSNPSPE
FT                   HYLPLLYVLGSWDGKEPVSIPTDGVEMGSLSMLSVQIG"
FT   gene            complement(303834..304487)
FT                   /gene="ribB"
FT                   /locus_tag="YpAngola_A0289"
FT   CDS_pept        complement(303834..304487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="YpAngola_A0289"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="identified by match to protein family HMM PF00926;
FT                   match to protein family HMM TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86449"
FT                   /db_xref="GOA:A9R7D2"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7D2"
FT                   /protein_id="ABX86449.1"
FT                   /translation="MNQTLLSDFGTPVERVERAIDALRNGRGVMVLDDESRENEGDMVF
FT                   AAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEG
FT                   VTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGVLSRRGHTEASIDLATL
FT                   AGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAYLQSRAKKAS"
FT   misc_binding    complement(304729..304918)
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element)"
FT   gene            305056..305337
FT                   /locus_tag="YpAngola_A0290"
FT   CDS_pept        305056..305337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04380"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87148"
FT                   /protein_id="ABX87148.1"
FT                   /translation="MIDPKKIEQIARQVHESMPKGIREFGEDVEKKIRLILQSQLTRLD
FT                   LVNREEFDVQTQVLLRTREKLALLEQRVGALEAKFNSAPADHGEKTGE"
FT   gene            complement(305662..306912)
FT                   /locus_tag="YpAngola_A0291"
FT   CDS_pept        complement(305662..306912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0291"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87363"
FT                   /protein_id="ABX87363.1"
FT                   /translation="MGGLKQELSLAQGVGLLSTSLLGTGVFAVPALAAMLAGHDSLWAW
FT                   PVLIVLVFPIAIAFAALGRHFPSAGGAAHFVAIAFGPKLGKVTGWLFLSVIPVGLPAAL
FT                   QIAAGFWQAMFGWSDTGLLMVQLVTLLVIWLLGTRSAGSSANLQTVIALLVIALVAAIW
FT                   WQGDIRLSQIPWPALQDVSPPNIFNALAVMFWCFVGLEAFAHLATEFRHPERDFPRALI
FT                   VGLLVAGAVYWGCTVAVLHFQAYGESQAAAASLPGIVVQLFGEHALWIACIIGYLACFA
FT                   SVNIYTQSFARMVWSQSQVRPQSKLARLSAGQTPVNALTAVVGSCLVFALLIYWLALPL
FT                   DLLIVYANGIFVLIYLLCMLAGIRLLSGRARVMSVIGSLLCCVLLVMIGWKSVYALLMF
FT                   ALLWMLMSKPKTQLTQP"
FT   gene            complement(306949..308379)
FT                   /gene="hldE"
FT                   /locus_tag="YpAngola_A0292"
FT   CDS_pept        complement(306949..308379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldE"
FT                   /locus_tag="YpAngola_A0292"
FT                   /product="bifunctional protein HldE"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM PF01467; match to protein
FT                   family HMM TIGR00125; match to protein family HMM
FT                   TIGR02198; match to protein family HMM TIGR02199"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88419"
FT                   /db_xref="GOA:A9R7D5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7D5"
FT                   /protein_id="ABX88419.1"
FT                   /translation="MKVTLPDFRRAGVLVVGDVMLDRYWYGPTCRISPEAPVPVVKVDT
FT                   IEERPGGAANVAMNIASLGAVARLVGLTGIDDAARALICKLSEVRVRCDFVSVPTHPTI
FT                   TKLRVLSRNQQLIRLDFEEGFDGVDPTPIFERIQLALPQIGALVLSDYAKGALNSVQPM
FT                   IQLARKANVPVLIDPKGSDFERYRGATLLTPNLSEFEAVVGRCKNEEELVNRGMQLVAD
FT                   FELSALLVTRSEQGMTLLQLGKPPLHLPTQAKEVFDVTGAGDTVIGVLAAALAAGNSLE
FT                   ESCFLANAAAGVVVGKLGTSTVSPIELENAIRGRAETGFGVMDEQQLKIAVAQARQRGE
FT                   KVVMTNGIFDILHAGHVSYLANARKLGDRLIVAVNSDASTKRLKGEKRPVNPLEQRMVV
FT                   LGALEAVDWVVPFEEDTPQRLIADILPDLLVKGGDYKPHEIAGSEEVWAAGGEVKVLNF
FT                   EDGVSTTNIIQSIKNGRG"
FT   gene            complement(308514..311369)
FT                   /gene="glnE"
FT                   /locus_tag="YpAngola_A0293"
FT   CDS_pept        complement(308514..311369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="YpAngola_A0293"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="identified by match to protein family HMM PF03710"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85091"
FT                   /db_xref="GOA:A9R7D6"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7D6"
FT                   /protein_id="ABX85091.1"
FT                   /translation="MLPLPSELQIQAQSIKQRFSELPAPPDLRDEDIAVLALSDFVSDM
FT                   LLIHPQWLEELHQQPPQPQEWQYYSQWLSQALAGVQDEAALLTALRLFRRRVMVRIAWS
FT                   QVLQTSGTAETLQQLSTLAESMIIAARDWLYQVCCRELGTPCNRQGVPQPLLILGMGKL
FT                   GGGELNFSSDIDLIFAYPENGQTQGGRRELDNAQFFTRLGQRLIKALDQHTIDGFVYRV
FT                   DMRLRPFGDSGPLVLSFAALEDYYQEQGRDWERYAMVKARLMGGADDPYSQELRQMLRP
FT                   FVFRRYIDFSVIQSLRNMKGMIAREVRRRGLKDNIKLGAGGIREIEFITQVFQLIRGGR
FT                   EPRLQERALLPTLQAVAELGLLPEQQVADLSGSYLFLRRLENLLQAIADEQTQTLPNDP
FT                   LNQARLAWGMGYADWAAMSTALENHMQAVRVVFDDLIGDETPDIGEDPSHGLYKSLWQD
FT                   VLEESDLAPLTPHLEEAARRQLLATISGFRHDVDKRTIGPRGREVLDQLMPRLFAEVCP
FT                   RPDANVALSRLILLLLSIVTRTTYLELLVEYHAALKHVIRLCSASPMVASQLARYPLLL
FT                   DELLDPQSLYQPLAPSAYRDELRQYLLRVPEDDEEQQLEALRQFKQAQQLRIAAGDITE
FT                   ALPVMKVSDHLTYLAEAIIDAVIQQAWNQMVARYGQPSHLQQSEGRGFAVIGYGKLGGW
FT                   ELGYSSDLDLVFLLDCPLDVMTDGDRSIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDA
FT                   RLRPSGEAGMLVSTIEAFADYQRNEAWTWEHQALVRARIVYGSPKLHQQFDAIRQQILC
FT                   RHREDPQLQQEVREMREKMRNHLGSKQRDIFDIKADAGGITDIEFIAQYLVLRYAASEP
FT                   RLTRWSDNVRIFESMAHYDIMSPEEAAALTRAYVTMRDEIHHLALQEQSSKVAADSFIA
FT                   EREQVAASWHKWLAANDANVS"
FT   gene            complement(311540..312847)
FT                   /locus_tag="YpAngola_A0294"
FT   CDS_pept        complement(311540..312847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0294"
FT                   /product="adenylate cyclase"
FT                   /note="identified by match to protein family HMM PF01928;
FT                   match to protein family HMM PF05235"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85484"
FT                   /protein_id="ABX85484.1"
FT                   /translation="MTVEIELKFIATPAAIAALPEWIESQKNQHFPPQTLANIYFDTAD
FT                   KRLRQNDIGLRIRGYDGRYEMTVKTGGKVVGGLHQRPEYNVDIDSDQLDLARFPQDIWP
FT                   EGWAVDLLQAELQPLFRTDFTREKWVITYGESEIELALDQGSISADTLSEPLSEIELEL
FT                   KQGTQGDLLALAAELAKMGGLRQSNLSKAARGYHLAQGNPPRELRPFLVFQPVAKSTVE
FT                   QGMAGGLESILEHWQYHEELWLRGEPAAKTMIIDALAMVRQSLAIFGGLVPRKASTELR
FT                   ALLIALEPQLEPKSVDAALLCYSVDYLKCKLALTSWLITAGWRPFMDAKAQAKFDGSFK
FT                   RFCDIMLSRSAADLKEAFGHNLDDDGYLAQLPRLNRQLIAFQLLSGFYPQSEWHPYIDA
FT                   WFGLQQAIMARQGHWRDTARKEALSQAAFWLNGAVR"
FT   gene            313151..313774
FT                   /locus_tag="YpAngola_A0295"
FT   CDS_pept        313151..313774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86754"
FT                   /protein_id="ABX86754.1"
FT                   /translation="MQKLRLICLTILSVSLSWGAQAEEKRYISDELDTYVHSGPGNQYR
FT                   IVGTLKGGDEVTLISVDNGTNYGQIRDSKGKTTWIPLNQLSETPSLRVRVPDLEQQVKT
FT                   LTDKLANIDNSWNQRTAEMQQKVAASDSVISELQKENESLKNQLIVAQKKVNAVNLQLD
FT                   DKQRTIILQWFMYGGGVAGIGLLLGLVLPHLIPSRKKNNRWMNC"
FT   gene            313934..315172
FT                   /gene="cca"
FT                   /locus_tag="YpAngola_A0296"
FT   CDS_pept        313934..315172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="YpAngola_A0296"
FT                   /product="multifunctional CCA protein"
FT                   /EC_number="3.1.3.-"
FT                   /EC_number="3.1.4.-"
FT                   /EC_number="2.7.7.72"
FT                   /note="identified by match to protein family HMM PF01743;
FT                   match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87090"
FT                   /db_xref="GOA:A9R7D9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7D9"
FT                   /protein_id="ABX87090.1"
FT                   /translation="MNIYLVGGAVRDSLLNLPVTEQDWVVVGATPEQLLKLGYQQVGKD
FT                   FPVFLHPVSHEEYALARTERKSGQGYTGFTCYAAPDVTLEDDLLRRDLTVNAIARSADG
FT                   EFIDPYHGKQDLENRVLRHVSDAFGEDPLRVLRVARFAARFAYLGFTIAPETMSLMSNM
FT                   AQSGELSALTPERVWKETEKALKTQSPHVYFQVLRDCGALAVLFPEIERLFGVPAPEKW
FT                   HPEIDTGIHTLMTLAIAAQLSPEVDIRFAALCHDLGKGLTPKEHWPHHHGHGPAGVKLV
FT                   EQLCQRLRIPNPVRDLAKLVAEYHDLIHTVNKLRPETLLKLFNAIDVWRKPERLEQMIM
FT                   TSEADARGRTGFENNPYPQGDYLRAAFQIANGVSIQEVVASGLQGLAIRDELQRRRQQA
FT                   LAEWKQTQETASI"
FT   gene            complement(315408..316226)
FT                   /gene="uppP"
FT                   /locus_tag="YpAngola_A0297"
FT   CDS_pept        complement(315408..316226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="YpAngola_A0297"
FT                   /product="undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="identified by match to protein family HMM PF02673;
FT                   match to protein family HMM TIGR00753"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86901"
FT                   /db_xref="GOA:A9R7E0"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7E0"
FT                   /protein_id="ABX86901.1"
FT                   /translation="MTDMYSLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDKA
FT                   KTFEVIIQLGSILAVVVVFWRRLFGLIGIHFGAVPHEGKTNGHLTLGHILLAMIPAVIL
FT                   GLAFHDVIKALFDPKSVMYALVAGGVLLLAAEWLKPKNPKAVGLDDITYRQAFAIGCFQ
FT                   CLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHFLTLGD
FT                   LPMFAVGFITAFIVALIAIKTFLSLIKRISFVPFAIYRFIVAAVVYWVFM"
FT   gene            complement(316500..316859)
FT                   /gene="folB"
FT                   /locus_tag="YpAngola_A0298"
FT   CDS_pept        complement(316500..316859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="YpAngola_A0298"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="identified by match to protein family HMM PF02152;
FT                   match to protein family HMM TIGR00525; match to protein
FT                   family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87340"
FT                   /protein_id="ABX87340.1"
FT                   /translation="MDIVFIEELSVITTIGVYDWEQTIQQKLVFDIEMGWDNRKAAGSD
FT                   DVNDCLSYADISEAVIQHVGSQRFALVERVAEEVAELLLRRFNSPWVRIKVSKPGAVAQ
FT                   AKNVGVIIERGQRLS"
FT   gene            316877..317617
FT                   /locus_tag="YpAngola_A0299"
FT   CDS_pept        316877..317617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0299"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02660;
FT                   match to protein family HMM TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86134"
FT                   /protein_id="ABX86134.1"
FT                   /translation="MCLPDTTSSRICVLSTDVAIKTTIIQRGGVMSAIALGMIIFAYLC
FT                   GSISSAILVCRVARLPDPRTHGSGNPGATNVLRIGGRTAAVAVLLFDILKGMLPVWIAY
FT                   LLHIPPLYLGLTAIAACLGHIYPVFFHFKGGKGVATAFGAIAPIGWDLTGLMTGTWLLT
FT                   VLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVAMLSCLILMRHHDNIQRLWRGKEGKI
FT                   WDKLRKKKQKTPAEEAAELEEKED"
FT   gene            complement(317808..318821)
FT                   /gene="gcp"
FT                   /locus_tag="YpAngola_A0300"
FT   CDS_pept        complement(317808..318821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="YpAngola_A0300"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85961"
FT                   /db_xref="GOA:A9R7E3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7E3"
FT                   /protein_id="ABX85961.1"
FT                   /translation="MRVLGIETSCDETGIAVYDDKAGLLANQLYSQVKLHADYGGVVPE
FT                   LASRDHVRKTVPLIQAALKEANLSAKDIDAVAYTAGPGLVGALLVGATIGRALAFAWGV
FT                   PAVPVHHMEGHLLAPMLEENAPEFPFVALLVSGGHTQLISVTGIGEYLLLGESVDDAAG
FT                   EAFDKTAKLLGLDYPGGPMLSRMAQQGTVGRFTFPRPMTDRPGLDFSFSGLKTFAANTI
FT                   RANGDDDQTRADIARAFEDAVVDTLAIKSKRALDQTGFKRLVIAGGVSANQTLRLKLAD
FT                   MMQKRGGEVFYARPEFCTDNGAMIAYAGMVRLRSNLNSELSVSVRPRWPLSELPKV"
FT   gene            319227..319442
FT                   /gene="rpsU"
FT                   /locus_tag="YpAngola_A0301"
FT   CDS_pept        319227..319442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="YpAngola_A0301"
FT                   /product="ribosomal protein S21"
FT                   /note="identified by match to protein family HMM PF01165;
FT                   match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87154"
FT                   /db_xref="GOA:A9R7E4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7E4"
FT                   /protein_id="ABX87154.1"
FT                   /translation="MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTER
FT                   KRAKASAVKRHAKKLARENARRTRLY"
FT   gene            319578..321326
FT                   /gene="dnaG"
FT                   /locus_tag="YpAngola_A0302"
FT   CDS_pept        319578..321326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="YpAngola_A0302"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF01807; match to protein
FT                   family HMM PF08275; match to protein family HMM PF08278;
FT                   match to protein family HMM TIGR01391"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88618"
FT                   /protein_id="ABX88618.1"
FT                   /translation="MAGRIPRVFINDLLARTDIIDLIDARVKLKKQGKNYHACCPFHHE
FT                   KTPSFTVNGEKQFYHCFGCGAHGNAVDFLMNYDRLEFVESIEELATMHGLEVPYEAGSG
FT                   TTQIERHQRQSLYQLMESLSAFYQQSLKGQNAKQAREYLKHRGLSEEIIQHFAIGFAPP
FT                   GWDNALKRFGRDGESRTALNDAGMLVTNDTGRTYDRFRERVMFPIRDKRGRVIAFGGRI
FT                   LGDGVPKYLNSPETEIFHKGRQLYGLYEAQVNHPNPTRLLVVEGYMDVVALAQFGIDYA
FT                   VASLGTATTAEHIQLLFRATDNVICCYDGDRAGRDAAWRALETALPYLNDGRQLRFMFL
FT                   PDGEDPDTLVRKEGKDAFEQRMEAAQPLSTFLFETLMPQVDLSSPDGRAKLSTLALPLI
FT                   SQVPGEALRLYLRQQLGNKLGLLDDSQLDKLMPKQIDNANTYQPPQLKRTTMRILIGLL
FT                   VQNPQLATLIPSLQGLEQAKLAGLPLFIELVETCLAQPGLTTGQLLELYRDNKFSQQLE
FT                   TLATWNHMIVEDMVEPTFVDTLASLYDSILEQRQETLIARDRTHGLNAEERKELWSLNL
FT                   ALARKK"
FT   gene            321484..323322
FT                   /gene="rpoD"
FT                   /locus_tag="YpAngola_A0303"
FT   CDS_pept        321484..323322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="YpAngola_A0303"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="identified by match to protein family HMM PF00140;
FT                   match to protein family HMM PF03979; match to protein
FT                   family HMM PF04539; match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF04546; match to protein family HMM TIGR02393;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87135"
FT                   /protein_id="ABX87135.1"
FT                   /translation="MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDII
FT                   QMINDMGIQVLEEAPDADDLMLAENTTDTDDDAAEAAAQVLSSVESEIGRTTDPVRMYM
FT                   REMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAGESRLSDL
FT                   ITGFVDPNAEEDIAPTATHVGSELSTEEMDDEDEDEDEDDDAEDDNSIDPELARQKFSD
FT                   LREQYENARMEIKKNGRNHANAAAEILKLSEVFKQFRLVPKQFDYLVNNMRAMMDRVRT
FT                   QERIIMKLCVEQCKMPKKNFVTLFSSNETSDTWFNAAVAMGKPWSEKLKDVSEDVQRSL
FT                   QKLRQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQ
FT                   FLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
FT                   INKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSH
FT                   LGDFIEDTTLELPLDSATSENLRSATHDVLAGLTAREAKVLRMRFGIDMNTDHTLEEVG
FT                   KQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
FT   gene            323517..323595
FT                   /locus_tag="YpAngola_A0304"
FT   tRNA            323517..323595
FT                   /locus_tag="YpAngola_A0304"
FT                   /product="tRNA-Met"
FT   gene            complement(323840..324178)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0305"
FT                   /note="putative phage terminase, small subunit; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            complement(324156..324446)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0306"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(324463..324918)
FT                   /locus_tag="YpAngola_A0307"
FT   CDS_pept        complement(324463..324918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86000"
FT                   /protein_id="ABX86000.1"
FT                   /translation="MANLEKAVNEFTRISKSMGYNINPPYTGKLETYDFGRDISPEQPD
FT                   FWKQYGSFLRISNGSFADGCVFYGMSGGEDDAGLIEFNNALNIPDFKDETMTGLIVIGG
FT                   NNTDTFYYDPRTGKWEACDRIGTDRVWESCDSLAELIETQIKMLENG"
FT   gene            complement(324945..325415)
FT                   /locus_tag="YpAngola_A0308"
FT   CDS_pept        complement(324945..325415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86410"
FT                   /protein_id="ABX86410.1"
FT                   /translation="MTDIEKAVTTFQAYRAAIGYPKIPPYEGEVIEYDFGRKIESNQPD
FT                   FWTQYHEFLRLSDGLAADGVYFYGIACEGKLIGNRLIDNNDALRDGEMYDESMDGLIAI
FT                   GSSNSDIFVYDTNTHKWESRDRIAIDDINESYDTLAELIDSQLQRINIGDAF"
FT   gene            complement(325424..326806)
FT                   /locus_tag="YpAngola_A0309"
FT   CDS_pept        complement(325424..326806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0309"
FT                   /product="HNH endonuclease domain protein"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84931"
FT                   /protein_id="ABX84931.1"
FT                   /translation="MSFNLPGMYLYYLSRDNLAPEEYERIISPHAAWARICREYEFDDS
FT                   HNTSRYLINMREREQRSSPDQPRPGGIREKEKLEKLVFSGDVVMLSDMYGPARLFYING
FT                   EGQLMSTDPHAFRFEGAAKIIKAFDDSVKCRNYQRTGGKPRSTQTRRLKSTTNTIPDRS
FT                   MVTRASDESGRVLSAKWQSVTDSAKTLWEATPFTHDKATTEAARGRIADGAVGTLEGLG
FT                   TLMGPSAQEYMAGAFNPEQAAINKVRQQNQQAAGKAIYDNTKGAVTDAYQRNGLAGAAA
FT                   MVVTASVAELAGTKGLGTVEKVGTLGDVAKLGKAVELEKLEGYLGTYKGQKVLLQNVDV
FT                   VKMDYVRRSTADRNLLRKEFDNGVRKKFLKDIANNPEVVKRLDAFDRSVLAKGVVPDGY
FT                   QVHHKLPLDDSGNNNFDNLVLISTRPEHAAFTTTQKHITKNLTPTGTNIVLWPKPQGII
FT                   YP"
FT   gene            327725..327883
FT                   /locus_tag="YpAngola_A0311"
FT   CDS_pept        327725..327883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88173"
FT                   /protein_id="ABX88173.1"
FT                   /translation="MTKKTAHSQITKTQIYRAVASSTAIETGVSVQKIEQQLKQNLAQA
FT                   KAVGLAR"
FT   gene            complement(327880..328047)
FT                   /locus_tag="YpAngola_A0310"
FT   CDS_pept        complement(327880..328047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0310"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84877"
FT                   /protein_id="ABX84877.1"
FT                   /translation="MSRLLCDVLAVLAGKGLLDYSLWDEHKAFYFKAIQAGVSGNYSPM
FT                   MRLVSDILPD"
FT   gene            complement(328188..328391)
FT                   /locus_tag="YpAngola_A0312"
FT   CDS_pept        complement(328188..328391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88608"
FT                   /protein_id="ABX88608.1"
FT                   /translation="MLANKLGIIDEYEMEALESGLLLMLYEQLFIEGPLPTTLAFNSIR
FT                   EWHRQWLGNVYTSGQGDYVTLT"
FT   gene            complement(329860..330009)
FT                   /locus_tag="YpAngola_A0313"
FT   CDS_pept        complement(329860..330009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0313"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86827"
FT                   /protein_id="ABX86827.1"
FT                   /translation="MWITIAPFVTSGNWQVPLTGSHFIMFGVLSWVNRVSAVQELEQGF
FT                   ASVW"
FT   gene            330066..331088
FT                   /locus_tag="YpAngola_A0314"
FT   CDS_pept        330066..331088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0314"
FT                   /product="transposase for insertion sequence"
FT                   /note="identified by match to protein family HMM PF00665;
FT                   match to protein family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86516"
FT                   /protein_id="ABX86516.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            331088..331867
FT                   /locus_tag="YpAngola_A0315"
FT   CDS_pept        331088..331867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0315"
FT                   /product="putative transposition helper protein"
FT                   /note="identified by match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85504"
FT                   /protein_id="ABX85504.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            331883..332365
FT                   /locus_tag="YpAngola_A0316"
FT   CDS_pept        331883..332365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0316"
FT                   /product="phage family integrase"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85648"
FT                   /protein_id="ABX85648.1"
FT                   /translation="MGRWWRYKWITFHPSLTLVKTTGKKIWRFHYQLPNSSKRTMVSLG
FT                   AYPALSLADAREVRAEKLAMLVRGVDPQARADEEAEKLQIAEESIFVNVARKWFELKES
FT                   HVSAAHAKDIWRSIEKDILPSIESVPIQELKARTLIQVLEPIKARGALETDLLPIE"
FT   gene            332414..332677
FT                   /locus_tag="YpAngola_A0317"
FT   CDS_pept        332414..332677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0317"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85129"
FT                   /protein_id="ABX85129.1"
FT                   /translation="MKKRFSDEQIINILREAEAGVSARELCRKHAISEASYYNWKAKYG
FT                   GMEASDIKKIKDLEDENRRLKQMFANLSLECRALKDVIEKKL"
FT   gene            333626..333754
FT                   /locus_tag="YpAngola_A0318"
FT   CDS_pept        333626..333754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0318"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88689"
FT                   /protein_id="ABX88689.1"
FT                   /translation="MEFDALIKPGLWLYKVIELKMEYHQIIHIFTSEGNSLKISIQ"
FT   gene            334070..334837
FT                   /locus_tag="YpAngola_A0319"
FT   CDS_pept        334070..334837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0319"
FT                   /product="esterase, DmpD/TodF/XylF family"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM PF07819"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88284"
FT                   /protein_id="ABX88284.1"
FT                   /translation="MKLNFRLQNAPSPTSALPIILIHGLFGNLDNLGVLARDLQQHHNV
FT                   IQVDLRNHGLSPRAPQMDYPVIAQDVLALMDELAITQAIIIGHSMGGKVAMAMTALAPN
FT                   RVEKLVAIDIAPVNYQVRRHDTIFAALNAVSAAGVTQRNEAAQLMRTLIKEEGVIQFLL
FT                   KSFQGGEWRFNVPALWDQYENIIGWQPIPPWPHPILFIRGELSPYIQDSYRDDIARQFP
FT                   QARAHVVAGTGHWVHAEKPDSVLRAIHRFLDAA"
FT   gene            335169..335456
FT                   /locus_tag="YpAngola_A0320"
FT   CDS_pept        335169..335456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0320"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="identified by match to protein family HMM PF01402"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87843"
FT                   /protein_id="ABX87843.1"
FT                   /translation="MAKEQTDRTTLDLFADERRPGRPKTNPLSRDEQLRINKRNQLRRD
FT                   KVRGLRRVELKINADAVDALNSLAEQRNISRSELIEQMLLAQLAHDQEGC"
FT   gene            335873..336400
FT                   /gene="fldA"
FT                   /locus_tag="YpAngola_A0321"
FT   CDS_pept        335873..336400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fldA"
FT                   /locus_tag="YpAngola_A0321"
FT                   /product="flavodoxin 1"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM TIGR01752"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87290"
FT                   /protein_id="ABX87290.1"
FT                   /translation="MATVGIFFGSDTGNTENIAKMIQKQLGKEVAEVHDIAKSSKEDLE
FT                   SFDILLFGIPTWYYGEAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCDAMGT
FT                   IRDIIEPRGAAIVGHWPTAGYHFEASKGLADDDHFIGLAIDEDRQPELTNERVEAWVKQ
FT                   ISEELNLSEIIG"
FT   gene            336767..337213
FT                   /locus_tag="YpAngola_A0322"
FT   CDS_pept        336767..337213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0322"
FT                   /product="ferric uptake regulation protein"
FT                   /note="identified by match to protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86915"
FT                   /protein_id="ABX86915.1"
FT                   /translation="MTDNNKALKNAGLKVTLPRLKILEVLQNPACHHVSAEDLYKILID
FT                   IGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSN
FT                   ESIESLQREIAKQHGIKLTNHSLYLYGHCETGNCREDESAHSKR"
FT   gene            complement(337654..340318)
FT                   /pseudo
FT                   /gene="chb"
FT                   /locus_tag="YpAngola_A0323"
FT                   /note="chitobiase; this gene contains a frame shift which
FT                   may be the result of sequencing error; identified by match
FT                   to protein family HMM PF00728; match to protein family HMM
FT                   PF02838; match to protein family HMM PF03174"
FT   gene            340444..340581
FT                   /locus_tag="YpAngola_A0324"
FT   CDS_pept        340444..340581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0324"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86659"
FT                   /protein_id="ABX86659.1"
FT                   /translation="MFRDLLFRDLLLQNNSAEFPAKVSYTAPLGLTVTGIGCINATRVI
FT                   "
FT   gene            complement(340646..342067)
FT                   /locus_tag="YpAngola_A0325"
FT   CDS_pept        complement(340646..342067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0325"
FT                   /product="outer membrane porin, OprD family"
FT                   /note="identified by match to protein family HMM PF03573"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86326"
FT                   /protein_id="ABX86326.1"
FT                   /translation="MVTHCQIAAHKAKRKTLALAIAGVLFGTGFMAAPEARADGFIDDS
FT                   SLTGGIYYWQRQRDRKDMTPTSPEYGKYVANLHHSTFNANLAFSSGYVADMFGLDLAAF
FT                   GAVEISNSGPAAPNEIGFSDAKTRWDEKWTGDKSGVSVYRAAAKFKLGDFWARGGYIQP
FT                   TGQTLLAPHWSFMPGTYRGAEGGAKFDFDTAGALSMSYMWTDEYKAPWYQNMYHFRQAD
FT                   GLTGVSYLHSFGAKYDFKNNLVMEAAFGQAKDYMDQYFAKASYAFPVAGNDLRTTYQFY
FT                   GAKDKVDGGASNANDVYDGLAWLQALTLGYTTGPFDLRLEGTWAKADGNQGYFLQRMTP
FT                   GYATSNGRLDVWWDSRSDFNANGEKALFGGVMYDLKNWNMAGWSVGTSYAYGWDAKPST
FT                   NPKFDQNTRLKESAWNFDILYTLQEGRAKGTLFKLHYTLYDNHTNIPSYGDGFGNVFQD
FT                   EKDVKFIVIAPFTLF"
FT   gene            complement(342773..344440)
FT                   /gene="glnS"
FT                   /locus_tag="YpAngola_A0326"
FT   CDS_pept        complement(342773..344440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="YpAngola_A0326"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM PF03950; match to protein
FT                   family HMM TIGR00440"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84873"
FT                   /db_xref="GOA:A9R7G5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7G5"
FT                   /protein_id="ABX84873.1"
FT                   /translation="MSEAEARPSNFIRQIIDEDLASGKHTSVHTRFPPEPNGYLHIGHA
FT                   KSICLNFGIAEDYQGQCNLRFDDTNPVKEDVEFVESIKRDVEWLGFTWSGDVRYSSDYF
FT                   DQLYQYAVELINKGLAYVDELTPEQMREYRGTLTAPGKNSPYRDRSVEENLALFEKMRA
FT                   GGFAEGTACLRAKIDMASPFIVMRDPVLYRIKFAEHHQSGNKWCIYPMYDFTHCISDAL
FT                   EGITHSLCTLEFQDNRRLYDWVLDNISIDCHPRQYEFSRLNLEYTIMSKRKLNQLVTEK
FT                   VVEGWDDPRMPTISGLRRRGYTAASIREFCRRIGVTKQDNNVEMMSLESCIRDDLNEHA
FT                   PRAMAVLDPIKVVIENRAAGEEWLTMPNHPNNPEMGSRQVPFDSEIYIDRADFREEANK
FT                   QYKRLVLGKEVRLRNAYVIKAERVEKDAEGNVTTLYCSYDAETLNKDPADGRKVKGVIH
FT                   WVSVAHALPAEIRLYDRLFNVPNPAAAEDFLSTINPESLVIRQGFVEPSLADAVSDKTY
FT                   QFEREGYFCADSRYSRPGALVFNRTVGLRDTWAAKATQ"
FT   gene            complement(344642..345151)
FT                   /locus_tag="YpAngola_A0327"
FT   CDS_pept        complement(344642..345151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0327"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85474"
FT                   /protein_id="ABX85474.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSSPYPGS
FT                   PFTGRK"
FT   gene            complement(345279..345355)
FT                   /locus_tag="YpAngola_A0328"
FT   tRNA            complement(345279..345355)
FT                   /locus_tag="YpAngola_A0328"
FT                   /product="tRNA-Gln"
FT   gene            complement(345359..345437)
FT                   /locus_tag="YpAngola_A0329"
FT   tRNA            complement(345359..345437)
FT                   /locus_tag="YpAngola_A0329"
FT                   /product="tRNA-Met"
FT   gene            complement(345469..345543)
FT                   /locus_tag="YpAngola_A0330"
FT   tRNA            complement(345469..345543)
FT                   /locus_tag="YpAngola_A0330"
FT                   /product="tRNA-Gln"
FT   gene            complement(345572..345658)
FT                   /locus_tag="YpAngola_A0331"
FT   tRNA            complement(345572..345658)
FT                   /locus_tag="YpAngola_A0331"
FT                   /product="tRNA-Leu"
FT   gene            complement(345664..345742)
FT                   /locus_tag="YpAngola_A0332"
FT   tRNA            complement(345664..345742)
FT                   /locus_tag="YpAngola_A0332"
FT                   /product="tRNA-Met"
FT   gene            complement(346093..346602)
FT                   /locus_tag="YpAngola_A0333"
FT   CDS_pept        complement(346093..346602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0333"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87028"
FT                   /protein_id="ABX87028.1"
FT                   /translation="MRSGNSKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(346909..348573)
FT                   /gene="asnB"
FT                   /locus_tag="YpAngola_A0334"
FT   CDS_pept        complement(346909..348573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="YpAngola_A0334"
FT                   /product="asparagine synthase B, glutamine-hydrolyzing"
FT                   /EC_number="6.3.5.4"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF00733; match to protein
FT                   family HMM TIGR01536"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87417"
FT                   /protein_id="ABX87417.1"
FT                   /translation="MCSIFGVLELKTDPIELRKKALEMSRFMRHRGPDWSGVWANDKAI
FT                   LAHERLSIVDVNTGAQPLYNAAHTHILAVNGEIYNHQALRQQYSDRYAFQTGSDCEVIL
FT                   ALYQEKGPAFLDDLQGMFAFVLYDTEKDAYLIGRDHLGIIPLYMGHDEHGNMFVASEMK
FT                   ALVPVCRTIKEFPAGSYLWSQDGEIREYYHRDWFDYDHVKDNVTDKIQLANALEDAVKS
FT                   HLMSDVPYGVLLSGGLDSSVISAITKKFAARRVEDNERSEAWWPQLHSFAVGLIGSPDL
FT                   RAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAM
FT                   GIKMVLSGEGSDEVFGGYLYFHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVE
FT                   ARVPFLDKNFLDVAMRINPQDKMCGNGKMEKHILRECFESYLPHSVAWRQKEQFSDGVG
FT                   YSWIDTLKEKAAEQVTDQQMETAHFRFPYNTPGSKEGYLYREIFEELFPLPSAAECVPG
FT                   GPSVACSSAKAIEWDESFKNMDDPSGRAVGVHQDAYK"
FT   gene            complement(348928..349674)
FT                   /gene="nagD"
FT                   /locus_tag="YpAngola_A0335"
FT   CDS_pept        complement(348928..349674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagD"
FT                   /locus_tag="YpAngola_A0335"
FT                   /product="hydrolase NagD"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01460"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86082"
FT                   /protein_id="ABX86082.1"
FT                   /translation="MTIKSVICDIDGVLLHDNTAIKGANDFLARIQDAGMPLVILTNYP
FT                   SQTAQDLTNRFITAGLDVPESAFYTSAMATADFLRRQDGKKAYVIGEGALVHELYKAGF
FT                   TITDINPDFVIVGETRSYNWDMMHKAAYFVANGARFIATNPDCHGFAPACGALCAPIEK
FT                   ISGRKPFYVGKPSPWIIRAALNKMQAHSESTVIVGDNLRTDILAGFQAGLETILVLSGV
FT                   STLTDIDAMPFRPSYVYPSVADIDII"
FT   gene            complement(349747..350973)
FT                   /gene="nagC"
FT                   /locus_tag="YpAngola_A0336"
FT   CDS_pept        complement(349747..350973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagC"
FT                   /locus_tag="YpAngola_A0336"
FT                   /product="N-acetylglucosamine repressor"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88571"
FT                   /protein_id="ABX88571.1"
FT                   /translation="MSTGGQAQIGNVDLVKQLNGAVVYRLIDQQGPISRIQIADLSQLA
FT                   PASVTKITRQLLERGLIKEVDQQASTGGRRAISIVTENRQFHTVAVRLGRNDATITLFD
FT                   MSGKSLGEEHYALPERTQETLEHALFNIISQFIDAYQRKLRELIAIAVILPGLVEQSKG
FT                   IVRYMPHISVSNWPLVDNLQARFNVTSFVGHDIRSLALAEHYFGATRDCEDSILVRLHR
FT                   GTGAGIIVNSQIFLGSNGNVGEIGHIQIDPLGDRCYCGNFGCLETVASNAAIENRVKHL
FT                   LTQGYPSKLSLDDCHIGAICKAANRGDLLACEVIEHVGRYLGKAIAITINLFNPQKVVI
FT                   AGEIIEAEKILLPAIQGCINTQVLKNFRQNLPIVTSQLNHQSAIGAFALAKRAMLNGVL
FT                   LQRLLETHP"
FT   gene            complement(350990..352135)
FT                   /gene="nagA"
FT                   /locus_tag="YpAngola_A0337"
FT   CDS_pept        complement(350990..352135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="YpAngola_A0337"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR00221"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88276"
FT                   /protein_id="ABX88276.1"
FT                   /translation="MYALTHGRIYTSHEVLDNHAVVVADGLIERICPVDELPAGIEICD
FT                   LGGAILAPGFIDVQLNGCGGVQFNDSLEAISAETLDIMQRANEKSGCTSFLPTLITCSD
FT                   EFMKHGVDVMRSYLQKNQHQALGLHLEGPYISPLKKGTHNPAFIRKPSAEMIDYLCANA
FT                   DVITKLTLAPEMVDPKYIQQLTEAGILVSAGHSNATYQQARQGFTAGIRFATHLYNAMP
FT                   YISGREPGLIGAIFDTPEVYTGVIADGLHVDWANIRNAKRLKGEKLVLVTDATAPAGAK
FT                   IEQFIFAGKTIYYRDGLCVDENGTLSGSALTMIEAVQNSVEHVGIALDEALRMATLYAA
FT                   RAIGVDKQLGSIEVGKVANLTAFTRDYKITKTIVNGNEVLS"
FT   gene            complement(352155..352955)
FT                   /gene="nagB"
FT                   /locus_tag="YpAngola_A0338"
FT   CDS_pept        complement(352155..352955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="YpAngola_A0338"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /EC_number="3.5.99.6"
FT                   /note="identified by match to protein family HMM PF01182;
FT                   match to protein family HMM TIGR00502"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85065"
FT                   /db_xref="GOA:A9R7S4"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7S4"
FT                   /protein_id="ABX85065.1"
FT                   /translation="MRLIPLRNTAEVGKWAARHIVNRINAFKPTAERPFILGLPTGGTP
FT                   MEAYKYLIAMHKAGEVSFKHVVTFNMDEYVGLPKEHPESYYTFMHTNFFDHVDIPAENI
FT                   NLLNGNAADIDAECRRYEEKIKSYGKIHLFMGGVGVDGHIAFNEPASSLASRTRIKTLT
FT                   QETRIANSRFFGGDANLVPKYALTVGVGTLLDAEEVMILVTGHGKAQALQAAVEGSINH
FT                   MWTISCLQLHAKAIMVCDEPSTMELKVKTVKYFRELEAENVKDL"
FT   gene            353355..355388
FT                   /gene="nagE"
FT                   /locus_tag="YpAngola_A0339"
FT   CDS_pept        353355..355388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="YpAngola_A0339"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM PF00367; match to protein
FT                   family HMM PF02378; match to protein family HMM TIGR00826;
FT                   match to protein family HMM TIGR00830; match to protein
FT                   family HMM TIGR01998"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86260"
FT                   /protein_id="ABX86260.1"
FT                   /translation="MSILGYLQKVGRALMVPVATLPAAAILMGVGYWIDPVGWGADNAL
FT                   AALFIKSGAAIIENMSVLFAIGVAYGMSKDKDGAAALTGFVGFLVLTTLCSPAAVSMIK
FT                   QIPLDQVPAAFGKIENQFVGILVGIISAELYNRFSGVELPKALSFFSGRRLVPILTSFL
FT                   MIAVAFMLMYIWPLIYNALVTFGEYIKDLGSVGAGIYAFFNRLLIPVGLHHALNSVFWF
FT                   DVAGINDIPNFLGGQESINKGTGIVGITGRYQAGFFPIMMFGLPGAALAIYHCARPENK
FT                   AKVAGIMMAGAFAAFFTGITEPLEFSFMFVAPVLYFLHAVLTGISVFIAASMHWIAGFG
FT                   FSAGLVDMVLSSRNPLATQWYMLIPQGLIFFVIYYLVFRFTIQKFNLLTPGRELAVEGS
FT                   EEDGYDVNVDKTPAVNESEINSLARRYIGAIGGSDNLTAIDACITRLRLNVKDSALVND
FT                   SVAKRLGASGVIRLNKQSVQIIVGTRAELIAAAMRTVLAGGPIPAASSNAAPTGARPQA
FT                   VINTAKTASLVLVSPITGDVVPLAQVPDEAFASKAVGEGVAIRPTDKIVVSPASGTIVK
FT                   IFNTDHAFCLETETGAEIVVHIGIDTVKLNGQGFTRLVEEGTTVVAGQPVLELDLAYLN
FT                   ANAHSMISPVVVSNIDDYAGISLLASGSVVAGQSQLFEIRGK"
FT   gene            355601..356110
FT                   /locus_tag="YpAngola_A0340"
FT   CDS_pept        355601..356110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0340"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86603"
FT                   /protein_id="ABX86603.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(356273..357376)
FT                   /locus_tag="YpAngola_A0341"
FT   CDS_pept        complement(356273..357376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0341"
FT                   /product="sugar-binding transcriptional regulator, LacI
FT                   family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86897"
FT                   /protein_id="ABX86897.1"
FT                   /translation="MAGIALHCRSPFEWPGFSRQGISMEKIRKRRNTGRVTLQEVADYA
FT                   GVGSMTVSRALRTPEQVSDKLREKIEQAVEKLGYIPNRAAGALASGHSDTVAVLIPSLT
FT                   DKASSRFMQALQQILNKNEFQLLLGCHEYNQRKEAEILMTLLQSHPAAVVIFGSQLADK
FT                   TYQILERTNIPIVNVVGSYFKGAKITLEAAFFESAYELTRHLLERGYQHIGYLGAHRDN
FT                   QLQRQQLNGWHKSMLEHYKNADQTVTTPDAASLQFGRYALTEILLRQPELDAVICSHED
FT                   IALGVLFECQRRLLKIPSGIAVACLDGSESCDQTHPTLTSMRIDYKKMGKEAGKMLIDM
FT                   LNEDDAGVKSVPLSQSFNYKFEPRQST"
FT   gene            357634..358077
FT                   /gene="cmtB"
FT                   /locus_tag="YpAngola_A0342"
FT   CDS_pept        357634..358077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmtB"
FT                   /locus_tag="YpAngola_A0342"
FT                   /product="mannitol-specific cryptic phosphotransferase
FT                   enzyme IIA component"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87695"
FT                   /protein_id="ABX87695.1"
FT                   /translation="MLKTLLTSDVIQVVSQAKDWRDAIAISCQPLIDNGAVEARYVEAI
FT                   YRSHEAIGPYYVVGPGIAMPHARPEDGVNRLSLALTVITEGVTFNAEGNDPVKLLIVLA
FT                   ATDSNSHIEAISQLAQLFDTASDVQALLNAKTPQDILSVIARY"
FT   gene            358246..358533
FT                   /locus_tag="YpAngola_A0343"
FT   CDS_pept        358246..358533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0343"
FT                   /product="PTS system, lactose/cellobiose specific IIB
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86882"
FT                   /protein_id="ABX86882.1"
FT                   /translation="MKITVVCGNGLGTSLMMEISIKSILKELAVSAEVDHVDLGSAKGT
FT                   PSDIFIGTKDIAEQLVAQAVGGKIVALDNMIDKKAMKERLSAALTELGAL"
FT   gene            358546..359802
FT                   /locus_tag="YpAngola_A0344"
FT   CDS_pept        358546..359802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0344"
FT                   /product="putative sugar-specific permease, SgaT/UlaA
FT                   family"
FT                   /note="identified by match to protein family HMM PF04215"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87319"
FT                   /protein_id="ABX87319.1"
FT                   /translation="MDFFRFLMSDVLSEPAILVGLIALIGLIAQKKPVTECIKGTVKTI
FT                   MGFVILGAGAGLVVSSLGDFANIFQQAFGIQGVVPNNEAIVSVAQKSFGKEMAMIMFFA
FT                   MVINILIARFTPWKFIFLTGHHTLFMSMMVAVILATAGLSGMMLIAIGSVVVGVAMVFF
FT                   PAIAHPYMKKVTGSDDVAIGHFSTLSYVLAGFIGSKFGNKEHSTEDMNVPKSLLFLRDT
FT                   PVAISFTMCIIFVVTCLFAGPEVVKSLSGGKNWFMFSLMQSITFAAGVYIILQGVRMVI
FT                   AEIVPAFKGISDKLVPNAKPALDCPVVFPYAPNAVLVGFLSSFAAGLIGMFALYLLNMT
FT                   VIIPGVVPHFFVGAAAGVFGNATGGRRWAILGAFAQGLLITFLPVFLLPVLGDIGFANT
FT                   TFSDADFGALGILLGIIVR"
FT   gene            complement(359919..360467)
FT                   /locus_tag="YpAngola_A0345"
FT   CDS_pept        complement(359919..360467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0345"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87877"
FT                   /protein_id="ABX87877.1"
FT                   /translation="MVEQNPAAVIEWVDIVDEQNNVIAQSSRQQMRAQRLRHRATYIVV
FT                   HDGMGKILVQRRTESKDFHPGKLDATAGGVVQSGENYLESARREAEEELGIAGVPFAEH
FT                   GQFYFEEECCRVWGALFSCVSHGPFALQPEEIDEVCWMVPEEITARCDEFTPDSLKALS
FT                   LWLTRNNEQDYGKITPREA"
FT   gene            360536..360688
FT                   /locus_tag="YpAngola_A0346"
FT   CDS_pept        360536..360688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87888"
FT                   /protein_id="ABX87888.1"
FT                   /translation="MLFLINDLILLPDAVIGELAAASLTPVSAWAFTQLPPSYNSHYWG
FT                   IKAVY"
FT   gene            complement(360689..361240)
FT                   /locus_tag="YpAngola_A0347"
FT   CDS_pept        complement(360689..361240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0347"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00040"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86473"
FT                   /protein_id="ABX86473.1"
FT                   /translation="MKLMFASDLHGSLPATERVLAIFDHSGAQWLVLLGDLLNHGPRNA
FT                   LPEGYQPAAVAESLNAYKDSIIAVRGNCDSEVDQMLLQFPIMAGWQQIIMPETRLFLTH
FT                   GHLYHPGALPPLRHGDVLAYGHTHLPQAQWQGDIICFNPGSVSIPKGEYPASYGMLDKG
FT                   VLQVLTLQGDEIVARLALKN"
FT   gene            complement(361428..362120)
FT                   /locus_tag="YpAngola_A0348"
FT   CDS_pept        complement(361428..362120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0348"
FT                   /product="cyclic diguanylate phosphodiesterase (EAL) domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86795"
FT                   /protein_id="ABX86795.1"
FT                   /translation="MKLNIKVNCSYICEPIRKQDGRLLAVELLSRFSATPVDLPIDVEK
FT                   FINELDINGKNDLFQNQLQAVKAYSDWFITNNVLLSINIDFDLASVIVTDAPTRQLLDE
FT                   MPFLRLEIMETFSNLSDGMNNPLLRELASLYPLWLDDLGSGGSTLNAVTANIFEYIKID
FT                   KHFFWQHNKHTFPILINNIKKYCLGVIVVGVENQGESEQLAGSNIDAMQGYLFNPMTLD
FT                   ELVSQPLR"
FT   gene            362474..363382
FT                   /locus_tag="YpAngola_A0349"
FT   CDS_pept        362474..363382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0349"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF08338; match to protein family HMM TIGR01777"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86281"
FT                   /protein_id="ABX86281.1"
FT                   /translation="MRILITGATGLIGRSLTPFLLSQGHQITALTRSLQRANNLLGQQV
FT                   TYWPTLDDQEDLNSFDAVINLAGEPIAEKRWTSQQKEILCQSRWQITERLATLINASSQ
FT                   PPTVFISGSAVGFYGDQGQALVTEEEPPHDEFTHQLCERWENLALAAESSHTRVCLLRT
FT                   GVVLAPEGGALAKMLPLFRLGLGGPMGDGRQYLPWIHLEDMVQGIYYLLTTHNLRGPFN
FT                   MVAPYPVHNEQFTATLADVLDRPAAIRTPAAAIRLLMGESAILVLGGQRALPKRLEEAG
FT                   FGFRYYELEDALRDVLKKPKE"
FT   gene            complement(363498..364295)
FT                   /gene="hisP"
FT                   /locus_tag="YpAngola_A0350"
FT   CDS_pept        complement(363498..364295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisP"
FT                   /locus_tag="YpAngola_A0350"
FT                   /product="histidine ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86693"
FT                   /protein_id="ABX86693.1"
FT                   /translation="MTNTSYIKNAETKLSVTELHKHYGEHEVLKGVSLSANAGDVISII
FT                   GSSGSGKSTFLRCINFLEKPSEGSISVNNQVIRLVRDSDGQLKVFDKKQLQLLRTRLTM
FT                   VFQHFNLWSHMTVLENVMEAPVQVLGLSKSVAKERAILYLDKVGIDERARAKYPVHLSG
FT                   GQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQKLAEEGKTMVVVTHEMEF
FT                   ARHVSSHVIFLHKGVIEEEGPPAELFGNPKSPRLQQFLSGSLK"
FT   gene            complement(364309..365025)
FT                   /gene="hisM"
FT                   /locus_tag="YpAngola_A0351"
FT   CDS_pept        complement(364309..365025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisM"
FT                   /locus_tag="YpAngola_A0351"
FT                   /product="histidine ABC transporter, permease protein HisM"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85168"
FT                   /protein_id="ABX85168.1"
FT                   /translation="MIEILHQYWQALLWSDGYRFTGMAVTLWLLISSVVMGGLLALPLA
FT                   VARVSERRWIRLPVWIFTYIFRGTPLYVQLLVFYSGMYSLEIIRGNDLLNAFFRSGLNC
FT                   TILALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSRFKLYRCIILPAASRISLPAY
FT                   SNEVILMLHSTALAFTATVPDILKIARDINAATYQPFYAFSIAAVLYLSISFTLISLFR
FT                   QAEKRWLAHIQPQASH"
FT   gene            complement(365022..365708)
FT                   /gene="hisQ"
FT                   /locus_tag="YpAngola_A0352"
FT   CDS_pept        complement(365022..365708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisQ"
FT                   /locus_tag="YpAngola_A0352"
FT                   /product="histidine ABC transporter, permease protein HisQ"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85571"
FT                   /protein_id="ABX85571.1"
FT                   /translation="MLDGYSKLIFEGALVTLELALFSVLLSVVIGLMGAGGKLSSNRLV
FT                   SGLFECYTTLIRGVPDLVLMLLIFYGLQITLNSITESLGFVQIDIDPLSAGVITLGFIY
FT                   GAYFTETFRGAYMAVSKGQIEAATAFGFTSSQIFRRIMFPAMMRYALPGIGNNWQVILK
FT                   ATALVSILGLNDVVKATQLAGKGTYQPFFFALVAGAIYLFFTTLSNGVLWWLERRYSHG
FT                   VKRAEL"
FT   gene            complement(365811..366719)
FT                   /gene="hisJ"
FT                   /locus_tag="YpAngola_A0353"
FT   CDS_pept        complement(365811..366719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisJ"
FT                   /locus_tag="YpAngola_A0353"
FT                   /product="histidine ABC transporter, periplasmic
FT                   histidine-binding protein"
FT                   /note="identified by match to protein family HMM PF00497;
FT                   match to protein family HMM TIGR01096"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88055"
FT                   /protein_id="ABX88055.1"
FT                   /translation="MELIFPPDNYWHDYCKLIYGRSGLDRNLTRFVASKINLRVMFMNK
FT                   KLRVLPLVFAFAAASSAFAAIPKEIKIGTDPTYAPFESKNSSGELVGFDIDIAKELCKR
FT                   IDTKCTFVESDFDALIPSLKAKKVDAIISSLSITEKRQKEIAFTDKLFAANSRLIAAKG
FT                   STIEPTLVALKGKRVGVLQGSTQEAFANAEWQPKGIDVVAYQNQDLIYADLASGRIDAA
FT                   FQDEVAASEGFLKQPVGKDYIFAGPSVKNDQFFGVGTGMGLRKADVELKEALNKAFAEM
FT                   RNDGTYDQFAKKYFDFDVYGD"
FT   gene            complement(367118..367705)
FT                   /gene="ubiX"
FT                   /locus_tag="YpAngola_A0354"
FT   CDS_pept        complement(367118..367705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="YpAngola_A0354"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /EC_number="4.1.1.-"
FT                   /note="identified by match to protein family HMM PF02441;
FT                   match to protein family HMM TIGR00421"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88478"
FT                   /protein_id="ABX88478.1"
FT                   /translation="MRQFSMKRLIIGISGASGAIYGVRLLQVLQHVEGVETHLIISNAA
FT                   RQTLALETDYSVKDVQEFADVVHDFRDIAACISSGSFKTDGMVILPCSIKTLSGIVHSY
FT                   TDGLLTRAADVILKERRRLVLCVRETPLHLGHLRLMVQAAELGAVIMPPMLAFYHQPQT
FT                   IQDIIDQTVNRIIDQFDIELPKDLFTRWQGKN"
FT   gene            complement(367937..369454)
FT                   /gene="purF"
FT                   /locus_tag="YpAngola_A0355"
FT   CDS_pept        complement(367937..369454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="YpAngola_A0355"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88272"
FT                   /protein_id="ABX88272.1"
FT                   /translation="MCGIVGIAGFTPVNQSIYDALMVLQHRGQDAAGIVTIDAHNGFRL
FT                   RKANGLVKDVFETRHMLRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPFGITLAHNGN
FT                   LTNAHQLRKKLFEVSRRHVNTTSDSEILLNIFASELDRFQHYPLESDNIFAAVAATHQL
FT                   IRGAYACVAMIIGHGMVAFRDPNGIRPLVIGKRTLADGRNEYMVASESVALDTLDFEFL
FT                   RDVAPGEAVYITEKGQLFTRQCAENPKYNPCLFEYVYFARPDSFMDKISVYSARVRMGQ
FT                   KLGTKIAKQWEDMDIDVVIPIPETSCDIALEIARILDKPYRQGFVKNRYVGRTFIMPGQ
FT                   QERRKSVRRKLNANRAEFRGKNVLLVDDSIVRGTTSEQIVEMAREAGAKKVYFASAAPE
FT                   IRFPNVYGIDMPSANELIAHGREVDEIRQLIGADALIFQDLTDLIDAVREDNPDITQFE
FT                   CSVFNGIYVTKDVDQSYLEYLESLRNDDAQALRSHNEAENLEMHNEG"
FT   gene            complement(369467..369976)
FT                   /gene="cvpA"
FT                   /locus_tag="YpAngola_A0356"
FT   CDS_pept        complement(369467..369976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /locus_tag="YpAngola_A0356"
FT                   /product="colicin V production protein"
FT                   /note="identified by match to protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87978"
FT                   /protein_id="ABX87978.1"
FT                   /translation="MVWIDYVIIGIIGFSALVSLIRGFVREALSLVTWGCAFFVASHFY
FT                   TYLAVYFTRFEDEIVRNGIAIGILFIATLIVGAIVNYVISSLVERTGLSGTDRVLGVCF
FT                   GALRGVLIVSAMLFFLDTFTGFSQSVDWKQSQLIPQFSYIIRWFFDYLQSTSSFLPNQL
FT                   PIRSGL"
FT   gene            complement(370303..371025)
FT                   /locus_tag="YpAngola_A0357"
FT   CDS_pept        complement(370303..371025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0357"
FT                   /product="sporulation and cell division repeat protein"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86639"
FT                   /protein_id="ABX86639.1"
FT                   /translation="MASQFQNRLVGTIILVALGVIVLPGLLDGKKKHYEDEFAAIPLVP
FT                   KPGDSQEIDVVPPLNQPLPITPPEGAAQAVGAELNDDSVSQAANDAGNLAVEPTIVAPP
FT                   PIQSKPVEVKPTVTKPVDVKPTETKPIETKPAEKKPLEVKPKPEIKPPVEEKAPVGQAY
FT                   VVQLGALKNAAKVNEIVAMLRLSGHRAFTVPATPVQGEITRLYVGPDASKQKLQSALPE
FT                   LNALSGLNGQVKPYTTSR"
FT   gene            complement(371145..372449)
FT                   /gene="folC"
FT                   /locus_tag="YpAngola_A0358"
FT   CDS_pept        complement(371145..372449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="YpAngola_A0358"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /EC_number="6.3.2.12"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86943"
FT                   /protein_id="ABX86943.1"
FT                   /translation="MNNHQTPQATSPLAAWLCYLEHLHSQPIELGLERVKQVAERLDLL
FT                   KPAPKIFTVAGTNGKGTTCCTLEAILLAAGLRVGVYSSPHLLRYTERVRIQGQELSEAE
FT                   HSHSFAQIEAGRGDISLTYFEFGTLSALQLFKQAKLDVVILEVGLGGRLDATNIVDSDV
FT                   AAITSIALDHTDWLGYDRESIGREKAGVFRGGKPAVVGEPDMPQSIADVAAELGAQLYR
FT                   RDVAWKFSQQEPFDQQEPVDQQINGWHWQCGERQLTGLPVPNVPLANAATALAVLHYSE
FT                   LPLSDEAIRQGLQAASLPGRFQVVSEQPLLILDVAHNPHAARYLVNRLAQVINPVNASK
FT                   QGKVRAVVGMLSDKDIAGTLACLSERVDEWYCAPLEGPRGASAGQLAEHLVSARQFSDV
FT                   ETAWRQAMQDADTQDVVIVCGSFHTVAHVMAALHL"
FT   gene            complement(372698..373612)
FT                   /gene="accD"
FT                   /locus_tag="YpAngola_A0359"
FT   CDS_pept        complement(372698..373612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="YpAngola_A0359"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM TIGR00515"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85339"
FT                   /db_xref="GOA:A9R7U5"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7U5"
FT                   /protein_id="ABX85339.1"
FT                   /translation="MSWIERILNKSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNL
FT                   EVCPKCDHHMRMSARARLHMLLDAGSEVELGSELEPKDILKFRDSKKYKDRISAAQKDT
FT                   GEKDALVAMKGTLQGMPIVAASFEFAFMGGSMASVVGARFVRAVEQALEDNCPLVCFSS
FT                   SGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASLAMLGDINIAE
FT                   PKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPVMRQTLASILSKLTH
FT                   QPQPSVVESKADTVAQPENQADV"
FT   gene            complement(373843..374505)
FT                   /locus_tag="YpAngola_A0360"
FT   CDS_pept        complement(373843..374505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0360"
FT                   /product="DedA protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87201"
FT                   /protein_id="ABX87201.1"
FT                   /translation="MEFIRFVIDFILNIDVHLAELVAQYGIWVYAILFLILFCETGLVV
FT                   TPFLPGDSLLFVAGALASLPSNDLNVHTMVTLMVIAAILGDAINYTIGRIFGEKLFSNP
FT                   DSKIFRRSYLDKTHQFYEKHGGKAIILARFVPIIRTFAPFVAGMGKMSYRHFAAYNVIG
FT                   ALVWVLLFTYAGYLFGNVPIVQNNLKLLIVIIIVVSILPGVFEVWRHRRAAVRQKNQ"
FT   gene            complement(374662..375543)
FT                   /gene="truA"
FT                   /locus_tag="YpAngola_A0361"
FT   CDS_pept        complement(374662..375543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="YpAngola_A0361"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85909"
FT                   /protein_id="ABX85909.1"
FT                   /translation="MSGFELDQEETLVQQNTLAQQEKPAEVAGLKIALGIEYNGSRYFG
FT                   WQRQQEVASVQACLEAALSKVANEPIGVFCAGRTDAGVHATGQVVHFVTSAVRKDAAWT
FT                   MGVNSHLPADIAVRWVKTVDNDFHARFSATARRYRYIIFSHRYRPAILAQGVTHCYMPL
FT                   DAEKMERAAQCLLGENDFTSFRAVQCQSRTPWRNVKHVKVTRHGAYIVVDIKANAFVHH
FT                   MVRNIVGSLIEIGCGNQDVTWMAELLALKDRTRAAATAKADGLYLVSVDYPDHFALPKV
FT                   PMGPLFLADDEG"
FT   gene            complement(375543..376553)
FT                   /locus_tag="YpAngola_A0362"
FT   CDS_pept        complement(375543..376553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0362"
FT                   /product="aspartate-semialdehyde dehydrogenase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86302"
FT                   /protein_id="ABX86302.1"
FT                   /translation="MSDGWNIALLGATGAVGEALLELLNERQFPVGELYPLASERSAGA
FT                   TVRFNGKSILVENVAEFDWSQAQLAFFVAGREASAQYAEEAGNAGCLVIDSSGLFAMEP
FT                   DIPLVVPSVNPQVLADYRNRNIVAVADSLTSQLLTAIKPLTEQAGLSRLHVTNLISASA
FT                   HGKAAVDDLAGQSAKLLNGIPAEPGIFPKQLAFNVLPLLADEEGSVSEERRLVDQVRKV
FT                   LQDEGLPITVSCIQSPVFYGHAQVVHLEALRPIAAEEARSELENCDDIQLSEEDDYPTQ
FT                   VSDASGSDALSIGCVRNDYGIPEVLQFWSVADNIRFGGALMAIQTAERLLQEQLY"
FT   gene            376781..377290
FT                   /locus_tag="YpAngola_A0363"
FT   CDS_pept        376781..377290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0363"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84899"
FT                   /protein_id="ABX84899.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(377433..378560)
FT                   /gene="pdxB"
FT                   /locus_tag="YpAngola_A0364"
FT   CDS_pept        complement(377433..378560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxB"
FT                   /locus_tag="YpAngola_A0364"
FT                   /product="erythronate-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85406"
FT                   /db_xref="GOA:A9R7V0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR020921"
FT                   /db_xref="InterPro:IPR024531"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038251"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7V0"
FT                   /protein_id="ABX85406.1"
FT                   /translation="MKILVDENMPYAEELFRRLGDVQAVPGRPIPRDALVDADALMVRS
FT                   VTKVNEALLHGTSIGFVGTATAGTDHVDDTWLRQQGIGFSAAPGCNAIAVVEYVFSALM
FT                   MMAERDGFQLRDKTVGIIGVGNVGSRLNARLQALGVRTLLCDPPRADRGDNEAFWPLEK
FT                   LVREADVLTFHTPLNKTGAYQSLHMADDELLAALPDGRILINACRGAVVDNAALLRALE
FT                   KGKKLSVVLDVWEPEPDLSLPLLARVDIGTPHIAGYTLEGKARGTTQVFEAFSQHLGQP
FT                   QSVELASLLPVPEFSHLRLNGELDEGKLKRLMHLVYDVRRDDAPLRHVAGLPGEFDRLR
FT                   KHYQERREWSSLCVQCDDATSAGLLQQLGFTTQLL"
FT   gene            complement(378607..379392)
FT                   /locus_tag="YpAngola_A0365"
FT   CDS_pept        complement(378607..379392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0365"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88171"
FT                   /protein_id="ABX88171.1"
FT                   /translation="MTEPDFPVVTSRIPQTLSFRCEAFNANTEFLPHTHPFGQLICVKS
FT                   GVLAMSIGGQRFLAPPEFIVWIPAGMEHSSYNRKPMHFRAIDIALDFCTELPASPGLMN
FT                   VSPIFNAIVEDCFTRDLLMPETQQDRRLAHVLIDQLKVSPVQRTYLPTSQDKLLSPILA
FT                   ALERCPADSTSLALWAKRVYTTERTLSLRCQQELGMAFSEWRQRLRFLHAISLLEQGKT
FT                   VNSVALDVGYSSASAFIAMFQQISGTTPERFRRGNSGLY"
FT   gene            complement(379379..379519)
FT                   /locus_tag="YpAngola_A0366"
FT   CDS_pept        complement(379379..379519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0366"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88333"
FT                   /protein_id="ABX88333.1"
FT                   /translation="MTWVIKTITWVMKTFITEIKTVITEIKAITMKSIILLRGIMDDDR
FT                   T"
FT   gene            379597..380514
FT                   /locus_tag="YpAngola_A0367"
FT   CDS_pept        379597..380514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0367"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87924"
FT                   /protein_id="ABX87924.1"
FT                   /translation="MNVLFPLFAVIIWSVNAVVSKISATAIDPAAISFYRWLLALLTLS
FT                   PFLLLGVVRNWQAIRVYWWKLMLLGMLGMVLYQSLAYYAAHSVSALFMGILSSLIPLLT
FT                   VLISIVLLRVAPTVGIALGSLLSLGGLVWLISAGNPVQLLQHGIGKGELMMLGASASYA
FT                   LYGVLTKRWAIQLPNWQSLYMQIVFGVVLLLPGFLMTPDVQLTAQNIPLVLFAGIPASI
FT                   LAPYLWIQGVMRLGANTASIFMNLTPVFTAIIAVVFLHEQLHSYHLIGGGITLAGVVLA
FT                   QRLRSPLRRNLDLAGHIPNNKNSR"
FT   gene            380799..381836
FT                   /locus_tag="YpAngola_A0368"
FT   CDS_pept        380799..381836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0368"
FT                   /product="Div protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87285"
FT                   /protein_id="ABX87285.1"
FT                   /translation="MQPLNGPGVPIGNDRHITPTKLTAQSTVEDQALTPAQRTTLEKLI
FT                   VRIMALSPVKSAEIWAGLRHNLSLDATGDLLARHFQPAEQLLQTRLSQAQENHASQQLR
FT                   QQLTALLPQGNNRQAVSDFIRQQFGHTVLSQLSHTELQQVLVLLQSGTLNIPQPQLTTL
FT                   TDRPLLPAEHQNIQSLVAKLSAATGEQPTKIWQTLFDMVGVKHHDPLPARHFQLLSQFL
FT                   QTKVALSQQTAPTLVNLQTALKQPADAQEQQLLADYSQNRFQASPTTPLTQAQLNDIIN
FT                   ILFAARLEKANAAQYLDEEHKPLQPLINPFIASLPESLQPLLQKPSLVVVALIIVIAFL
FT                   LAIFL"
FT   gene            complement(382170..382700)
FT                   /locus_tag="YpAngola_A0369"
FT   CDS_pept        complement(382170..382700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0369"
FT                   /product="fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86869"
FT                   /protein_id="ABX86869.1"
FT                   /translation="MSNFKKSVLVAAVLSLSAFAANAADQGKGKVTFTGSIIEAPCSIT
FT                   SEAADQVVELGQISTTSLANMGSSEPRSFSIGLEKCDVATMKNVSVTFDGTPDGVDAEM
FT                   LKLIGLADGAGIVITDEAGATIKRGVASVGKTLDQGSNSLKFSAYLKGTSADEGSVVPG
FT                   EFSSVANFTLAYN"
FT   gene            383488..384183
FT                   /locus_tag="YpAngola_A0370"
FT   CDS_pept        383488..384183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0370"
FT                   /product="aspartate racemase family protein"
FT                   /note="identified by match to protein family HMM PF01177;
FT                   match to protein family HMM TIGR00035"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86730"
FT                   /protein_id="ABX86730.1"
FT                   /translation="MMKILGLIGGMSWESTIPYYRMINQHVKAQLGGLHSAKIILYSVD
FT                   FHEIEQLQAKGDWQTAAQLLSNAAISLKHAGAEVIVVCTNTMHKVADDIEAACGLPLLH
FT                   IADATAVQIKQQGIDKIGLLGTRYTMEQGFYRGRLTEKHGIEVITPDDTDREAVNRIIY
FT                   EELCLGIISETSRDAYRRVIKKLEAQGVQGIIFGCTEITLLVNAQDASVPVFDTTAIHA
FT                   SAAADYALQ"
FT   gene            complement(384591..385814)
FT                   /gene="fabB"
FT                   /locus_tag="YpAngola_A0371"
FT   CDS_pept        complement(384591..385814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="YpAngola_A0371"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86085"
FT                   /protein_id="ABX86085.1"
FT                   /translation="MKRAVITGLGIVSSIGNNQQEVLASLQEGRSGITFAQEFKDAGMR
FT                   SHVWGDVKLQSEPKDLIDRKVLRFMSDASIYAYLAMQEAIADSGLSDSQVSNFRSGLVV
FT                   GSGGGSPRNQVAGSDAMRTPRGLKGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSA
FT                   CATSAHCIGHALELIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPAKASRT
FT                   YDQDRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
FT                   MQMAMAGVDTPIDYMNVHGTSTPVGDVKELGAIREVFGNNTPAISSTKAMTGHSLGAAG
FT                   VHEAIFSLLMVEHGFIAPSINIDNLDEQAQGMNIITETTQRELTTVMSNSFGFGGTNAT
FT                   LVMRKYQK"
FT   gene            385986..388055
FT                   /locus_tag="YpAngola_A0372"
FT   CDS_pept        385986..388055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0372"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF05430; match to protein
FT                   family HMM TIGR03197"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85642"
FT                   /db_xref="GOA:A9R7V8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7V8"
FT                   /protein_id="ABX85642.1"
FT                   /translation="MNQRPIQTATLSWNEQGTPVSEQFGDIYFSNEDGLEETHHVFLKG
FT                   NGFPARFASHPQQSCIFAETGFGTGLNFLTLWRDFALFRQQSPNATLRRLHYISFEKYP
FT                   LHVADLASAHARWPELASFAEQLRAQWPLPLAGCHRILLADGAITLDLWFGDVNTLLPT
FT                   LDDSLNNQVDAWFLDGFAPAKNPDMWNEQLFNAMARMTRPGGTFSTFTAAGFVRRGLQQ
FT                   AGFNVTKVKGFGQKREMLTGTLPQQIHAPTAPWYHRPAATRCDDIAIIGGGIVSALTAL
FT                   ALQRRGAVVTLYCADAQPAQGASGNRQGALYPLLNGKNDALETFFTSAFTFARRQYDQL
FT                   LEQGIAFDHQWCGVSQLAFDDKSRGKIEKMLHTQWPVEFAEAMSREQLSELAGLDCAHD
FT                   GIHYPAGGWLCPSDLTHALMMLAQQNGMTCHYQHELQRLKRIDSQWQLTFGQSQAAKHH
FT                   ATVILATGHRLPEWEQTHHLPLSAVRGQVSHIPTTPVLSQLQQVLCYDGYLTPVNPANQ
FT                   HHCIGASYQRGDIATDFRLTEQQENRERLLRCLPQVSWPQQVDVSDNQARCGVRCAIRD
FT                   HLPMVGAVPDYAATLAQYQDLSRRIQHGGESEVNDIAVAPVWPELFMVGGLGSRGLCSA
FT                   PLVAEILAAQMFGEPLPLDAKTLAALNPNRFWIRKLLKGRPVQTRSPATQESSR"
FT   gene            complement(388233..388511)
FT                   /locus_tag="YpAngola_A0373"
FT   CDS_pept        complement(388233..388511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08891"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85387"
FT                   /protein_id="ABX85387.1"
FT                   /translation="MIAEFETRILAQIDDMVEHASDDDLFAGGYLRGHLTLAVAEAEEH
FT                   GEHSAEQLHARVQTSLEKAIKAGELSPPDQVLVLGLWDRLLAHALRS"
FT   gene            complement(388569..389111)
FT                   /locus_tag="YpAngola_A0374"
FT   CDS_pept        complement(388569..389111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04315"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88193"
FT                   /protein_id="ABX88193.1"
FT                   /translation="MNHHYQQLIDIFNTCFSGEYNTHLVKGDDEPIYLPADEESPHHRV
FT                   IFAHGYYASAMHEISHWCIAGEERCKQVDFGYWYCPDGRDALTQSQFEAVEIKPQALEW
FT                   MFCVAAGFPFNVSCDNLEGDCEPDRIIFQRKVREQVLWLLDQGISTRPQGFIQALQSFY
FT                   NTPPLAPELFPYPEDLI"
FT   gene            complement(389211..390017)
FT                   /locus_tag="YpAngola_A0375"
FT   CDS_pept        complement(389211..390017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0375"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87776"
FT                   /protein_id="ABX87776.1"
FT                   /translation="MDWFTLGPAVLGILFAVALLAGFIDSIAGGGGLLTVPALLAVGLP
FT                   PAQALATNKLQSVGGSFSASLYFIRRGAVNLKQQKLTIALTLVGSMLGAILVQYMRADI
FT                   LRQILPLLVIGIGVYFLLTPRLGVVDQQRRLSALPFALIAGGGIGFYDGFFGPGAGSFY
FT                   ALAFVTLCGFNLAKSTAHAKVLNFTSNLGGLIFFIIGGKVVWSIGLVMLVGQVLGARLG
FT                   AHMVLTRGQKLIRPMIVVVSFVMSCKLLYDNHGAEIGSWLGQHVFA"
FT   gene            complement(390021..390827)
FT                   /locus_tag="YpAngola_A0376"
FT   CDS_pept        complement(390021..390827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0376"
FT                   /product="peptidoglycan amidase MepA"
FT                   /note="identified by match to protein family HMM PF03411"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88549"
FT                   /protein_id="ABX88549.1"
FT                   /translation="MVALVTMVPVMAATPWQKITHPVAGSPQSIGGFANGCVIGAQPLP
FT                   LESADYQVMRSDQRRYFGHPDLLNFIHRLSAQAHQQQLGTVLIGDMAMPAGGRFSSGHA
FT                   SHQSGLDVDIWLQLPKQRWSQQQLLKPQPIDLVAVDGKRVIPALWQPQIESLIKLAAKD
FT                   NDVTRIFVNPAIKKQLCLDAGADRQWLHKVRPWFAHRAHMHVRLRCPANSLECVDQDTP
FT                   PPGDGCGAELESWFQPPPPSAKPGKTLPPPLPPSCQALLDNHFATE"
FT   gene            complement(390854..391939)
FT                   /gene="aroC"
FT                   /locus_tag="YpAngola_A0377"
FT   CDS_pept        complement(390854..391939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="YpAngola_A0377"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="identified by match to protein family HMM PF01264;
FT                   match to protein family HMM TIGR00033"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88190"
FT                   /db_xref="GOA:A9R7W3"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7W3"
FT                   /protein_id="ABX88190.1"
FT                   /translation="MAGNSIGQFFRVTTFGESHGIALGCIIDGVPPGIPITEADIQLDL
FT                   DRRRPGTSRYTTQRRELDQVRILSGVFEGVTTGTSIGLMIENTDQRSQDYSAIKDVFRP
FT                   GHADYTYEQKYGVRDYRGGGRSSARETAMRVAAGAIAKKYLAQKFGVQVRGYLAQMGDV
FT                   SCDLLDWDLVEQNPFFCPDASKLEPLDALMRELKKAGDSIGAKITVVAENVPVGLGEPV
FT                   FDRLDADLAHALMSINAVKGVEIGDGFAVVTKRGSENRDEITPQGFQSNHAGGILGGIS
FT                   SGQPVVAHIALKPTSSIMVPGQTINRQGEAVEMVTRGRHDPCVGIRAVPIAEAMMAIVL
FT                   MDHLLRQRAQCGDVASDVPRW"
FT   gene            complement(392016..392948)
FT                   /locus_tag="YpAngola_A0378"
FT   CDS_pept        complement(392016..392948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0378"
FT                   /product="methyltransferase, HemK family"
FT                   /note="identified by match to protein family HMM PF05175;
FT                   match to protein family HMM TIGR00536; match to protein
FT                   family HMM TIGR03386"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87663"
FT                   /protein_id="ABX87663.1"
FT                   /translation="MDKIFVDEAVNELHTIQDMLRWTVSRFNAANIFYGHGTDNPWDEA
FT                   VQLVFPSLFLPLDIPEDIRSSRLTSSERHRIVERVIRRVNERIPVAYLTNKAWFCGMEY
FT                   YVDERVLVPRSPIGELIENRFDGLIHHQPNHILDMCTGSGCIAIACAYAFPDAEVDAVD
FT                   ISNDVLAVTEHNIQQHGMEHQVTPIRSDLFRDLPPIKYDLIVTNPPYVDAEDMADLPQE
FT                   FRFEPELGLAAGSDGLKLARRILACAPDFLQDDGVLICEVGNSMVHLMDQYPDVPFTWL
FT                   EFEKGGDGVFMLTKQQLIDCAAHFSMYRD"
FT   gene            393318..393848
FT                   /locus_tag="YpAngola_A0379"
FT   CDS_pept        393318..393848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0379"
FT                   /product="Smr domain protein"
FT                   /note="identified by match to protein family HMM PF01713"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86395"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR022990"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7W5"
FT                   /protein_id="ABX86395.1"
FT                   /translation="MKKKYHLTPDELQLFKESIAGAKKLRQDTIVHHTPPKLGKKIAPE
FT                   RLLQEQVDASYYFSDEFQPLLDTDGPTRYVRPGVDNFEVKKLRRGDYSPEMFLDLHGLT
FT                   QKQAKQELGALIAACKREHVHCACVMHGHGKHVLKQQTPLWMAQHPDVLAFHQAPKEWG
FT                   GTAALLLLIELEE"
FT   gene            complement(394111..394602)
FT                   /gene="sixA"
FT                   /locus_tag="YpAngola_A0380"
FT   CDS_pept        complement(394111..394602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sixA"
FT                   /locus_tag="YpAngola_A0380"
FT                   /product="phosphohistidine phosphatase SixA"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF00300;
FT                   match to protein family HMM TIGR00249"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85838"
FT                   /protein_id="ABX85838.1"
FT                   /translation="MQVFIMRHGDAALDAASDAQRPLTLCGQDESRQIASWLSEQSVDI
FT                   DQILVSPYLRARQTLEVVREVMALPAEPEVMPELTPGGDAAFICSYLQALAKEDCAAVL
FT                   VISHLPLVGYLVAELCPGQCPPMFATSAIACIDLNGKSEKGTLDWQVSPSQLLAKACHG
FT                   "
FT   gene            394651..394788
FT                   /locus_tag="YpAngola_A0381"
FT   CDS_pept        394651..394788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85331"
FT                   /protein_id="ABX85331.1"
FT                   /translation="MLYRRNPCPQAKKLHNDNAPSLYGGRAFCLKLNLKKMAVFLPRED
FT                   "
FT   gene            complement(395157..397484)
FT                   /gene="fadJ"
FT                   /locus_tag="YpAngola_A0382"
FT   CDS_pept        complement(395157..397484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadJ"
FT                   /locus_tag="YpAngola_A0382"
FT                   /product="fatty oxidation complex, alpha subunit FadJ"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="5.1.2.3"
FT                   /note="identified by match to protein family HMM PF00378;
FT                   match to protein family HMM PF00725; match to protein
FT                   family HMM PF02737; match to protein family HMM TIGR02440"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85036"
FT                   /protein_id="ABX85036.1"
FT                   /translation="MMSKENIVTRENTAVSENAVSEPTVNNDVGASATNSVTHPAFTLN
FT                   VRPDNIGIITIDVVGDKVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGA
FT                   DITMIAACRTAHDARVLAQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRIC
FT                   SLDDKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDD
FT                   VVPRDILLDVAIQRAKAGWLNRRALPWQERLLSGPLGKALLFRIVRKKTLAKTRGHYPA
FT                   AERIIDVVRKGLDQGGPSGYEAEARAFGELAMSPQSAALRSLFFATTSLKKETGSAATA
FT                   RAIHRVGVLGGGLMGGGIANVTATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKR
FT                   MRPTEQQRQMMLISGSTDYRGFERVDIVVEAVFEDLSLKQQMVADIERFGAAHTIFASN
FT                   TSSLPISQIAALAQRPEQVIGLHYFSPVDKMPLVEVIPHEKTSEETIATTVALARKQGK
FT                   TAIVVADRAGFYVNRILAPYINEAARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGI
FT                   DVATKIMPILVEQLGPRFAAPPSFDVILKDGRKGRKNGRGFYLYSNPTKNSSPTKNGNS
FT                   PAKRNSFKWRKNKVKPVDASIYTLLGVTPKAHLGAGVITQRCTMLMLNEAVRCLDESII
FT                   RNPRDGDIGAVFGIGFPPFLGGPFRYLDSLGADKVVQALRLLVQQYGERFEPCQRLVTM
FT                   AEQQQQFYPVDANIDEVTDVAS"
FT   gene            complement(397481..398791)
FT                   /gene="fadI"
FT                   /locus_tag="YpAngola_A0383"
FT   CDS_pept        complement(397481..398791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadI"
FT                   /locus_tag="YpAngola_A0383"
FT                   /product="acetyl-CoA C-acyltransferase FadI"
FT                   /EC_number="2.3.1.16"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930; match to protein family HMM
FT                   TIGR02446"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88323"
FT                   /db_xref="GOA:A9R7W9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012806"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7W9"
FT                   /protein_id="ABX88323.1"
FT                   /translation="MSKPLPLVTRQGDRIVIVNGLRTPFAKQATAYHGVPAVDLGKIVV
FT                   SELLARSGISSELIDQLVFGQVVQMPEAPNIAREIVLGTGMSVHTDAYSVSRACATSFQ
FT                   AVANVAESIIAGSVDIAIAGGADSSSVLPIGVSKALARTLVDANKARSLSQKLKLFSRL
FT                   RLRDLLPVAPAVAEYSTGLRMGDTAEQMAKTYGISREDQDALALRSHQLAAEAWQQGWL
FT                   HDEVMTAYIPPYREAIIEDNNIRKDSILAQYAKLRPAFDRQHGSVTAANSTPLTDGAAA
FT                   VLMMSESKAKALGLPPLGYLRSFAFSAIDVWQDMLLGPSYATPLALDRAGITLADLTLI
FT                   DMHEAFAAQTLANLKMFASDTFAREKLGRSQAIGEVDMSKFNVLGGSIAYGHPFAATGA
FT                   RMITQTLNELRRRGGGLGLTTACAAGGLGAAMILEVE"
FT   gene            complement(399078..399236)
FT                   /locus_tag="YpAngola_A0384"
FT   CDS_pept        complement(399078..399236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0384"
FT                   /product="conserved hypothetical protein TIGR00743"
FT                   /note="identified by match to protein family HMM TIGR00743"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87137"
FT                   /protein_id="ABX87137.1"
FT                   /translation="MLKTLTDKARAVESDPCLIEHKLEDVEGGVRLTIDFTFACQAETM
FT                   IFQLGLR"
FT   gene            399788..401053
FT                   /gene="fadL"
FT                   /locus_tag="YpAngola_A0385"
FT   CDS_pept        399788..401053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadL"
FT                   /locus_tag="YpAngola_A0385"
FT                   /product="long-chain fatty acid transport protein"
FT                   /note="identified by match to protein family HMM PF03349"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85938"
FT                   /protein_id="ABX85938.1"
FT                   /translation="MNQKNLFTRSALAAAIALISSNVSAAGFQLNEYSAAALGRAFSGE
FT                   GAVADNASVGSRNPAAMTLFDRPSFSGGVIYIDPSVDITGTSPSGKSTDASNIAPSAWV
FT                   PNLHFIMPLDEQWAIGASATSNYGLATEFNDDYVAGMLGGQTDLKTANLNLSAAYRLND
FT                   NFSFGLGFDAVYADAKIVRHLGEAGGGLLPANTEAARLEGTKWGYGWNTGILYEIDKEN
FT                   RYSFTYRSEVNIDFDGDYSNQLPVIFGGLGGKTVPGSLTLNLPAVWEVSGYNKVAPQWA
FT                   IHYSMAYTTWSSFKELKATASNGDVLFDKHEGFRDAYRIALGTTYYYDDNWTFRTGIAF
FT                   DDSPIPAGNRSISIPDQDRFWLSAGTTYAFNKNASVDVGIAYMKGQNVSITEKTPAPSN
FT                   TTYEFNSKGSAMLYGVNFNYTF"
FT   gene            complement(401160..401924)
FT                   /gene="vacJ"
FT                   /locus_tag="YpAngola_A0386"
FT   CDS_pept        complement(401160..401924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacJ"
FT                   /locus_tag="YpAngola_A0386"
FT                   /product="lipoprotein VacJ"
FT                   /note="identified by match to protein family HMM PF04333"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85172"
FT                   /protein_id="ABX85172.1"
FT                   /translation="MNFRLTGLAFASVLLVGCASSSPDHMEQGRSDPLEGFNRAMFNFN
FT                   YEVLDPYVVRPVAVVWRDYVPQPARNGMSNFLGNLEEPASMVNSFLVGDPYNAMKHFNR
FT                   FFLNTVLGMGGLIDVAGMANPKLAKQVPQRFGSTLGHYDVGYGPYVVLPGYGSFTLRED
FT                   GGQLADTVYPVLSYLTFWMAAGKWVLEGVETRAQLLDSDGLVRNSSDPYLMIREAYFQR
FT                   HDFLANGGQLKPEVNSNAQAIQGDLDSIDAAD"
FT   gene            complement(401960..403186)
FT                   /gene="ccmI"
FT                   /locus_tag="YpAngola_A0387"
FT   CDS_pept        complement(401960..403186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmI"
FT                   /locus_tag="YpAngola_A0387"
FT                   /product="cytochrome c-type biogenesis protein CcmI"
FT                   /note="identified by match to protein family HMM TIGR03142"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85567"
FT                   /protein_id="ABX85567.1"
FT                   /translation="MAFWLIVIISLAVAGALLVIPVIRKNENKRVTTRDELNKAIYRDR
FT                   LSELAEDEAQGVIAERPELVKELQQNLLTDIPQQLGEVKNPINRWVLLPGVVVLVVVAV
FT                   GLYLKTGGLEQVAAWHQVAAQMPELRARVANEHADPLSMEDVARLGLGLRTSLQQDAGN
FT                   VNDWMMLGRVGMALNNATTATQAFAHAYQLAPDNNEVKLGYVEVLTRSNDPEDNQLATQ
FT                   MLRAMVGQDHTNLRAMSLLAFNAFEQGDFKQAIAVWEVMLKLLPASDSRVDVVKRSIQQ
FT                   AKSQIEQETATLGIEVSLSSDAAQALPQQGALIISVTNGINPVPVAVKQLPLSRFPLAV
FT                   TLDDSNAMMPERLLSSLQQVKVRVRLSLDGAANAQSGDWYGESAVQDFKGNGPSSEQKI
FT                   GVQINKQIP"
FT   gene            complement(403186..403698)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0388"
FT                   /note="putative cytochrome c-type biogenesis protein; this
FT                   gene contains a frame shift which may be the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF03918"
FT   gene            complement(403695..404261)
FT                   /gene="dsbE"
FT                   /locus_tag="YpAngola_A0389"
FT   CDS_pept        complement(403695..404261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbE"
FT                   /locus_tag="YpAngola_A0389"
FT                   /product="thiol:disulfide interchange protein DsbE"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534; match to protein
FT                   family HMM TIGR00385"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86688"
FT                   /protein_id="ABX86688.1"
FT                   /translation="MKPQSSFNKLMFIPLVLFLLLVVAFLIQLTRNANGEDPTMLESAL
FT                   IGKPVPAFKLESLEQPGKTFDQAVLRDGKPILLNVWATWCPTCRAEHEYLNKLAAQGIR
FT                   VVGLNYKDDRSKAVQWLNSLGNPYFLSLYDGDGMLGLDLGVYGAPETFLIDGQGVIRYR
FT                   HAGDLNDRVWQQEILPLYKKYQGGA"
FT   gene            complement(404258..406228)
FT                   /gene="ccmF"
FT                   /locus_tag="YpAngola_A0390"
FT   CDS_pept        complement(404258..406228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmF"
FT                   /locus_tag="YpAngola_A0390"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="identified by match to protein family HMM PF01578;
FT                   match to protein family HMM TIGR00353"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86356"
FT                   /protein_id="ABX86356.1"
FT                   /translation="MIPEIGSFLLCLALAISLLLSLYPQWGAARQDARMMAVGRPLTYG
FT                   MFAAITLSFICLIYAFVVNDFTVSYVAANSNSYLPIYYRIAASWGAHEGSLLLWVLLLS
FT                   CWSLAVALFSRSMPEDAVARVLSVLGMITGGFLLFIILTSNPFSRTLPDFPIDGRDLNP
FT                   LLQDVGLIFHPPLLYMGYVGFSVAFAFAIASLMAGRLDSAWARWSRPWTQAAWIFLTLG
FT                   IVLGSAWAYYELGWGGWWFWDPVENASFMPWLAGTALIHSLAVTEKRGTFKAWTVLLAI
FT                   TAFSLCLMGTFLVRSGVLVSVHSFASDPARGMFILAYLVIVIGGSLLLYAVKGAQVRSR
FT                   TQHEVFSRETFLLGNNVLLIAAMLVVLLGTLLPLVHKQLGLGSISIGEPFFNTMFTWLM
FT                   APMALLMGIGPLVRWRRDEPSKLWKRLSVALVVTLLLSISVPWLLQDSVAGMTVVGLMM
FT                   AIWVIILTLMELHERATHRYGFWRGLTHLSRSHWGMVLGHLGVAVTVIGIAFSQNYSVE
FT                   RDVRMKAGDSIDIHDYHFTFRDVHDIKGPNYTGGVGIIDVTRNGKLEATLHAEKRYYSV
FT                   ARSMMTEAAIDGGLTRDLYAALGEELGDGSWAVRLYYKPFVRWIWFGGIFMAVGGIFCM
FT                   LDPRYRMSKKLKRGAIPEAES"
FT   gene            complement(406225..406719)
FT                   /gene="ccmE"
FT                   /locus_tag="YpAngola_A0391"
FT   CDS_pept        complement(406225..406719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmE"
FT                   /locus_tag="YpAngola_A0391"
FT                   /product="cytochrome c-type biogenesis protein CcmE"
FT                   /note="identified by match to protein family HMM PF03100"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86786"
FT                   /db_xref="GOA:A9R7X6"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7X6"
FT                   /protein_id="ABX86786.1"
FT                   /translation="MNPRRKSRLYLAMVVLIGISLTTTLVLYALRSNIDLFYTPGEILQ
FT                   GKGERHEKPAIGQRLRIGGMVMPGSVQRDAKTLEMSFQVYDARGAVTVTYTGILPDLFR
FT                   EGQGVVAQGVFAEGNTVHAKEVLAKHDEKYTPPEVEEAMKENHSRPAAAYRGTNTTGNA
FT                   L"
FT   gene            complement(406716..407018)
FT                   /gene="ccmD"
FT                   /locus_tag="YpAngola_A0392"
FT   CDS_pept        complement(406716..407018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmD"
FT                   /locus_tag="YpAngola_A0392"
FT                   /product="heme exporter protein CcmD"
FT                   /note="identified by match to protein family HMM PF04995;
FT                   match to protein family HMM TIGR03141"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87427"
FT                   /protein_id="ABX87427.1"
FT                   /translation="MTPAFHSWAEFFAMGNYAFYVWLAVAATLLSLLGLLMHTLWQHKQ
FT                   LLADIHRRQAREQRIRQAQLNQTSMHQVPLHQAPLHQAPLQQAPQHIANLQEKRP"
FT   gene            complement(407015..407752)
FT                   /gene="ccmC"
FT                   /locus_tag="YpAngola_A0393"
FT   CDS_pept        complement(407015..407752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="YpAngola_A0393"
FT                   /product="heme exporter protein CcmC"
FT                   /note="identified by match to protein family HMM PF01578;
FT                   match to protein family HMM TIGR01191"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87788"
FT                   /protein_id="ABX87788.1"
FT                   /translation="MWKWFHQFAKPERLYPLCGRLIPWFGGGAIICLAVGWVWGLGFAP
FT                   SDYQQGDSFRIMYLHVPAAIWSMGIYMSMAIAAFVGLVWQIKMADNLVAAMAPVGAVLT
FT                   FIALVTGSAWGKPMWGTWWIWDARLTSELVLLFLYLGVIALYNAFDDRKLAGRAAGILV
FT                   LVGVVNLPIIHFSVVWWNTLHQGSTNMQQSIDPSMRSPLRWAILGFLLCFITLTLMRLR
FT                   NLILQQERHRPWVTALLRKEPRV"
FT   gene            complement(407815..408474)
FT                   /gene="ccmB"
FT                   /locus_tag="YpAngola_A0394"
FT   CDS_pept        complement(407815..408474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="YpAngola_A0394"
FT                   /product="heme exporter protein CcmB"
FT                   /note="identified by match to protein family HMM PF03379;
FT                   match to protein family HMM TIGR01190"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87164"
FT                   /protein_id="ABX87164.1"
FT                   /translation="MFISVLRRELKIAFRKGAEIVNPLWFFLIVITLFPLGIGPEPQLL
FT                   ARIAPGIVWVAALLASLLSLERLFRDDFYDGSLEQLLLLPTPLPLTVLGKVCAHWVVTG
FT                   LPLLVLSPLVALLLSLDVNTAIAMGLTLLLGTPTLSFIGAIGVALTVGLRKGGVLLSLL
FT                   VLPLYIPVLIFATAAIDAASMAMPIDGYLAILGAMLAGSVTLAPFATAAALRVSIQ"
FT   gene            complement(408444..409100)
FT                   /gene="ccmA"
FT                   /locus_tag="YpAngola_A0395"
FT   CDS_pept        complement(408444..409100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="YpAngola_A0395"
FT                   /product="heme ABC exporter, ATP-binding protein CcmA"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01189"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86709"
FT                   /protein_id="ABX86709.1"
FT                   /translation="MLEAKNLTCIRDDRCLFQQLSFCIAPGEIVQIEGPNGAGKTSLLR
FT                   ILAGLAEADEGQVNWRDKNIRRDRAKYHQDLLFLGHQPGIKSVLTPFENLLFYQSVFQK
FT                   VDSAAIWQALAQVGLVGYEDLPVSQLSAGQQRRVALARLWLSPAPLWILDEPLTAIDKQ
FT                   GVSTLLALFVQHAAKGGMVLLTTHQDLGAVSHNVRKICLANTQEKSCLSACCAVN"
FT   gene            complement(409545..410012)
FT                   /locus_tag="YpAngola_A0396"
FT   CDS_pept        complement(409545..410012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0396"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85824"
FT                   /protein_id="ABX85824.1"
FT                   /translation="MSLIKSTLIFGVLLVVSFGTLAMSDECKQAYGIFDDAAYFSGKMN
FT                   VKPGDGKEVTKTNVNVEAFNEWYYRSYDDEWMAVLEKYTKFKGVDDDSVIGISLLAFIE
FT                   TSGLVEFYKSYIDFLTDFPKRTDTYLVSGRVEAAKKKIDDAYKELVGHCNK"
FT   gene            complement(410267..410341)
FT                   /locus_tag="YpAngola_A0397"
FT   tRNA            complement(410267..410341)
FT                   /locus_tag="YpAngola_A0397"
FT                   /product="tRNA-Arg"
FT   gene            410628..411170
FT                   /locus_tag="YpAngola_A0398"
FT   CDS_pept        410628..411170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0398"
FT                   /product="LemA family protein"
FT                   /note="identified by match to protein family HMM PF04011"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86399"
FT                   /protein_id="ABX86399.1"
FT                   /translation="MEIYIGLAVVALILIWAVMTYNRFISLRRFKDEAWSDIAVQLKRR
FT                   HDLVPNLLSLVKRYAQHEKELLEEITRQRSNLVGNTRQIAENEREYSGILGRVFALAEA
FT                   YPDLKANENFLSLQQSLAEIEEQLQMARRYFNGTVRDFNILVESFPSLLLAHLFNFKAD
FT                   VFFELENPDEAKLPRME"
FT   gene            411175..412491
FT                   /locus_tag="YpAngola_A0399"
FT   CDS_pept        411175..412491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86673"
FT                   /protein_id="ABX86673.1"
FT                   /translation="MARLSGKALYVIWILLLLVTGTVQATADEISVSTPAVEAPKGHGL
FT                   IRAYEHILSFDTHARFDADGSMEMRENIKVLSLGKQISRGIFRTLPLTWNRQDGKFFSV
FT                   EYQIKNVLRDGVAEPFSVTKEGETLMVRIGRADHILKPGIYNYVIQYQVSNHFSRFPDW
FT                   DELYWNVTGNGWEYPISKASFHLELPASEAFLNSEGKDTRLSTIDVYTGRLGEKEQNAK
FT                   ILADGSVQTSQPLKQGEGLTVAYTWPRTILANAPAPETSSLLVYLLLPTVQTSVLWIPI
FT                   LLLIGYYLLWWRKNVTAIGLKMPPIVPLYALPATLSPGYLRYVTQRKYDAIAFSSDLLN
FT                   LVAQRSVAIKTKKSKNKSPWVLNSRDEQWLSLQSDGNQLDIHDKQLLHTLFSSNRKNIN
FT                   LSKPHQRPMQKALKFLEKRCEDQQEKLFSQWLGPIWRGI"
FT   gene            complement(412525..413733)
FT                   /locus_tag="YpAngola_A0400"
FT   CDS_pept        complement(412525..413733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0400"
FT                   /product="IS285, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87237"
FT                   /protein_id="ABX87237.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            complement(414046..414333)
FT                   /locus_tag="YpAngola_A0401"
FT   CDS_pept        complement(414046..414333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0401"
FT                   /product="antibiotic biosynthesis monooxygenase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87518"
FT                   /protein_id="ABX87518.1"
FT                   /translation="MEIRVIASIVAKTEFIEEVKAALHQIIEPSREEKGNLQYDLHTES
FT                   EQKGSFVFFERWASDEALEKHNKTEHFKQLVKAIDGKLESLEIKKVKQIA"
FT   gene            414568..415614
FT                   /gene="pyrC"
FT                   /locus_tag="YpAngola_A0402"
FT   CDS_pept        414568..415614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="YpAngola_A0402"
FT                   /product="dihydroorotase, homodimeric type"
FT                   /EC_number="3.5.2.3"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR00856"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88057"
FT                   /db_xref="GOA:A9R7Y6"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7Y6"
FT                   /protein_id="ABX88057.1"
FT                   /translation="MTAQPQTLKIRRPDDWHIHLRDDEMLSTVLPYTSEVFARAIVMPN
FT                   LAQPITTVASAIAYRERILAAVPAGHKFTPLMTCYLTNSLDAKELTTGFEQGVFTAAKL
FT                   YPANATTNSTHGVSDIPAIYPLFEQMQKIGMPLLIHGEVTDAAVDIFDREARFIDQILE
FT                   PIRQKFPELKIVFEHITTKDAADYVLAGNRFLGATVTPQHLMFNRNHMLVGGIRPHLFC
FT                   LPILKRSTHQQALRAAVASGSDRFFLGTDSAPHAKHRKESSCGCAGVFNAPAALPAYAS
FT                   VFEELNALQHLEAFCALNGPRFYGLPVNDDVVELVRTPFLQPEEIPLGNESVIPFLAGQ
FT                   TLNWSVKR"
FT   gene            415927..416172
FT                   /gene="dinI"
FT                   /locus_tag="YpAngola_A0403"
FT   CDS_pept        415927..416172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinI"
FT                   /locus_tag="YpAngola_A0403"
FT                   /product="DNA-damage-inducible protein I"
FT                   /note="identified by match to protein family HMM PF06183"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88345"
FT                   /protein_id="ABX88345.1"
FT                   /translation="MRVEVSIDKKNQLPAGAIEALTQELTKRLNTKFPDTATAVQVRYA
FT                   SANNLSVLGGAKTDKDVISEILQEIWESADDWFDAE"
FT   gene            complement(416937..418145)
FT                   /locus_tag="YpAngola_A0404"
FT   CDS_pept        complement(416937..418145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0404"
FT                   /product="IS285, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84981"
FT                   /protein_id="ABX84981.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            418236..418871
FT                   /locus_tag="YpAngola_A0405"
FT   CDS_pept        418236..418871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86287"
FT                   /protein_id="ABX86287.1"
FT                   /translation="MFSVTDPISAYAGNIYDSRGVYDVIREFKRFSITATEYVGENGRK
FT                   YIHISGYAGLRRIITGTRYGASHPQMLSMGIGQQGLSSNIVKGLKFCILFSIGYRTIEG
FT                   IFKDEYTLAEFIGNITMDMAKIAIVAATSFIVGVLFTATVLAGGSIIVVAGVAFAVGFV
FT                   ATAILDHFDEKYGISEKLIALLTKEMRKKPRTQEANFQSILNGLGRLK"
FT   gene            420721..421200
FT                   /locus_tag="YpAngola_A0406"
FT   CDS_pept        420721..421200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05638;
FT                   match to protein family HMM TIGR03344"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86949"
FT                   /protein_id="ABX86949.1"
FT                   /translation="MANLIYASIDGEKQGLISSGCSTLDSIGNRCQLGHEDQIYVYGFD
FT                   HNIARAQNVAHQPIIITKPIDKSSPLLGMSISNNEKLQIVLYMYRINSSGSLEVFYTIK
FT                   LKDAYISNISQHCPNALTHNDIQPYEIISISYKSIDWEHNISGTSGYSIWDERVY"
FT   gene            complement(421360..421869)
FT                   /locus_tag="YpAngola_A0407"
FT   CDS_pept        complement(421360..421869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0407"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87108"
FT                   /protein_id="ABX87108.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(422193..423770)
FT                   /gene="guaA"
FT                   /locus_tag="YpAngola_A0408"
FT   CDS_pept        complement(422193..423770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="YpAngola_A0408"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87511"
FT                   /db_xref="GOA:A9R7Z2"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7Z2"
FT                   /protein_id="ABX87511.1"
FT                   /translation="MTKNIHKHRILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQ
FT                   IREFNPSGIILSGSPESTIENGSPRAPDYVFTAGVPVLGVCYGMQTMAIQLGGKVESSN
FT                   QREFGYAQVEIKADSALIRDIKDAINPAGEAVLDVWMSHGDKVAEIPADFVTVASTDTC
FT                   PFAIMANEEKRFYGVQFHPEVTHTKQGLRLLERFVLGICGCEALWTSATIIEDAIVRLR
FT                   EQIGDDHVILGLSGGVDSSVTAMLLHRAIGKRLTCVFVDNGLLRLNEADQVLEMFGDKF
FT                   GLNIVHVAAEDRFLSALTGVDEPEAKRKIIGRVFVELFDEEACKQEQVKWLAQGTIYPD
FT                   VIESAASATGKAHVIKSHHNVGGLPKEMKLGLVEPLKELFKDEVRKIGLELGLPYDMLY
FT                   RHPFPGPGLGVRVLGEVKKEYCDLLRRADAIFIEELHKADLYNKVSQAFTVFLPVRSVG
FT                   VMGDGRKYDWVVSLRAVETVDFMTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGK
FT                   PPATIEWE"
FT   gene            complement(423955..425502)
FT                   /gene="guaB"
FT                   /locus_tag="YpAngola_A0409"
FT   CDS_pept        complement(423955..425502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="YpAngola_A0409"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88149"
FT                   /protein_id="ABX88149.1"
FT                   /translation="MLEAIDYALYNATAIFYLFHIHLGEILPMLRIAKEALTFDDVLLV
FT                   PAHSTVLPNTAELGTQLTATIRLNIPMLSAAMDTVTESRLAIALAQEGGLGFIHKNMSI
FT                   ERQAEEVSRVKKHESGVVTEPQTVTPTTTLRQVKELTARNGFAGYPVVTEDYELVGIIT
FT                   GRDVRFVTDLDQPVTAVMTPKERLVTVKEGETREVVLQKMHEKRVEKVLVVDDSFHLRG
FT                   MITVKDFQKAERKPNACKDEHGRLRVGAAVGAGAGNEERIDALVAAGVDVLLIDSSHGH
FT                   SEGVLQRIRETRAKYPNLQIVGGNVATGAGAKALADAGVSAVKVGIGPGSICTTRIVTG
FT                   VGVPQITAIADAVEALEGTGIPVIADGGIRFSGDIAKAIAAGASCVMVGSMLAGTEESP
FT                   GEIELYQGRSFKSYRGMGSLGAMSKGSSDRYFQTDNAADKLVPEGIEGRVAYKGLLKEI
FT                   VHQQMGGLRSCMGLTGCGTINELRTKAEFVRISGAGIQESHVHDVTITKESPNYRMM"
FT   gene            425588..426967
FT                   /gene="xseA"
FT                   /locus_tag="YpAngola_A0410"
FT   CDS_pept        425588..426967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="YpAngola_A0410"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF02601; match to protein
FT                   family HMM TIGR00237"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86881"
FT                   /db_xref="GOA:A9R7Z4"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7Z4"
FT                   /protein_id="ABX86881.1"
FT                   /translation="MSQSSASSIFTVSRLNQTVRELLEREMGQIWLTAEISNFSQPASG
FT                   HWYFTLKDDRAQVRCAMFRNSNRRTTFRPQNGQQVLVRASITLYEPRGDYQLIAESMQP
FT                   AGDGLLQQQFEQLKQQLAAEGLFDQSHKQPLPHPAKQVGVITSASGAALHDVLHVLQRR
FT                   DPSLPVIIYPTSVQGVDAPLQIVRAIQLANLRAECDVLIVGRGGGSLEDLWSFNDERVA
FT                   RAIFNSHIPIVSAVGHETDVTIADFVADLRAPTPSAAAELVSRNQIELVRQIQGQQQRM
FT                   EMAMDYYLAQRNQQFTRLEHRLQQQHPHLRLARQQTLLLKLQRRLEESAQTQIRLLSKR
FT                   TERLQQRLQQVQPQGQIHRYNQRVQQQEYRLRQAVERQLNGYRQRFGIACSQLEAVSPL
FT                   ATLARGYSVTQTPAGALLKTTKQVQAGDKLTTRLQDGWVESEITQVTVAKKSRQKKVVT
FT                   Q"
FT   gene            complement(427060..427284)
FT                   /locus_tag="YpAngola_A0411"
FT   CDS_pept        complement(427060..427284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07191"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84968"
FT                   /protein_id="ABX84968.1"
FT                   /translation="MDALCPVCQKAMTEVSGHFHCETCHGNYQQQAECPDCAQPLQVLK
FT                   ACGAVDYFCQHGHGLISKRRVHFNYLPVS"
FT   gene            complement(427333..428289)
FT                   /locus_tag="YpAngola_A0412"
FT   CDS_pept        complement(427333..428289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0412"
FT                   /product="transporter, auxin efflux carrier family"
FT                   /note="identified by match to protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85374"
FT                   /protein_id="ABX85374.1"
FT                   /translation="MSWEIWSFAFSVTVPNLLMMLLGVLLRRCRLIDDNFCDGATRLVF
FT                   NLALPCLLFFSVATNHVSLLDNLPLAIYGAGGTLLTFLLLEVAAKWLVKDPRERGVFVQ
FT                   GGFRANTAIVGLAFAMTAYGAEGVAIGSMYLTVTVILFNTLSVITLTRSLQAGQGGKIS
FT                   KLSLLRGIVTNPLIIGLVCGLLFAQTALSLPQVIVQTGSYISALALPLALLCTGASLDW
FT                   HAMFRSSNVAALSSVAKLFLVPILMTLGGLLMGFRGATLGVIFLFSATPTAAGSYVMTR
FT                   AMGGNATLAANIIAITTVGSFFTTALGIYFLRSLGVM"
FT   gene            complement(428243..428371)
FT                   /locus_tag="YpAngola_A0413"
FT   CDS_pept        complement(428243..428371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0413"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86036"
FT                   /protein_id="ABX86036.1"
FT                   /translation="MVIYPSDIQVADVLAAGRLKKRELRASHVLGNLEFRIQCHGT"
FT   gene            complement(428636..430123)
FT                   /locus_tag="YpAngola_A0414"
FT   CDS_pept        complement(428636..430123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0414"
FT                   /product="GTP-binding protein EngA"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86418"
FT                   /db_xref="GOA:A9R7Z8"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R7Z8"
FT                   /protein_id="ABX86418.1"
FT                   /translation="MIPVIALVGRPNVGKSTLFNRLTHTRDALVADFPGLTRDRKYGRA
FT                   EVEGHEFIVVDTGGIDGTEDGVETKMAGQSLLAIEEADIVLFMVDARAGLMPADQGIAQ
FT                   HLRSREKATFLVANKTDGIDPDTATADFYSLGLGEVHAIAASHGRGVTQLIEDVMAPYM
FT                   DAEEPEVELTEEEENAAYWAEQEAQGEDVPPEDPEDDFDPRTLPIKLAIVGRPNVGKST
FT                   LTNRILGEDRVVVYDMPGTTRDSIYIPMTRDDREYILIDTAGVRKRGKITETVEKFSVI
FT                   KTLQAIEDSNVVLLVIDARDGISDQDLSLLGFILNSGRSLVIAVNKWDGMTEEARAQVK
FT                   DMLDLRLGFVDFARIHFISALHGSGVGNLFESVQEAYDCSTKRVGTSLLTRIMQMAEED
FT                   HQPPLVRGRRVKLKYAHAGGYNPPIVVIHGNQVTDLSDSYKRYLMNYFRRSLKVMGTPI
FT                   RIQFKEGENPFAGKRNPLTPNQMRKRKRLMSHLKKGK"
FT   gene            complement(430271..431452)
FT                   /locus_tag="YpAngola_A0415"
FT   CDS_pept        complement(430271..431452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0415"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF01011;
FT                   match to protein family HMM TIGR03300"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87536"
FT                   /protein_id="ABX87536.1"
FT                   /translation="MQLRKTLLVGLVSVALLSGCSLFNSEEDVVTMSPLPKVENQFSPT
FT                   KVWSTSVGSGVGDYYSHLRPAWQGTSVFAADRKGLVKAMDADTGKQIWQTDLSEKTNFL
FT                   SSNHSAMLSGGVTASGSHVYVGSEKAVVYALNAYDGQVAWQTVVAGEALSRPVVSDGVV
FT                   LIHTSNGMLQALNESDGAIKWTLNLDTPALSLRGESAPAVAFGAAIVGGDNGRVSAVMM
FT                   EQGQLIWQQRISQVTGATEIDRLNDIDITPVVVDGVVYALAYNGNLTALDLRSGQILWK
FT                   REIGSVNDFIVDAGRIYLVDQNDRIIALKSDGGVTLWSQSDLLHRNLTAPVMYNGYLVV
FT                   GDAEGYLHWVNTDDGRFVAQQSVDSSGFLSAPVVASDKLLIQARSGTVYAFTR"
FT   gene            complement(431464..432099)
FT                   /locus_tag="YpAngola_A0416"
FT   CDS_pept        complement(431464..432099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86114"
FT                   /protein_id="ABX86114.1"
FT                   /translation="MEVYTTENDQVDAVRRFFSENGKALAVGVVLGIGALVGWRYWQGN
FT                   QNTAMTEASSAYQKVSTALSTNSAGNVSADSIALAEKFVQSNKNNYGVLVGLELAHDFV
FT                   EQNAFDKAAQQLSQALGQTKDENLLSLINLRLARVQLQLKKPDEALKTLDAVQGDGWTA
FT                   MAQDVRGDALLSKGDTAGARAAYSKAIESNASQALQALLRMKLNNLSS"
FT   gene            complement(432113..433387)
FT                   /gene="hisS"
FT                   /locus_tag="YpAngola_A0417"
FT   CDS_pept        complement(432113..433387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="YpAngola_A0417"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00442"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87339"
FT                   /db_xref="GOA:A9R801"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R801"
FT                   /protein_id="ABX87339.1"
FT                   /translation="MAKNIQAIRGMNDYLPADTAIWQRIESILKQVLSGYGYSEIRMPI
FT                   VEQTPLFKRAIGEVTDVVEKEMYTFDDRNGESLTLRPEGTAGCVRAGIEHGLLYNQEQR
FT                   LWYIGPMFRYERPQKGRYRQFHQLGAEVFGLPGPDIDAELILLTARWWRALGIFEHVKL
FT                   ELNSIGSLAARADYREALVAFLEQHVEVLDEDCKRRMYSNPLRVLDSKNPDVQQLLDDA
FT                   PKLSDYLDEESKQHFAGLCELLDKASIPYTVNERLVRGLDYYNRTVFEWVTHSLGAQGT
FT                   VCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNADFQVPATVDAYVISSGEGA
FT                   QSAAMLLAESLRDALPTLKIMTNYGGGNVKKQFTRADKWGARVALMLGESEVAAQQVVV
FT                   KDLRNGEQETLAQADVAARLALMLG"
FT   gene            complement(433596..434723)
FT                   /gene="ispG"
FT                   /locus_tag="YpAngola_A0418"
FT   CDS_pept        complement(433596..434723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="YpAngola_A0418"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="identified by match to protein family HMM PF04551;
FT                   match to protein family HMM TIGR00612"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87797"
FT                   /db_xref="GOA:A9R802"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R802"
FT                   /protein_id="ABX87797.1"
FT                   /translation="MHNGSPIIRRKSTRIYVGKVPIGDGAPIAVQSMTNTKTTDVDATV
FT                   AQIKALERVGVDIVRVSIPTMDAAEAFKLIKQQSTVPLVADIHFDYRIALKVAEYGVDC
FT                   LRINPGNIGNESRIREVVACARDYNIPIRIGINGGSLEKDIQEKYGEPTPEALLESAMR
FT                   HVDILDRLNFDQFKVSVKASDVFLAVNSYRLLAKQINNPLHLGITEAGGARSGSVKSAI
FT                   GLGLLLSEGIGDTLRISLAADPVEEVKVGFDILKSLRIRARGINFIACPTCSRQEFDVI
FT                   GTVNALEQRLEDLITPMDVSIIGCVVNGPGEALVSTIGVTGARNHSGFYEDGVRQKERF
FT                   DNKAMIDQLEAKIRAKASILDANNRIVINQLDDNK"
FT   gene            complement(434785..435822)
FT                   /locus_tag="YpAngola_A0419"
FT   CDS_pept        complement(434785..435822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85320"
FT                   /db_xref="GOA:A9R803"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR023690"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R803"
FT                   /protein_id="ABX85320.1"
FT                   /translation="MNTEASQDQTVTETPGVRLRQARESLGLTQQTVAERLCLKVSTIR
FT                   DIEEDNAQANLASTFHRGYIRSYAKLVHLPEDELLPILEKQAPVRAAKVAPMQSFSLGK
FT                   KHKKRDGWLMSFTWLIVLVVLGLTGAWWWQNHQAQQAEIANMVDQSSAQLSQNGGQPVP
FT                   LTDDNSDAIAPTDAPAPVANGQPVPLTNHSGSAITNSATTSSVPKTTSTEPVDTANTNT
FT                   TMHQEGAASAAVSPSQVPQPGMPTGQPPLPTADAGVSGSASSVGALVMNFTADCWLQVV
FT                   DATGKTLFSGIQKGGAVLNLAGKAPYKLTIGAPGALTISYQGNPVDLSKFIKANRVARL
FT                   TVCVE"
FT   gene            complement(435812..436561)
FT                   /gene="pilF"
FT                   /locus_tag="YpAngola_A0420"
FT   CDS_pept        complement(435812..436561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilF"
FT                   /locus_tag="YpAngola_A0420"
FT                   /product="type IV pilus biogenesis/stability protein PilW"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719; match to protein
FT                   family HMM TIGR02521"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85731"
FT                   /protein_id="ABX85731.1"
FT                   /translation="MKLTKLWRVCLVVSVLTGCSGTPPENTSQAVAGQTRLQLGLAYLA
FT                   QGDLTAARKNLEKAVEADPQDYRTQLGMAFYAQRIGENSAAEQRYQQAMKLAPGNGTVL
FT                   NNYGAFLCSLGQYVSAQQQFSAAALLPDYGQVADSLENAGYCFLRANQDKQARVLLSRA
FT                   LKYDPDKGEPLLAEAQRHFGEGNRAQAQLLLDVYQHTLPASAESLWLQIRFAALAGRQD
FT                   SVQRYGKQLARSFPQSKQYQHFLANEY"
FT   gene            complement(436715..437911)
FT                   /locus_tag="YpAngola_A0421"
FT   CDS_pept        complement(436715..437911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0421"
FT                   /product="radical SAM domain protein, Cfr family"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00048"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86149"
FT                   /db_xref="GOA:A9R805"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R805"
FT                   /protein_id="ABX86149.1"
FT                   /translation="MSEQLLTASTPIDAAPLSDNTVQTTAPATSKINLLDLNRQQMREF
FT                   FAEMGEKPFRADQVMKWMYHYCYDDFEQMTDINKGLRAKLQRVAEIRAPEVAEEQRSVD
FT                   GTIKWAIKVGDQQVETVYIPEADRATLCVSSQVGCALECKFCSTAQQGFNRNLRVSEII
FT                   GQVWRAAKIIGSLKSTGTRPITNVVMMGMGEPLLNLNNVVPAMDIMMDDFGFGLSKRRV
FT                   TLSTSGVVPALDKLGDMIDVALAISLHAPTDDIRDEIVPINRKYNIETFLAAVRRYLDK
FT                   SKANGGRVTVEYVMLDHINDSTEQAHQLAECLKDTPCKINLIPWNPFPGAPYGRSSNSR
FT                   VDRFSKVLMEYGFTTIVRKTRGDDIDAACGQLAGEVIDRTKRTLKKKMAGEPIAIKTV"
FT   gene            complement(438173..438601)
FT                   /gene="ndk"
FT                   /locus_tag="YpAngola_A0422"
FT   CDS_pept        complement(438173..438601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="YpAngola_A0422"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="identified by match to protein family HMM PF00334"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86543"
FT                   /db_xref="GOA:A9R806"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R806"
FT                   /protein_id="ABX86543.1"
FT                   /translation="MALERTFSIIKPNAVANNDIGAIYARFERAGFKIIAAKMLHLTKE
FT                   QAEGFYAEHKGRPFFDGLVEFMTSGPIMVQVLEGENAVQRHRDIMGATNPDNALAGTLR
FT                   ADFSDSFTANAVHGSDAVESAQREIAYFFAADEIFPRS"
FT   gene            complement(438928..441348)
FT                   /locus_tag="YpAngola_A0423"
FT   CDS_pept        complement(438928..441348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0423"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87567"
FT                   /protein_id="ABX87567.1"
FT                   /translation="MRYNRNHMLTLMFSLLIFDAYANEPKVCFYMDDDYNGESLCAAQG
FT                   NSVASIPDKWNDRISSISIPHGLVVTVYEDVDFLGASRSFEADVDLVSDKDLIYLNDNI
FT                   SAFKIKKAVCFYGESNFTGDSLCLSSGEQFDLYRGNYPERKQSHLVNPLNDEVYSIKIP
FT                   PGMQTTVYEDDDYNGKYFVLTEDYTPDDLLIIRMNNKISSMRVSQDEDFICDRFCSIKK
FT                   SIKFKIQKSFGSYWIDPRIKYRDILLDFQLSDTDDYSIKFFDEGLIKVKNYKLFFFDGN
FT                   EKHGEGFLFNLSDKSSNLSFLLRFNGVFFQIQFIESLNNEIVYSSPLIGTLFDDANSDV
FT                   IFDINNVDANSPIVIDKMVLTVGKEHNRAERSTLGLATCWAIPILSIYNYIVQGHCNQA
FT                   DKFVHNAADFFGSPADKILQIFGSSLPLPPKNSNETLDDESALINFMSDVKGTLTYITT
FT                   NMGEHALTVPATALACKASMREKILPHLRNRRDLAPGCIDWTLSILTDFTLLFGASIEY
FT                   WNSKNFGRVIENIVREGEIGSAVADVDTASRLIESVQAHVAEATEVADIIHLKTAFDFS
FT                   QLSYVSYVRHTEEEVVSPQSAQALPLGRYELALVDYHFIETVPRIRQDGRWVERPDLHF
FT                   DIEVISGVPEETDASRQVLLPIIEAWQHSYSQQELLFHASDILPESSLARYEIEPLLEA
FT                   SRLTSEVAISWLRTSRDDFVYVVVRLEGEVISLTMAVDININDVGVAGSLTNPDYVITP
FT                   NAEGAVRGAGTAAIRALADHFKRKGKISLVSSVISQPSAIVKKKVGFRFIEEL"
FT   gene            442064..446389
FT                   /locus_tag="YpAngola_A0425"
FT   CDS_pept        442064..446389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0425"
FT                   /product="pertactin family"
FT                   /note="identified by match to protein family HMM PF03212;
FT                   match to protein family HMM PF03797; match to protein
FT                   family HMM TIGR01414"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87433"
FT                   /protein_id="ABX87433.1"
FT                   /translation="MKNSNTLNTRLLPLSILISSLVSGGAMAVSQIATTDTPAVTPIKS
FT                   TLTGPFERNSAGTSFGSNVDVIDNTSTATRVIAETTPEAESTIGEATGQEGGNATAVIP
FT                   PTTTPSEQEITEPEQPGLLDKIKDLLGLGEITQEQADALEKNVKTKVEKVDAQTAAKLA
FT                   LESAQAEAQKAAEDALYLKTENVSYQAFAQTEEKIKKEADEAKKKQDKTKEDAIKAVKV
FT                   NNTPLVPGDKDIAEKVTKAVTDTTKVQGEKAVTLATKITDAKVAQEKKDANTEALAEID
FT                   GRLISVSNALIQATGTDKGPLDQKLKEAQQAKTEQDGKELASGGYKELFEEDKKTSGYF
FT                   GIAENDNGSGQQEKLAEAKKNRDAYNKAAKKELDAIAKAQKAVEAIDAQIVKLKKDKGD
FT                   IEQEQSTEKGKTGGLDIALSGANDAKDAAQGEFDTAKNAAELAELAETAAKAIEAAKIT
FT                   DKAVEDATAAYKEAADKAEQTKTALEAAEKAKEDADKLVVTNTGLLNDADQALEQLVTA
FT                   QNNAQPTLDLPAIDVTIAPAKTQDVIEGTSAIATQVAGGTQNVAKGGKAIDSVITKDGI
FT                   VNLAAGANAKGTEVTKGTLNNNGGVDTDTVVSTEGKLVLTGGSETAIATSTGAKVAEGG
FT                   VVTAGDHSVIEKMISSGNVTASGNNTIVRDTTINDGKLSLAGTATANNTTFNGGIFSVE
FT                   GDTAATKTNMTGGKFAVTGNATIKDTVLSASDFSLADKVTANNTTLTGGTFTVAGDTAA
FT                   TKTKMTGGEFAVTGNAKIEDTVLNASDFSLADKATANNTTLTDGTFTVAGDAAVTATNM
FT                   SGGKFAVKGKAKIKDTQLSAGNFTLAENATANDTTLNGGKFDVSNEATATNTTINNGLF
FT                   TLKDGAHADSTTVNSGTFVMADQSTANGIQLVDSAFTLASGAKASGITKLTGGQAQVAG
FT                   SLESLSLTGGRADFANSAKASGLLDISADSQIIMNRGADTAQANLNLAGRLELLASDVA
FT                   QAVAQPVARAAMELSNARAVMPAPAMPVPAAAPVAHFALNDVVMTGGTVDMSNAKNAQL
FT                   TMASLNGTGNFNLGSVMQSDSVAPLNVSGDANGDFIIAMNSSGQAPTNLNVVNTNGGDA
FT                   RFALANGPVALGNYMTNLAKDANGNFVLTADKSAMTPGTAGILAVANTTPVIFNAELSS
FT                   IQQRLDKQSTETNQSGMWGSYLNNNFAVKGRAANFDQKLNGMTLGGDKATALADGVLSV
FT                   GGFASYSSSDIKTDYQSKGKVDSHSFGAYAQYLANSGYYMNAVVKNNQFSQDVNITSIN
FT                   GSASGVSNFSGMGIALKAGKHFNFNEAYVSPYVAMSAFSSGKSNISLSNGMEAQSSSTR
FT                   SAMGTLGVNAGYRFVMNNGAELKPYAIFAVDHEFAKNNQVTVNQEVFDNNLSGTRVNTG
FT                   AGMNVNITPNLSVGSEVKLSSGKDIKTPVTINLNVGYSF"
FT   gene            complement(446386..446526)
FT                   /locus_tag="YpAngola_A0424"
FT   CDS_pept        complement(446386..446526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0424"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86995"
FT                   /protein_id="ABX86995.1"
FT                   /translation="MTINQVKSREPIAAPCGFYQSIALYQLITLYQSIIIVTINSYQQL
FT                   T"
FT   gene            446947..450391
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0426"
FT                   /note="pertactin family; this gene contains a frame shift
FT                   which may be the result of sequencing error; identified by
FT                   match to protein family HMM PF03212"
FT   gene            complement(450729..451682)
FT                   /gene="sseB"
FT                   /locus_tag="YpAngola_A0427"
FT   CDS_pept        complement(450729..451682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sseB"
FT                   /locus_tag="YpAngola_A0427"
FT                   /product="sseB protein"
FT                   /note="identified by match to protein family HMM PF07179"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87630"
FT                   /protein_id="ABX87630.1"
FT                   /translation="MSFPPPSIDDKHAIDDSPAADDNHTADDNSAADERHEHHHHDEHG
FT                   EDLESLLKLAATASIHRTAFFRVLLDATVLVLVGDSEQGSDDGEMSFTTANGVNILHWE
FT                   KQDGESVIPFFTSVEVLQQALEQTDGETIGSEKQPFVAMPVRVLFEMTQGAHLFLNPKS
FT                   EYGKEFWPEEVAMLLKNGGLVQPAEMVVDKESQILLGQPEEYPSAMVDALIQLFSQRKP
FT                   VRRAFLALMHDKSVDEKPNLLIGLEVDGTANEVDQLIQEAGNVASDHAPDGGPVDFCLV
FT                   SEKERGVSHYLTTHTQAFYQRKWGSWLRNVIPSTNH"
FT   gene            complement(451761..453059)
FT                   /gene="pepB"
FT                   /locus_tag="YpAngola_A0428"
FT   CDS_pept        complement(451761..453059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepB"
FT                   /locus_tag="YpAngola_A0428"
FT                   /product="peptidase B"
FT                   /EC_number="3.4.11.23"
FT                   /note="identified by match to protein family HMM PF00883"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88378"
FT                   /db_xref="GOA:A9R811"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR008330"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R811"
FT                   /protein_id="ABX88378.1"
FT                   /translation="MTTEIMQISLSHNPADARWGEKALISTNDQGVTIHLTSHDQLGGI
FT                   QRAARKIDGQGIKQVKLAGEGWGLEQSWAFWQGFRGPKGQRSVVWAELPANEKTELEQR
FT                   LKIIDWVRDTINAPAEDLGPEQLAKNAIDLLCAVSCDAVSYRITKGEDLREQNYAGIYT
FT                   VGRGSDRAPVLLALDYNPTGNPDAPVMACLVGKGITFDSGGYSLKQSAFMDSMKSDMGG
FT                   AATLTGALALAAARGLKERVKLYLCCADNMVSGNAFKLGDIIRYRNGKTVEIMNTDAEG
FT                   RLVLADGLIDASEQNAPLIIDAATLTGAAKTALGNDYHALFSFDDELAQALLNSAHSEH
FT                   ELFWRLPLAEFHRSQLPSNFAELNNVAGGAYSAGASTAAAFLSHFVKNYQQGWLHIDCS
FT                   ATYRKSAVDQWSAGATGLGVRTVANLLLAQAKQ"
FT   gene            complement(453199..453399)
FT                   /locus_tag="YpAngola_A0429"
FT   CDS_pept        complement(453199..453399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04384"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86438"
FT                   /protein_id="ABX86438.1"
FT                   /translation="MSLTWQDTREIAEALYERFPDTDPKTVRFTDMHQWICELDGFDDD
FT                   PQRSNEKVLEAILLVWLDEFE"
FT   gene            complement(453429..453764)
FT                   /gene="fdx"
FT                   /locus_tag="YpAngola_A0430"
FT   CDS_pept        complement(453429..453764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="YpAngola_A0430"
FT                   /product="ferredoxin, 2Fe-2S type, ISC system"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86014"
FT                   /protein_id="ABX86014.1"
FT                   /translation="MPKIVFLPHKDLCPDGAVLEAIQGETILDVALRHGIDIEHACEKS
FT                   CACTTCHCVVREGFDSLPESSELEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYT
FT                   INHAREH"
FT   gene            complement(453767..455683)
FT                   /gene="hscA"
FT                   /locus_tag="YpAngola_A0431"
FT   CDS_pept        complement(453767..455683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscA"
FT                   /locus_tag="YpAngola_A0431"
FT                   /product="Fe-S protein assembly chaperone HscA"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR01991"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85353"
FT                   /protein_id="ABX85353.1"
FT                   /translation="MALLQISEPGLTAAPHQRRLAAGIDLGTTNSLVATVRSGKAQTLA
FT                   DEQLADEQLIADEQLIAGQQLINEKQRDLLPSVVHYHPQGIDVGWKARNLAALDPVNTI
FT                   SSVKRMMGRSLADIVQRYPNLPYQFHASENGLPMIQTARGLVNPVQVSAEILKTLAQRA
FT                   QAALAGELDGVVITVPAYFDDAQRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLDSGQE
FT                   GVIAVYDLGGGTFDISILRLSRGVFEVLATGGDSALGGDDFDHLLADWLREQAGVATRD
FT                   DHGIQRQLLDTAIAAKIALSEAETAVVSVAGWQGEVTREQLESLIAPQVKRTLMACRRA
FT                   LKDAGVTADEILEVVMVGGSTRVPLVREQVGQFFGRTPLTSIDPDKVVAIGAAIQADIL
FT                   VGNKPDSDMLLLDVIPLSLGLETMGGLVEKVIPRNTTIPAARAQEFTTFKDGQSAMMIH
FT                   VLQGERELVKDCRSLARFTLRGLPPLPAGGAHIRVTFQVDADGLLSVTAMEKSTGVEAS
FT                   IQVKPSYGLSDDEIANMIKDSMANAQSDITARKLAEQRVDAARVLESLQGALAEDAALL
FT                   SEQESAAIAQAVALLQQQMQGSDPQAIEAAIKALDAQTQDFAARRMDASIRRALAGHSV
FT                   DEV"
FT   gene            complement(455926..456450)
FT                   /gene="hscB"
FT                   /locus_tag="YpAngola_A0432"
FT   CDS_pept        complement(455926..456450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /locus_tag="YpAngola_A0432"
FT                   /product="Fe-S protein assembly co-chaperone HscB"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF07743; match to protein
FT                   family HMM TIGR00714"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84960"
FT                   /db_xref="GOA:A9R815"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R815"
FT                   /protein_id="ABX84960.1"
FT                   /translation="MDYFTLFGLPARYLIDGNQLTTRYQELQRQFHPDRFATQPERERL
FT                   ASMQQAATINDAYQTLKHPLKRAEYMLSLQGFDLGNEQHTMRDTAFLMEQLELREELDA
FT                   IERKPDAETLLAEFSRRVAQMTTTRTQQMVEQLDAQLWVQAADTVRKLRFLDKLQQQVE
FT                   QLEERLFDDFA"
FT   gene            complement(456561..456884)
FT                   /gene="iscA"
FT                   /locus_tag="YpAngola_A0433"
FT   CDS_pept        complement(456561..456884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscA"
FT                   /locus_tag="YpAngola_A0433"
FT                   /product="iron-sulfur cluster assembly protein IscA"
FT                   /note="identified by match to protein family HMM PF01521;
FT                   match to protein family HMM TIGR00049"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88152"
FT                   /db_xref="GOA:A9R816"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R816"
FT                   /protein_id="ABX88152.1"
FT                   /translation="MSISISDSAAQRVSAFLNHRGKGLGLRLGVRTSGCSGMAYVLEFV
FT                   DEINDDDIVFEDKGVKVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGES
FT                   FNV"
FT   gene            complement(457154..457540)
FT                   /gene="iscU"
FT                   /locus_tag="YpAngola_A0434"
FT   CDS_pept        complement(457154..457540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscU"
FT                   /locus_tag="YpAngola_A0434"
FT                   /product="FeS cluster assembly scaffold IscU"
FT                   /note="identified by match to protein family HMM PF01592;
FT                   match to protein family HMM TIGR01999"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85643"
FT                   /protein_id="ABX85643.1"
FT                   /translation="MAYSEKVIDHYENPRNVGSFDSQDPTIGSGMVGAPACGDVMKLQI
FT                   KVNEAGIIEDARFKTYGCGSAIASSSLVTEWMKGKSLDQAEAIKNTQIAEELELPPVKI
FT                   HCSILAEDAIKAAIADYKSKHTAK"
FT   gene            complement(457571..458800)
FT                   /gene="iscS"
FT                   /locus_tag="YpAngola_A0435"
FT   CDS_pept        complement(457571..458800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS"
FT                   /locus_tag="YpAngola_A0435"
FT                   /product="cysteine desulfurase IscS"
FT                   /EC_number="2.8.1.7"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM TIGR02006"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86484"
FT                   /protein_id="ABX86484.1"
FT                   /translation="MTESKVKTPIYLDYAATTPVDPRVAEKMMQYLTLDGIFGNPASRS
FT                   HKFGWQAEEAVDIARNDVAALVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIIT
FT                   CKTEHKAVLDSCRQLEREGFEVTYLAPQPNGIIDLKQLEATMREDTILVSIMHVNNEIG
FT                   VVQDIAEIGEMCRSRGIIFHVDATQSVGKLPIDLSKLKVDLMSFSAHKVYGPMGIGALF
FT                   VRRKPRIRIEAQQHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMESEAARLRSLRLR
FT                   LWNGIKDIEEVYLNGSLENGAPGILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEP
FT                   SYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYAIALVHKSIGRLRDLSPLWDMFKQGV
FT                   DISSIEWSHH"
FT   gene            complement(458854..459348)
FT                   /gene="iscR"
FT                   /locus_tag="YpAngola_A0436"
FT   CDS_pept        complement(458854..459348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscR"
FT                   /locus_tag="YpAngola_A0436"
FT                   /product="iron-sulfur cluster assembly transcription factor
FT                   IscR"
FT                   /note="identified by match to protein family HMM PF02082;
FT                   match to protein family HMM TIGR00738; match to protein
FT                   family HMM TIGR02010"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85106"
FT                   /db_xref="GOA:A9R819"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R819"
FT                   /protein_id="ABX85106.1"
FT                   /translation="MRLTSKGRYAVTAMLDVALHSQDGPVPLADISERQGISLSYLEQL
FT                   FSRLRKNGLVASVRGPGGGYLLGKDASAIAVGAVITAVDESVDATRCQGKEGCQGGNRC
FT                   LTHTLWRDLSERISSFLNNITLAELVNNQDILEVADRQNNDTRRTANGRPQETINVNLR
FT                   A"
FT   gene            complement(459504..460277)
FT                   /locus_tag="YpAngola_A0437"
FT   CDS_pept        complement(459504..460277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0437"
FT                   /product="RNA methyltransferase, TrmH family, group 1"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00050"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87605"
FT                   /protein_id="ABX87605.1"
FT                   /translation="MLHNIRIVLVETSHTGNMGSTARAMKTMGLTNLYLVNPLVKPDSQ
FT                   AIALSAGASDVIGKATIVDTLDEALAGCSLVVGTSARSRTLPWPMLEPRECGVRSAREA
FT                   EHAPVALVFGRERVGLTNDELQKCHYHVAIPANPEYSSLNLAMAVQILAYEVRVAYLDR
FT                   QQANAPVEEEEEAPYPLVDDLERFYQHLEQVLSHSGFIRQAHPGQIMSKLRRLFTRARP
FT                   EAQELNILRGMLTSIEKQDKYPQRGTGDTAGKSKD"
FT   gene            460396..461199
FT                   /gene="suhB"
FT                   /locus_tag="YpAngola_A0438"
FT   CDS_pept        460396..461199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="YpAngola_A0438"
FT                   /product="inositol-1-monophosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="identified by match to protein family HMM PF00459"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86113"
FT                   /protein_id="ABX86113.1"
FT                   /translation="MHPMLTIAIRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDR
FT                   DAEHLIIDVIRKSYPKHTIISEECGELVGEDDDVQWVIDPLDGTTNFIKRLPHFAVSIA
FT                   VRIKGRTEVAVVYDPMRNELFTASRGQGAQLNGYRLRGTNAKDLDGTILATGFPFKVKQ
FT                   HAPAYIRVVGKLFEQCADFRRTGSAALDLAYVAAGRVDGFFEIGLKPWDFAGGELLVRE
FT                   SGGIVTDFAGGHNHFSSGNIVAGNPRIVKSIVQAMSNEISDALKR"
FT   gene            complement(461298..462320)
FT                   /locus_tag="YpAngola_A0439"
FT   CDS_pept        complement(461298..462320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0439"
FT                   /product="transporter, Ni2+-Co2+ transporter (NiCoT)
FT                   family"
FT                   /note="identified by match to protein family HMM PF03824"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88165"
FT                   /protein_id="ABX88165.1"
FT                   /translation="MSVVIAPIPRPKQRHWLINLWPLLLFLLILASAGYVSWLYWPELL
FT                   FKTVAWQKSVHQQMAQLLQQVKAEPHQAGWVLMLFSLIYGVLHAVGPGHGKVVIVTYLA
FT                   THPARLKSSLKLTFAASILQGSVAILLVTLLLGVWQLSSRYLHQSSFWLEKGSFLLVIG
FT                   LGMLLCFRAVKRIYRQINALKPQKMTFQQIQPLPANHVHSDNCGCGHRHLPSDKELQAG
FT                   GDWRTRLTIVLAMGMRPCSGAIMVLLFSKVIGVYWWGILSAMAMALGTSLTISLLALFV
FT                   HYARRLAVYLSRKRAPAAWGEIAWATLALTGGIILLFAGVLFYLSSQPEMVGAVRPFGR
FT                   "
FT   gene            complement(462311..462985)
FT                   /locus_tag="YpAngola_A0440"
FT   CDS_pept        complement(462311..462985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06226"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88615"
FT                   /protein_id="ABX88615.1"
FT                   /translation="MRYVLHYNGFITVSRLITLLLTGAAMIYSQLAQAHPHSFIDMKTT
FT                   FINEKQMLVGMKMVWTMDEITSSDLLYDAENAKSDSEIWKKLAAEVMANVLGQHYFTDI
FT                   YRDGQPVKYKNLPTEYHLSRQGHQAVLSFVLPLAEPQPLVGKPFIISTYDPTYFVDMAY
FT                   ADQKALSLSAEMEKNCKLTLMTPNPDASLQAYALSLDKSDSPGDDMELGKQFAQQVTLQ
FT                   CQ"
FT   gene            complement(462985..463113)
FT                   /locus_tag="YpAngola_A0441"
FT   CDS_pept        complement(462985..463113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86180"
FT                   /protein_id="ABX86180.1"
FT                   /translation="MNHRYLSDLSIAKEIHSVYRASSFLHRLTTYITVIAEYPRVE"
FT   gene            463127..464473
FT                   /gene="csiE"
FT                   /locus_tag="YpAngola_A0443"
FT   CDS_pept        463127..464473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csiE"
FT                   /locus_tag="YpAngola_A0443"
FT                   /product="stationary phase inducible protein CsiE"
FT                   /note="identified by match to protein family HMM PF00874"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85138"
FT                   /protein_id="ABX85138.1"
FT                   /translation="MRLNTPFKPRLSDDQPLSGQQRRCHMLLMLFMPARKVQLDTISQF
FT                   NGVDLATTRQDIAEVASEIQCFYHLELNASADDYYQINGSRLDKRLCLIHWLRRGLRYC
FT                   PHFIEHYFSPDLYQALAWNNGLLSSALRRSTLRQSTLRQSILRQSTLRQIVYQCEPHLN
FT                   RQLSEKDRQFLQLYLAYCVWENQQHTVPQLSMTQQQWLEQKPARVAADHLFNALNRLLI
FT                   PPLGLIERDMLILMLTMIKAHHYHSTQSPEDARLIAAIKQLIHRFKRLSGMHFSCDDSL
FT                   VSQLFAHLAPAIERCYFNIGIDHSLPKDISKMYPRLLRTTQQALIKFEQEYQIRFSIEE
FT                   VILIAISFGAWLIQGNALQEKQILLLTHDNPILEAQVEQQIRELTLLPLHIKYLSHDVY
FT                   LQSGAPAGTAVVLTPYVLQSTESAPPLIQISFPLTEPQSIQLCRILELP"
FT   gene            complement(464470..465627)
FT                   /locus_tag="YpAngola_A0442"
FT   CDS_pept        complement(464470..465627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0442"
FT                   /product="MFS transporter, phenyl propionate permease (PPP)
FT                   family"
FT                   /note="identified by match to protein family HMM PF01306;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87753"
FT                   /protein_id="ABX87753.1"
FT                   /translation="MVLQSTRWLSLSYFTYFFSYGIFLPFWGLWLEGEGIPPETIGILL
FT                   GAGLLSRFLGSLIIAPRVKDPSHLVTAIRILALLTLAFAVGFWFGNGWAWLMVVIAGFN
FT                   LFFGPLVPLTDALAATWQKQITMDYGKVRLWGALAFVIGSALTGKLVSVWGHPAILYSL
FT                   LFGVTAMLLGALLRPGVMPRGEVKHRNVAATPWKVLLSEPQVWRFLLCVTLLQGAHAAY
FT                   YSFSSIYWKDAGYSPATIGYLWSLGVVAEILVFAFSHILFRRWTARSLLLLSAVSGIIR
FT                   WSLMASTTELPWLIFIQILHCGSFTVCHLAAMRFISARSGADVIRLQSVYSALAMGGGI
FT                   AVMTVISGFLFENYQSGVFWVMALIVIPALFIRPRVAANPNELAS"
FT   gene            complement(465979..466518)
FT                   /gene="ail"
FT                   /locus_tag="YpAngola_A0444"
FT   CDS_pept        complement(465979..466518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ail"
FT                   /locus_tag="YpAngola_A0444"
FT                   /product="attachment invasion locus protein"
FT                   /note="identified by match to protein family HMM PF06316"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85541"
FT                   /protein_id="ABX85541.1"
FT                   /translation="MNKTLLVSSLIACLSIASVNVYAEGESSISIGYAQSRVKEDGYKL
FT                   DKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGLEESVDGFKLIDGDFKYYSVTAGPVFRI
FT                   NEYVSLYGLLGAGHGKAKVSSIFGQSESISETSLAYGAGLQFNPHPNFVIDASYEYSKL
FT                   DDVKVGTWMLGAGYRF"
FT   gene            complement(466987..468240)
FT                   /gene="glyA"
FT                   /locus_tag="YpAngola_A0445"
FT   CDS_pept        complement(466987..468240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="YpAngola_A0445"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by match to protein family HMM PF00464"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85370"
FT                   /db_xref="GOA:A9R8C1"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8C1"
FT                   /protein_id="ABX85370.1"
FT                   /translation="MLKREMNIADYDADLWRAMEQEVVRQEEHIELIASENYTSPRVMQ
FT                   AQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKALFGADYANVQPHSGSQANVA
FT                   VYSALLKPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGIDESGQIDYEDLARQAE
FT                   IHKPKMIIGGFSAYSGIVDWAKMREIADSIDAWFFVDMAHVAGLVAAGVYPNPVPHAHI
FT                   VTTTTHKTLAGPRGGLILAKGGDEDLYKKLNSSVFPGNQGGPLMHVIAGKAVALKEAME
FT                   PEFKIYQQQVAKNAKAMVAVFLERGYKVVSGGTDNHLFLLDLVDKDITGKDADAALGRA
FT                   NITVNKNSVPNDPKSPFVTSGVRIGSPAITRRGFKEAESRELAGWMCDVLDNINDEATI
FT                   ERVKQKVLAICARLPVYA"
FT   gene            468781..469971
FT                   /gene="hmp"
FT                   /locus_tag="YpAngola_A0446"
FT   CDS_pept        468781..469971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmp"
FT                   /locus_tag="YpAngola_A0446"
FT                   /product="flavohemoprotein"
FT                   /EC_number="1.14.12.17"
FT                   /note="identified by match to protein family HMM PF00042;
FT                   match to protein family HMM PF00175; match to protein
FT                   family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88692"
FT                   /protein_id="ABX88692.1"
FT                   /translation="MLDTQTIAIVKSTIPLLAATGPKLTAHFYERMFKHHPELKNIFNM
FT                   SNQSSGDQREALFNAICAYATNIENLAALLPTVERIAQKHTSLNIQPEHYPIVGEHLIA
FT                   TLDELFSPGQAVLDAWAKAYGVLADVFIQRESQIYQQSETETGGWRTLRRFRIIKKEQQ
FT                   SEVICSFVLAPEDGGQVLHYKPGQYLGIYIEHESLEFQEIRQYSLTTAPNGKTYRIAVK
FT                   REEQGTVSNLLHRELNEGDIVRIAPPRGDFFLDVSPDTPVALISAGVGQTPMLSMLNTL
FT                   YSQQHAAPVHWLHAAENGRVHAFADEVSAIAAKMPNLSRHVWYREPDLQDKHGEDYHSQ
FT                   GLMDLSSYQWLADDPKRHYYFCGPLPFMQFIGRQLLAQGIAPEQIHYECFGPHKVI"
FT   gene            470435..471016
FT                   /locus_tag="YpAngola_A0447"
FT   CDS_pept        470435..471016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0447"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86495"
FT                   /protein_id="ABX86495.1"
FT                   /translation="MSKRFIKKEGLALVSMARYLIGERSGNRLKTIDDLSGDFGISVGV
FT                   IQHALKVLEADGAIVVERRGRNGTRLLDLNMTLLLQQADLGNMVCAMPLPYTKLYEGLA
FT                   SGLKEQFTLLPLYFAHMRGAEVRIECLIDGVYDMAVVSHLAAKNYLKQEKVTLALNLGR
FT                   GSYVDGHQLIFCNERCNSDPHPTPEIRSRG"
FT   gene            471043..472065
FT                   /locus_tag="YpAngola_A0448"
FT   CDS_pept        471043..472065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0448"
FT                   /product="transposase for insertion sequence"
FT                   /note="identified by match to protein family HMM PF00665;
FT                   match to protein family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85955"
FT                   /protein_id="ABX85955.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            472065..472844
FT                   /locus_tag="YpAngola_A0449"
FT   CDS_pept        472065..472844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0449"
FT                   /product="putative transposition helper protein"
FT                   /note="identified by match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87653"
FT                   /protein_id="ABX87653.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(472854..473444)
FT                   /locus_tag="YpAngola_A0450"
FT   CDS_pept        complement(472854..473444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0450"
FT                   /product="thiazole biosynthesis protein ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87232"
FT                   /protein_id="ABX87232.1"
FT                   /translation="MSEDFNQRWQQLDWDDISLTINSKKPADVERALNAIKPTREDLMA
FT                   LISPAALAYLEPMAQKAQQLTRQRFGNTVSFYVPLYLSNLCANDCTYCGFSMSNRIKRK
FT                   TLDEAEIIRECEAIKALGFEHLLLVTGEHQTKVGMDYFRRHLPTIRSRFSSLMMEVQPL
FT                   AEDEYTELKALGLDGCQRRMKSDPLISPPTAQY"
FT   gene            complement(473437..474294)
FT                   /gene="thiG"
FT                   /locus_tag="YpAngola_A0451"
FT   CDS_pept        complement(473437..474294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="YpAngola_A0451"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /note="identified by match to protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88429"
FT                   /protein_id="ABX88429.1"
FT                   /translation="MIIFCCSKPLPEDDMLKIADTTFTSRLFTGTGKFSSPELMLEALR
FT                   ASGSQLITMAMKRVDLQSGNDAILAPLRQLGVRLLPNTSGAKTAEEAIFAARLAREALN
FT                   THWVKLEIHPDVRYLLPDPIETLKAAEVLVKEGFVVLPYCGADPVLCKRLEEVGCAAVM
FT                   PLGSPIGSNLGLRTRDFLQIIIEQSKVPVVVDAGIGAPSHALEALELGADAVLVNTAIA
FT                   VAHSPVQMAHAFRLAVESGERARLAGLGASPFNPSQPDTLQLRATATSPLTGFLSQLEE
FT                   QDHV"
FT   gene            complement(474254..474469)
FT                   /gene="thiS"
FT                   /locus_tag="YpAngola_A0452"
FT   CDS_pept        complement(474254..474469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="YpAngola_A0452"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88074"
FT                   /protein_id="ABX88074.1"
FT                   /translation="MKTNYIPIMLNDQPLEVECNLTAEMLLNQLKHHQPGTALAINQVI
FT                   IPRADWQNHRLQAGDHILLFQAIAGG"
FT   gene            complement(474466..475263)
FT                   /gene="thiF"
FT                   /locus_tag="YpAngola_A0453"
FT   CDS_pept        complement(474466..475263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="YpAngola_A0453"
FT                   /product="adenylyltransferase ThiF"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87661"
FT                   /protein_id="ABX87661.1"
FT                   /translation="MKNDQTLSDSEFLRYSRQLLLEDIGPEGQRKLKGASVLIVGLGGL
FT                   GSPAALYLAAAGVGQLLLADDDQLDLTNLQRQILYRTADIGQTLSNPTSSVSHNKARLA
FT                   QRHLQQLNPQIRIVALDTRLTGQVLTDAVANADLVLDCSDNMETRHQVNAACVTAQKPL
FT                   ISGSAVGFSGQLLVIEPPYAQGCYACIYPDKELPQRNCRTAGVLGPVVGVIGTLQALEA
FT                   IKMLAGIPLALSGKLRLFDGKQQSWSTLQLTRAAHCPACGGGL"
FT   gene            complement(475253..475927)
FT                   /gene="thiE"
FT                   /locus_tag="YpAngola_A0454"
FT   CDS_pept        complement(475253..475927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="YpAngola_A0454"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87252"
FT                   /protein_id="ABX87252.1"
FT                   /translation="MSQLDALSPVATPGFPSTEQRLGLYPVVDSLLWIERLLAAGVTTL
FT                   QLRIKNADDAQVEQDIVAAIELGKRYQARLFINDYWQLAVKHGAYGVHLGQEDLEAADL
FT                   AAIQQAGLRLGISTHDEHELAVAKTLRPSYIALGHIFPTQTKQMPSSPQGLASLSRQVK
FT                   NTPDYPTVAIGGISIERVPHVLATGVGSVAVVSAITLASDWQRATAQLLHLIEGKELAD
FT                   EK"
FT   gene            complement(475914..477959)
FT                   /gene="thiC"
FT                   /locus_tag="YpAngola_A0455"
FT   CDS_pept        complement(475914..477959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="YpAngola_A0455"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86537"
FT                   /protein_id="ABX86537.1"
FT                   /translation="MSNNTTSLPAENSSHPRKGTPIRKKQREEAQQFINTLQDVTFPNS
FT                   QRIYLQGSRPDIQVPMREIQLSPTQIGGSKNEPRYEDNEAIPVYDTSGPYGDPQAKLDV
FT                   HNGLPKLRAAWVADRQDTEALASVSSGFTQQRLADEGLDHLRFEHLPRPRKAATGQCVT
FT                   QLHYARQGKITPEMEFIALRENMGRERIRGEVLLQQHPGQAFGAHLPENITAEFVRQEV
FT                   AAGRAIIPANINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADT
FT                   VMDLSTGRYIHETREWILRNSPVPIGTVPIYQALEKVNGVAENLTWEMFRDTLLEQAEQ
FT                   GVDYFTLHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFREICQICA
FT                   AYDVSLSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQMI
FT                   RRNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHL
FT                   GLPNKEDVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPAT
FT                   ARAYHDETLPQESGKVAHFCSMCGPKFCSMKISQEVRDYAAAQEQAAAQAQAATPTTAA
FT                   QPIDITQPINMLQSGMEKMSAEFRSRGSELYHRPANLSAEANNEPT"
FT   misc_binding    complement(478093..478218)
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element)"
FT   gene            complement(478335..478844)
FT                   /gene="rsd"
FT                   /locus_tag="YpAngola_A0456"
FT   CDS_pept        complement(478335..478844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsd"
FT                   /locus_tag="YpAngola_A0456"
FT                   /product="regulator of sigma D"
FT                   /note="identified by match to protein family HMM PF04353"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86078"
FT                   /db_xref="GOA:A9R8D2"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR023785"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8D2"
FT                   /protein_id="ABX86078.1"
FT                   /translation="MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKEK
FT                   HTPLNAKTLENFCHNLVDYLSSGHFHLYDRIIKEVEGASSPKMALTAKIHPALKNNTQT
FT                   IMAFHDCYTNIEIDDDSCTEYQQALSDIGEALDARFRLEDQLIQWAAESWQAAQLADAD
FT                   KKSQVN"
FT   gene            478941..479723
FT                   /locus_tag="YpAngola_A0457"
FT   CDS_pept        478941..479723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0457"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM PF09296; match to protein
FT                   family HMM PF09297"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86856"
FT                   /db_xref="GOA:A9R8D3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8D3"
FT                   /protein_id="ABX86856.1"
FT                   /translation="MELQLTGKESGWWIVSHENKLWLPKGELPQGNAANWSLQGTTARQ
FT                   IGEWQGQSVWLIRQMMPSGMGSVRQLLDVDRGLFQLAGRGVQLAEFYRSHRFCGYCGHE
FT                   MHASRTEWASLCNHCRERYYPQIAPCVIVAIRRGDEILLAQHVRHRGGINTVLAGFVEV
FT                   GETLEQAVSREVLEESNIHIKNLRYVTSQPWPFPHSLMMAFMADYDSGELCHDPKELLN
FT                   AGWYRYDQLPLLPPPGTVARRLIEDTVVLCREHSDLSQ"
FT   gene            479816..480601
FT                   /locus_tag="YpAngola_A0458"
FT   CDS_pept        479816..480601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0458"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86426"
FT                   /protein_id="ABX86426.1"
FT                   /translation="MRPIITQTVQPVTSMYPSLPKAFIQDKVMLSLHNKAALDSTIKGD
FT                   AVRALLLHAYVDIKGNEVERRTTAVGIQKLYEEVLQELLYQDPKCISVMISHTANPPTP
FT                   LSIASPERVMQMMHQNIRQDIASQKTITDRTQTLHNLLSYKNQFQYKAIYDQPRLKPEE
FT                   NYNFKMVNDVHENLHSIQTDSCCKAGALTGATYFLQDSPGEIHVFGIRITQANEESGKV
FT                   ELFQGLKSDVQTNNKLDSLYLLLRGNSHQSPDDISSSVG"
FT   gene            480720..481787
FT                   /gene="hemE"
FT                   /locus_tag="YpAngola_A0459"
FT   CDS_pept        480720..481787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="YpAngola_A0459"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="identified by match to protein family HMM PF01208;
FT                   match to protein family HMM TIGR01464"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88255"
FT                   /db_xref="GOA:A9R8D5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8D5"
FT                   /protein_id="ABX88255.1"
FT                   /translation="MNELKNDRYLRALLRQPVDMTPVWMMRQAGRYLPEYKATRAIAGD
FT                   FMSLCKNAELACEVTMQPLRRYPLDAAILFSDILTIPDAMGLGLYFETGEGPRFQSPIT
FT                   CRADVEKLPIPDPEQELGYVMNAVRTIRRELAGSVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKLKKMMYAEPQTLHLLLDKLADSVILYLNAQIKAGAQSVMIFDTWGGVLTGRDYHEF
FT                   SLNYMHKIVDGLIRENEGRRVPVTLFTKGGGPWLEAMAATGCDALGLDWTTDIADARRR
FT                   VGDKVALQGNMDPSVLYAPPARIEQEVSTILASFGQGEGHVFNLGHGIHQDVPPAHAGA
FT                   FVNAVHALSRPYHQK"
FT   gene            481817..482557
FT                   /gene="nfi"
FT                   /locus_tag="YpAngola_A0460"
FT   CDS_pept        481817..482557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfi"
FT                   /locus_tag="YpAngola_A0460"
FT                   /product="endonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /note="identified by match to protein family HMM PF04493"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87743"
FT                   /protein_id="ABX87743.1"
FT                   /translation="MVKTKSRVETKSMFDTKALQAEQRQRASEISLHDGIDNQSVRFIA
FT                   GADVGFEQHGEITRAAIAILRYPSLALVEYQVARVATSLPYIPGLLSFREYPALLAAWA
FT                   QLQQRPDLILVDGQGIAHPRRLGVASHFGLLVDVPTIGVAKSRLCGDFLPLHQDVGAVQ
FT                   PLFDNDEQLGWVWRSKIRCNPLFISPGHRVSVGSALAWVQRCMAGYRLPEPTRWADAIA
FT                   SNRPQFQRWLRKNPDFLGKRRDMI"
FT   gene            482603..483193
FT                   /locus_tag="YpAngola_A0461"
FT   CDS_pept        482603..483193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04222"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85710"
FT                   /protein_id="ABX85710.1"
FT                   /translation="MLRNPIHLRLEKLESWQHLTFMACLCERMYPNYQQFCLETGFGDP
FT                   AVYRRILDLIWETLVVKDAKVNFDSQLEKLEEAIPSSDDYAIYGVYPAIDACIALSEAI
FT                   HSRLSGETLEHAIAISEASIRTVAMLEMTLAGKEMTDEELKILPAIEEEWDIQWEIFRL
FT                   LADCEERDLDLIKGLRSDLREAAVSNIGINLTQ"
FT   gene            483382..483657
FT                   /gene="hupA"
FT                   /locus_tag="YpAngola_A0462"
FT   CDS_pept        483382..483657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="YpAngola_A0462"
FT                   /product="DNA-binding protein HU-alpha"
FT                   /note="identified by match to protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85177"
FT                   /protein_id="ABX85177.1"
FT                   /translation="MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQLV
FT                   GFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVKS"
FT   gene            483701..484360
FT                   /locus_tag="YpAngola_A0463"
FT   CDS_pept        483701..484360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0463"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF07356"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85402"
FT                   /protein_id="ABX85402.1"
FT                   /translation="MFMQRVLITFGLTLGLSACSSLSDPPQFSASGYIADSGVVRLWRQ
FT                   DNAQQQPQVLMSVYSPYFGGNTRVTFYEYQNGILREIRRNDLGATPQSVQLRFDEQGQV
FT                   SFMQRQLASRRESLSADDIAVYQLEAKRILELSRVLRAGDVRLIQGRWQDGMLTTCAGK
FT                   TLRLNLDDNSQAWLTTRGEKNTQPLGVAWLDSSEGQQLLLVANQDFCRWEPQAGSL"
FT   gene            complement(484508..485794)
FT                   /gene="purD"
FT                   /locus_tag="YpAngola_A0464"
FT   CDS_pept        complement(484508..485794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="YpAngola_A0464"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02655; match to protein
FT                   family HMM PF02843; match to protein family HMM PF02844;
FT                   match to protein family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84924"
FT                   /protein_id="ABX84924.1"
FT                   /translation="MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLEN
FT                   VDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGS
FT                   KAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEE
FT                   AETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGGNVLPMATSQDHKRVGDGD
FT                   TGPNTGGMGAYSPAPVVTDDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQ
FT                   PKVIEFNCRFGDPETQPIMLRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGG
FT                   YPADYRQGDVIHGLPQQEVKDGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQ
FT                   YAYQLAEGIQWEGVFCRKDIGYRAIARGK"
FT   gene            complement(485854..487443)
FT                   /gene="purH"
FT                   /locus_tag="YpAngola_A0465"
FT   CDS_pept        complement(485854..487443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="YpAngola_A0465"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85892"
FT                   /db_xref="GOA:A9R8E1"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8E1"
FT                   /protein_id="ABX85892.1"
FT                   /translation="MQQRRPIRRALLSVSDKAGIIEFAQALSQRGIELLSTGGTARLLA
FT                   DAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDGIMAQHGIQPIDIVVVN
FT                   LYPFAQTVARPDCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYPAIITELDNN
FT                   DGSLTYPTRFNLAIKAFEHTAAYDSMIANYFGTLVPPYHGDTEQPSGHFPRTLNLNYIK
FT                   KQDMRYGENSHQQAAFYIEEDVKEASVATAQQLQGKALSYNNIADTDAALECVKEFSEP
FT                   ACVIVKHANPCGVAIGDSILAAYERAYQTDPTSAFGGIIAFNRELDAATASAIISRQFV
FT                   EVIIAPTVSSDALALLAAKQNVRVLTCGQWQARSAGLDFKRVNGGLLVQERDLGMVTAA
FT                   DLRVVSKRQPTEQELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSRVYSAKIAG
FT                   IKAADEGLEVAGSAMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEVIAAADEHSI
FT                   AMIFTDMRHFRH"
FT   gene            complement(487911..488057)
FT                   /locus_tag="YpAngola_A0466"
FT   CDS_pept        complement(487911..488057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85456"
FT                   /protein_id="ABX85456.1"
FT                   /translation="MLKDYFLQIGILTEVKMFTALVTLQDLILFLPAETGVDIVLRVPT
FT                   QIV"
FT   gene            488126..489603
FT                   /gene="rrs"
FT                   /locus_tag="YpAngola_A0467"
FT   rRNA            488126..489603
FT                   /gene="rrs"
FT                   /locus_tag="YpAngola_A0467"
FT                   /product="16S ribosomal RNA"
FT   gene            489746..489824
FT                   /locus_tag="YpAngola_A0468"
FT   tRNA            489746..489824
FT                   /locus_tag="YpAngola_A0468"
FT                   /product="tRNA-Ile"
FT   gene            489874..489951
FT                   /locus_tag="YpAngola_A0469"
FT   tRNA            489874..489951
FT                   /locus_tag="YpAngola_A0469"
FT                   /product="tRNA-Ala"
FT   gene            490169..493075
FT                   /gene="rrl"
FT                   /locus_tag="YpAngola_A0471"
FT   rRNA            490169..493075
FT                   /gene="rrl"
FT                   /locus_tag="YpAngola_A0471"
FT                   /product="23S ribosomal RNA"
FT   gene            493185..493300
FT                   /gene="rrf"
FT                   /locus_tag="YpAngola_A0472"
FT   rRNA            493185..493300
FT                   /gene="rrf"
FT                   /locus_tag="YpAngola_A0472"
FT                   /product="5S ribosomal RNA"
FT   gene            493425..493503
FT                   /locus_tag="YpAngola_A0473"
FT   tRNA            493425..493503
FT                   /locus_tag="YpAngola_A0473"
FT                   /product="tRNA-Asp"
FT   gene            493510..493587
FT                   /locus_tag="YpAngola_A0474"
FT   tRNA            493510..493587
FT                   /locus_tag="YpAngola_A0474"
FT                   /product="tRNA-Trp"
FT   gene            494565..495521
FT                   /locus_tag="YpAngola_A0475"
FT   CDS_pept        494565..495521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0475"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   sugar-binding protein"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86330"
FT                   /protein_id="ABX86330.1"
FT                   /translation="MYRRLLLAAAVTAAMCSAVQAAPLVVGFSQIGSESGWRSAETKVA
FT                   KQEAEKRGITLKIADAQQKQENQIKAVRSFIAQGVDAIFIAPVVATGWTPVLQEAKEAK
FT                   IPVFLLDRMIEVNDPSLYTAAVASDSVYEGKVAGEWLLQDVAGKPCNVVELQGTVGSSV
FT                   AINRKKGFADGIASAPGVKIIRSQSGDFTRSKGKEVMESFIKAEQNGKNICAVYAHNDD
FT                   MAIGAIQAIKEAGLKPGSDIKIVSIDGVPDIFKAMSSGEANATVELTPNMAGPALDALI
FT                   VLKKDGTQPPKFIQTESRLLQPDTAKQEYELKKSLGY"
FT   gene            495607..497097
FT                   /locus_tag="YpAngola_A0476"
FT   CDS_pept        495607..497097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0476"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   sugar-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85868"
FT                   /protein_id="ABX85868.1"
FT                   /translation="MEILLEVRGLSVEFPGVKALDSVDFSLQRGEVVALLGENGAGKST
FT                   LIKALTGVYKRSAGEVLLDGKAVCPIDTADAQLMGIGTVYQEVNLLPNISVAANLFIGR
FT                   EPLRWGLIDHNKMNQQAAKLLTGYGLTLDVQQPLANFSIAIQQIVAIARAVDLSAKVLI
FT                   LDEPTASLDAKEVSMLLDILCQLRDQGIGMVFVTHFLDQVYRISDRITVLRNGKLVGTK
FT                   TVAELPRIELVQMMLGHSFDEQLLKRGEHSITNKNPLVEFKNYGRRGVVENFDLSVSPG
FT                   EIVGLAGLLGSGRTETAQLIFGITTPDTGEAKIQGKPVKIRTPRKASKFGFGYCPEDRK
FT                   TEGIVGAATVRENIILALQAQRGWLRPLSMREQTQIADDFIQQLGIRTPSPEQQIQYLS
FT                   GGNQQKVLLARWLATKPRFLILDEPTRGIDVGAHAEIIRLIEKLCDEGLALLIISSELE
FT                   ELAGYADRIIVLRDRRHVAQLDHDEISVPAIMQAIAVQ"
FT   gene            497109..498128
FT                   /locus_tag="YpAngola_A0477"
FT   CDS_pept        497109..498128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0477"
FT                   /product="putative sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87642"
FT                   /protein_id="ABX87642.1"
FT                   /translation="MGNRSLSMTQRPRKVKWVLPKGATQFGALAVILLIDSLVAPHFFS
FT                   IHIQDGRLFGSIIDILNRGAPVALLALGMTLVIATGGIDLSVGAVMAIAGATAATLTSA
FT                   GYPFMTVLALSLAVGALCGLWNGFLVAVLQIQPIVATLMLMVAGRGIAQLITEGQIVTF
FT                   DSGGLATLGSSTLMYLPMSVVIACSMLILVWLLTRKTALGLFIESVGINLRSARNAGVS
FT                   TRLVLIAVYVICGVCAAVAGIIVTADIRGADANNAGLWLELDAILAVVIGGASLMGGRF
FT                   NLLLSVIGALIIQGMNTGILLSGYQPEFNLVLKAIVVLAVLVVQSPMISLSHLFQRRK"
FT   gene            498128..499120
FT                   /locus_tag="YpAngola_A0479"
FT   CDS_pept        498128..499120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0479"
FT                   /product="putative sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88481"
FT                   /protein_id="ABX88481.1"
FT                   /translation="MLKRNVPLLITIAVFILGYAFCLSQFPSFSSSRVWCDLLTDNAFL
FT                   GIVAVGMTFVILSGGIDLSVGSVIAFTGVLLAKLIGTYGIHPVYAFAIVLVMGAMFGAL
FT                   MGWIIDSLKLPAFIITLAGMFFIRGMSFIVSEESLPINHPIYETLANYAWRVPGGGRFT
FT                   LLAFIMLMVVAFGILLAHHTRFGHNVYAIGGNSVSAGLMGVPVRRTTIKIYMLSSTLAA
FT                   LSGIVFSLYTSAGYALAASGVELDAIAAVVIGGTLLAGGIGTVFGTLFGVLIQGLIQSY
FT                   ITFDGTLSSWWTKIVIGILLFSFIVIQKAMSAFYLNRRSRPQSSPLTPV"
FT   gene            complement(499107..499988)
FT                   /locus_tag="YpAngola_A0478"
FT   CDS_pept        complement(499107..499988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0478"
FT                   /product="substrate-binding transcriptional regulator, LysR
FT                   family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87320"
FT                   /db_xref="GOA:A9R8E7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR020890"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8E7"
FT                   /protein_id="ABX87320.1"
FT                   /translation="MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGA
FT                   NLFTRHRNNIRLTPAGERLVPYAEMLLNTWRLAKKEVIHSLQHTELSIGATASLWEAYL
FT                   TPWLQQLYEQQEELRLEARIALRNSLVKQLHERQLDLLITTEPPKMDELACLLLGHFSL
FT                   RLYSSFSLDLPKEDDTPNEHKNASEVPYIKLEWGADFHQQENRLLDSEQAPILTTTSAH
FT                   LTRQLLETTGGCAFLPEHWQKEYPQLVIHPDIPPIVRPLYAVWLQNSDQQALIRQLLKT
FT                   PMNNATQSVTRE"
FT   gene            500107..500445
FT                   /locus_tag="YpAngola_A0480"
FT   CDS_pept        500107..500445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04219"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88051"
FT                   /protein_id="ABX88051.1"
FT                   /translation="MADSFITTNRFFDNKHYPRGFSRHGDFTIKEAQLLERHGYAFNEL
FT                   DSGKREPVTEEEQRFVAVCRGEREPVSAEEKVWSKYVIRTRQPKRFHTLSGGKPQMDAV
FT                   EDYTDSDD"
FT   gene            complement(500702..502225)
FT                   /locus_tag="YpAngola_A0481"
FT   CDS_pept        complement(500702..502225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0481"
FT                   /product="Mg chelatase homolog"
FT                   /note="identified by match to protein family HMM PF01078;
FT                   match to protein family HMM PF07728; match to protein
FT                   family HMM TIGR00368"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87927"
FT                   /protein_id="ABX87927.1"
FT                   /translation="MSLATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLPETTVKEA
FT                   RDRVRSALINSGFNFPAKRITVSLAPADLPKEGGRYDLPIALAILAASEQIPADKLAHY
FT                   EFLGELALSGALRRVSGAIPAALTCSEANRQLILPTANGLEIGLIPQGNSWVADHLLAV
FT                   CGFLQGENPLAQGQPFEPAPSPDNHLDLHDIIGQSQAKRALEIAAAGGHNLLLLGPPGT
FT                   GKTMLATRLTGLLPPLTDQEALEAAAITGLLHSNALPTQWRCRAFRAPHHSASMAALIG
FT                   GGSIPRPGEISLAHNGVLFLDELPEFERRVLDSLREPLESGEIIISRAAAKICFPAKVQ
FT                   LIAAMNPSPSGHYQGVHNRTPPQQILRYLAKLSGPFLDRFDLSIEVPLLPAGMLGAQKN
FT                   QGESSATVKQRVLQARQRQMDRAGKINTQLTSQEVAEFCYLAPEDAAFLEQVLLTLGLS
FT                   VRAWHHILKVARTIADLAQEKTIQKSHLSEALSYRCMDRLLLQLHKSLM"
FT   gene            502848..504494
FT                   /gene="ilvB3"
FT                   /locus_tag="YpAngola_A0482"
FT   CDS_pept        502848..504494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB3"
FT                   /locus_tag="YpAngola_A0482"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85329"
FT                   /protein_id="ABX85329.1"
FT                   /translation="MNGAQWVVQALRAQGVDTVFGYPGGAIMPVYDALYDGGVEHLLCR
FT                   HEQGAAIAAIGYARATGKVGVCIATSGPGATNLITGLADALLDSVPVIAITGQVGSALI
FT                   GTDAFQEIDVLGLSLACTKHSFLVESLDALPEIMAEAFAIATSGRPGPVLIDIPKDIQL
FT                   AVGELTPHLKPVEEHSVDSAAELQHAWDMLANAQKPMLYVGGGVGMAQAVPALRDFIAM
FT                   TGIPAVATLKGLGAPDIAHPCYLGMLGMHGTKAANFAVQDCDLLVAVGARFDDRVTGKL
FT                   NTFASKAKVIHMDIDPAELGKLRQVHVALQGNLNVLLPALQQPLNIQSWRDEVMALKQQ
FT                   HHWRYDHPGQAIYAPLLLKQISERKAPETVVTTDVGQHQMWTAQHMNFTRPENFITSSG
FT                   LGTMGFGVPAAVGAQMARPDDMVICVSGDGSFMMNVQELGTIKRKQLPLKIVLLDNQRL
FT                   GMVRQWQQLFFDGRYSETNLSDNPDFITLASAFDIPGQRITRKDQVDAALDALFNSEGP
FT                   YLLQVSIDELENVWPLVPPGAGNETMLEKIS"
FT   gene            504491..504748
FT                   /gene="ilvM"
FT                   /locus_tag="YpAngola_A0483"
FT   CDS_pept        504491..504748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvM"
FT                   /locus_tag="YpAngola_A0483"
FT                   /product="acetolactate synthase isozyme II small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88402"
FT                   /protein_id="ABX88402.1"
FT                   /translation="MIQHQLSIQARFRPEMLERVLRVVRHRGFQVCAMNMSPMIDAGNV
FT                   NIELTVASQRPVDLLSSQLSKLMDVACVEILQPNTLQIRA"
FT   gene            504771..505697
FT                   /gene="ilvE"
FT                   /locus_tag="YpAngola_A0484"
FT   CDS_pept        504771..505697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="YpAngola_A0484"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="identified by match to protein family HMM PF01063;
FT                   match to protein family HMM TIGR01122"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87878"
FT                   /protein_id="ABX87878.1"
FT                   /translation="MTKKADYIWFNGEMVPWAEAKVHVMSHALHYGTSVFEGVRCYESH
FT                   KGPVVFRHREHMQRLHDSAKIYRMPVSQSVDELMEACRATLRKNNLTSAYIRPLVFIGD
FT                   VGMGVNPPEGYNTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRVAPNTIPTAAKAGGN
FT                   YLSSLLVGSEARRHGYQEGIALDVHGYLSEGAGENLFEVKDGILFTPPFTSSALPGITR
FT                   DAIIKLAKDMGLEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGIGKRGPVT
FT                   AKIQQAFFGLFTGETEDKWGWLDQVNP"
FT   gene            505954..507804
FT                   /gene="ilvD"
FT                   /locus_tag="YpAngola_A0485"
FT   CDS_pept        505954..507804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="YpAngola_A0485"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="identified by match to protein family HMM PF00920;
FT                   match to protein family HMM TIGR00110"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85173"
FT                   /db_xref="GOA:A9R8F3"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8F3"
FT                   /protein_id="ABX85173.1"
FT                   /translation="MPKYRSHTTTHGRNMAGARALWRATGMTDDDFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGKLVAEQIVASGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDKIIKLD
FT                   LIDAMIQGANPNVSDEESAQIERSACPTCGSCSGMFTANSMNCLNEALGLALPGNGSLL
FT                   ATHADRKQLFLDAGKHIVALTKRYYEQDDVSALPRNIANKAAFENAMILDIAMGGSTNT
FT                   VLHLLAAAQEGEIDFSMTDIDHLSRKVPHLCKVAPSTQKYHMEDVHRAGGVIGILGELD
FT                   RAGLLNRDVSNVLGLNLTQTLEAYDVMLTQDEGVKQMYAAGPAGIRTTKAFSQDCRYPS
FT                   LDTDREEGCIRTREHAYSQDGGLAVLYGNIAADGCIVKTAGVDKDSLTFRGPAKVFESQ
FT                   DEAVEAILGGKVVAGDVVVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALLTDGRFS
FT                   GGTSGLSIGHVSPEAASGGLIGLVQDGDFINIDIPNRGIVLDVSEAELAARRETEEAHG
FT                   DAAWSPKGRERQVSYALRAYAMLATSADKGAVRDKSKLGG"
FT   gene            507810..509354
FT                   /gene="ilvA"
FT                   /locus_tag="YpAngola_A0486"
FT   CDS_pept        507810..509354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="YpAngola_A0486"
FT                   /product="threonine ammonia-lyase, biosynthetic"
FT                   /EC_number="4.3.1.19"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM PF00585; match to protein
FT                   family HMM TIGR01124"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88490"
FT                   /protein_id="ABX88490.1"
FT                   /translation="MAVSQPLSAAPCGAEYLRAILRAPVYEVAQVTPLQVMEKISSRVG
FT                   NTVLVKREDRQPVHSFKLRGAYAMISSLTEEQKACGVVTASAGNHAQGVALSAHKMGIK
FT                   ALIVMPVATADIKVDAVRAFGGEVLLFGANFDEAKTKAIALAQEQGYTFVPPFDHPAVI
FT                   AGQGTLAMELLQQDAHLDRVFVPVGGGGLVAGVAVLIKQLMPQIKVIGVEAEDSACLRA
FT                   ALDAGQPVDLARVGLFAEGVAVKRIGDEPFRLCQEYLDDVITVDSDAICAAVKDLFEDV
FT                   RAIAEPSGALALAGLKKYVQQHNIQGERLAHVLSGANVNFHGLRYVSERCELGEQREAL
FT                   LAVTIPEQKGSFLRFCELLGGRSVTEFNYRYADAENACIFVGVRLTRGYAERVEILAEL
FT                   QDKGYQVVDLSDDEMAKLHVRYMVGGRPSKPLRERLFSFEFPESPGALLKFLHTLGTHW
FT                   NISLFHYRSHGTDFGRVLAAFELSATEPQFEERLAALGYYCHDETDNPAFKFFLAG"
FT   gene            complement(509485..509970)
FT                   /locus_tag="YpAngola_A0487"
FT   CDS_pept        complement(509485..509970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0487"
FT                   /product="putative enterobacterial membrane protein"
FT                   /note="identified by match to protein family HMM PF06092"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85855"
FT                   /protein_id="ABX85855.1"
FT                   /translation="MRLPGAVMKAKSKKIICALLLLGSILLGYFFWLSRHPVEIISVHQ
FT                   RNNYSDILVRNFPFTEKGKINWWLENRDMLKAKYSIPKPASDGFYTIIFWDFGDGYKEE
FT                   GKYDRLCFSDMNTTKNCIEKEKYMTIYKIKNDEPLFSFDGNRYFLNENNKIVKMKRE"
FT   gene            complement(510029..510511)
FT                   /locus_tag="YpAngola_A0488"
FT   CDS_pept        complement(510029..510511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0488"
FT                   /product="putative enterobacterial membrane protein"
FT                   /note="identified by match to protein family HMM PF06092"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85700"
FT                   /protein_id="ABX85700.1"
FT                   /translation="MRLPGAVMKAKSKKIICALLLLGSILLGYFFWLSLRPVEIVAIHK
FT                   DGNFSAVLVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITIWDFGDGYKEE
FT                   GKYDRRCFEDMKTSKNCIDKNSLMIIRNSQYNVMSFTLDSGIYQLKNGEIVKMKRE"
FT   gene            complement(510570..511031)
FT                   /locus_tag="YpAngola_A0489"
FT   CDS_pept        complement(510570..511031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0489"
FT                   /product="putative enterobacterial membrane protein"
FT                   /note="identified by match to protein family HMM PF06092"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86954"
FT                   /protein_id="ABX86954.1"
FT                   /translation="MKAKSKKTLYALLLIGSVLLGYFFWLSLRPVEIVAVHKDRNFSAV
FT                   LVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITIWDFGDGYKEEGKYDRRC
FT                   FEDMKTSKNCIDKNSLMIIRNSQYNVMSFTLDSGIYQLKNGEIVKMKHE"
FT   gene            complement(511015..511893)
FT                   /locus_tag="YpAngola_A0490"
FT   CDS_pept        complement(511015..511893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03034"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86293"
FT                   /protein_id="ABX86293.1"
FT                   /translation="MLETTKSTVQALYFPCTVFKTRKRMDDYGADDMRCGDLSATQLKT
FT                   DFNLHNISSKVNPYTLTLFQQLKPMPYGYAYDKNPESKKITRQECVRILFNEFRHESRS
FT                   FAFYGPYKHLIEKMIDHMQNGNGTPFRDLSLDAALKEQILSDYTEKNSTRLLLRKVLNE
FT                   NIDWRNKLYPAEKKDDIRKFILDGRLPKFDRFQDNFNGMGITVHDTWATDITIKSLQID
FT                   NDRYRAMVHYKIQDHFGLDNNDIKNTKFNRFHFFRIWFVLQRFNQFGFKPFMTNMEATI
FT                   EITGGRNESKK"
FT   gene            512541..512750
FT                   /locus_tag="YpAngola_A0491"
FT   CDS_pept        512541..512750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87573"
FT                   /protein_id="ABX87573.1"
FT                   /translation="MEDNGAVAKETIEGTVGYIGDDISLLTSAMNNFSSQVSEQVSMLG
FT                   AIQSNVTGSIAMISCYSIGRVIAA"
FT   gene            complement(512805..513686)
FT                   /gene="ilvY"
FT                   /locus_tag="YpAngola_A0492"
FT   CDS_pept        complement(512805..513686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvY"
FT                   /locus_tag="YpAngola_A0492"
FT                   /product="transcriptional regulator IlvY"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88141"
FT                   /protein_id="ABX88141.1"
FT                   /translation="MDLRDLKVFLHLAESRHFGRSAKAMHVSPSTLSRQIQRLEETIGQ
FT                   PLFLRDNRTVQLTDAGNQLKAFAQQTLLQYQQLLHALGQHGPSLSGELRLFCSVTAAYS
FT                   HLPPILDRFRARHPLVEIKLTTGDAADAVNKVQSNEADLGIAGRPEVLPTSVAFTQIGE
FT                   IPLVLIAPALPCAVRSQVAVEKPDWAMIPFILPEHGPSRKRIDLWFRRQRITNPLIYAT
FT                   VSGHEAIVSMVALGCGVALIPSVVVDNSPEPVRNRISLLDDVSLVEPFELGVCVPKKRL
FT                   QEPLIDAFWGLL"
FT   gene            513972..515450
FT                   /gene="ilvC"
FT                   /locus_tag="YpAngola_A0493"
FT   CDS_pept        513972..515450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="YpAngola_A0493"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="identified by match to protein family HMM PF01450;
FT                   match to protein family HMM PF07991; match to protein
FT                   family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86272"
FT                   /db_xref="GOA:A9R8G1"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8G1"
FT                   /protein_id="ABX86272.1"
FT                   /translation="MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVN
FT                   LTPDKQHSAVVKAVQPLMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLEFSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPA
FT                   KLRAYALSEQLKEIMAPLFQKHMDDIISGAFSSGMMADWANDDVKLLNWREETGRTAFE
FT                   NAPQFEGKISEQEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFANAAVPLLKEKFMDSLQAGDLGKSIPGSAVDNAQ
FT                   LRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG"
FT   gene            515631..515831
FT                   /locus_tag="YpAngola_A0494"
FT   CDS_pept        515631..515831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87572"
FT                   /protein_id="ABX87572.1"
FT                   /translation="MLYYEPEFLGSLRQEAYNTYEIAKTEREVAERNRVQKKPFGLFIE
FT                   EMTLQKTLTDSQVAETAAHII"
FT   gene            516027..517469
FT                   /locus_tag="YpAngola_A0495"
FT   CDS_pept        516027..517469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0495"
FT                   /product="S-type pyocin family protein"
FT                   /note="identified by match to protein family HMM PF06958"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87134"
FT                   /protein_id="ABX87134.1"
FT                   /translation="MGLLMQQQRVNADLETAKITEPQRVENARLTAEAAEKAARDRRIS
FT                   EEIAATEAKRQRMENERLAEQERQRVEGTKQQVSEASCAQQASAWQNRFTLPALQPSGS
FT                   AQYSFAASGMSAVGEAAELHNSFLAAQEQLSAIATISASGSVAAMIALGIYQTKVGESS
FT                   ERPPGWNVSPKFVGSISLSAMGLPATESLASQGEMALPVRMRIIDAKDWIGCTEIYAVK
FT                   TGVAGVLPKVKVGAAQYDESTGVYTFTTDSTPPRTLIFTPAQPPGAETRPILAPPGSTP
FT                   ATLQHTGEMIIKPVITPTILPLPQLYARDFHDYIIWFPADSGLEPVYVYLNSPYGKTTA
FT                   KGKYSGRDFNPDKAGGPIKNLDWKEIKIRGEGVDEVKLHTRRFGELEDNKLMIERLEKI
FT                   LTNKLTATDIDKRFYTHEIRELERYRMLGIPDDVNDKSVWNDAHTATLEDFKINEKTQP
FT                   LYTSEAEDAYIKAELKNSLGSK"
FT   gene            517469..517732
FT                   /locus_tag="YpAngola_A0496"
FT   CDS_pept        517469..517732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88348"
FT                   /protein_id="ABX88348.1"
FT                   /translation="MSIMEKIIQNETVEDVLLAFTPNTAYQGIERMYVRYRFNIVSNRE
FT                   LLFTYQRLIKEAKLAEDEKGHTLKGPNWKEPKFVTDKKYGIE"
FT   gene            518238..518495
FT                   /locus_tag="YpAngola_A0497"
FT   CDS_pept        518238..518495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0497"
FT                   /product="colicin-E7 immunity protein (ImmE7) (Microcin-E7
FT                   immunity protein)"
FT                   /note="identified by match to protein family HMM PF01320"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85449"
FT                   /protein_id="ABX85449.1"
FT                   /translation="MELKEKYEDYTEHEFLEFIRNICEVNTDSQSLHSSWVRHFTKITE
FT                   HPSGSDLIYYPEDGADDSPEGILELVKKWRAENGKPGFKK"
FT   gene            complement(518947..519105)
FT                   /locus_tag="YpAngola_A0498"
FT   CDS_pept        complement(518947..519105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0498"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85048"
FT                   /protein_id="ABX85048.1"
FT                   /translation="MGASSAQTLEAYYGLNITHNFSPCYIPVPLQDAGTLAALAHPSHL
FT                   VVDLKNK"
FT   gene            complement(519129..519863)
FT                   /locus_tag="YpAngola_A0499"
FT   CDS_pept        complement(519129..519863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0499"
FT                   /product="gram-negative pili assembly chaperone"
FT                   /note="identified by match to protein family HMM PF00345"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86332"
FT                   /protein_id="ABX86332.1"
FT                   /translation="MTTCRVLTLPALTIGVLIMSALATSAVASVIAERTRIVFSEGSTE
FT                   ESLQLVNSNSYPVAVQVWVDDGNLMATPDKAVSPILVLPPVFRLQPQAQRSLRLILSGG
FT                   SKLPADRESAFWLNIYEIPPKATPKSGDESFVTLALRMQYKVFYRPKNLPAPGDILGKA
FT                   LTFSLERNGDSALIKVNNPTPYYASFAALTIGSAEGPPEMVAPFSQLDFPLNRAPISDN
FT                   KTVNFDLIDDLGNRNSFSHELK"
FT   gene            complement(519913..521280)
FT                   /locus_tag="YpAngola_A0500"
FT   CDS_pept        complement(519913..521280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85911"
FT                   /protein_id="ABX85911.1"
FT                   /translation="MLRPTKPLISSGISQSTTAVYCRRPYFLAGMTLLIGLFSTSAWSN
FT                   CTRITAQNQISSSDGTAASWLGSRDDNNGSLNLPSIVDLSTNANFQPDGTLLASATSDF
FT                   TTFAVNTGYALDQVLFRCDAADVDQLYEMYATNGDSTYGGRYEDGTIAGNVSYGYATTV
FT                   MNVVIRFTNLATGEYYARIWKGRRLTGLDTDSSGRILVKAKNFSNVYTELFRIDYARSG
FT                   ANNTPSYLYGRSQPNAYIAFKGPGITGPIEGTDSYSNWPGWYSTWPASLGLYKYVTFRR
FT                   TTICAVSNFTPTVVLPRISVAELNNGNTSSADFNVDFQCQTGINSGVTAGTVAMGFLVP
FT                   AANAAKAQALGLMNGNGGVSHLVSDNYGAAGTAGGVGIRIYRNNSPMYLLSKNVTQTGN
FT                   NGGWYGILQGAQETTGSVDGGNSYTETFRAELSKISGQTVTAGAVNAHAQVVIRVQ"
FT   gene            complement(521297..523924)
FT                   /locus_tag="YpAngola_A0501"
FT   CDS_pept        complement(521297..523924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0501"
FT                   /product="fimbrial usher protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86744"
FT                   /protein_id="ABX86744.1"
FT                   /translation="MVQARVILKKNFSGRRKALTLCITLILHIDTAFGQEEPQNFEFDE
FT                   SLFLGTKYASGLTQLNKKNSITAGNYDAVDVLVNNKLFKRMSVQFIKDANSSEVYPCLS
FT                   DELLTAAGVELGRENSTPPKEPHVTEANTPITETHAPTNQCLPLSTRVKGASFRFDQAK
FT                   LRLELSIPQALLQKRPRGYIERAEWQEGEKLAFINYSANAYRSDTRGQQKRTSDFGFIG
FT                   LKSGINLGLWQVRQQSNVRYASNDSGSDTQWNSIRTYVQRPIPQLDSQLTLGETFTDST
FT                   LFGSMSFLGAKMATDQRMWPVSMRGFSPEVRGVASTNARVIIRQNGREIYETNVAPGPF
FT                   VINDLFSTSSQGDLNVEVIEANGSRSTFTVPFSAVPDSMRPGVSRYNAVIGESRDFTNI
FT                   DNYFTDFTYERGLTNQLTANSGVRLAKDYTALLAGGVLGTPVGALGLNATYSHAKVEND
FT                   KTQDGWRMQATYSQTFNQTGTTFSLAGYRYSTKGYRDLNDVFGVRSMQKNGGTWDSSTY
FT                   KQRSQFTTTINQDLGNWGQLYASASTSDYYNDTARDTQLQLGYSNSYQQISYNLAVSRQ
FT                   RSVYTSTLYNWDSPDTDETATTTRYGNTENIATFTVSIPLNIGSNNQYLSMSASRNPKS
FT                   GNNYQTSLSGTAGERNSFNYALNAGYDDSNFGSSSNNWGANVQKQFPNATVNGSYSRGN
FT                   NYTQYGAGARGAAVIHRQGVTLGPYLGETFGLIEANGAQGARIDSNGFALVPALTPYNY
FT                   NTIGLDTKGINRNTELKENQGRVVPYAGAAVKVKFETLTGYAVLIQAEGEGLPLGADVY
FT                   NSKDELVGMVGQGNQIYARIADNKGTLDVRWGESSGDQCQLPYAFNRQDTEQDIIHITA
FT                   SCRR"
FT   gene            complement(523952..524683)
FT                   /locus_tag="YpAngola_A0502"
FT   CDS_pept        complement(523952..524683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0502"
FT                   /product="gram-negative pili assembly chaperone"
FT                   /note="identified by match to protein family HMM PF00345"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85957"
FT                   /protein_id="ABX85957.1"
FT                   /translation="MLSIYARHYHYLFVTLLVAMSLSFANASVVMTGSRIIYPAAASEH
FT                   SIQLTNNDNFPNAVQVWLDSGDEKSTPETGKAPFIVTPPFFRIEANSGQTLRLKYTGSG
FT                   LPTDRESVFYLNFLQIPPVNKVEKDNKMLVLLRNRIKVFYRPESIIGRVDQVSTALTFS
FT                   LRKQGTNLVLTGKNPTGFYATIASGEIVSGSIKLKVKSNMIAPMSQVEWVIPNASVSSS
FT                   ATINFLIMNDFGGQDAGSYRI"
FT   gene            complement(524747..525277)
FT                   /locus_tag="YpAngola_A0503"
FT   CDS_pept        complement(524747..525277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0503"
FT                   /product="fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87552"
FT                   /protein_id="ABX87552.1"
FT                   /translation="MKKITLAIALFSASTTVAMSASNNTITFQGEVTAQTCSVTVNGLE
FT                   ANPVVLLPTVSSSDLDASGQTKGKTTFTLGVSGCTSGSDDLDIKTVFIGSLVTATGNLQ
FT                   NTGTAGNVELQLLKDATTTTGIDLNSGLAQDGIVLLAGDTSAEHDFAVQYYATGQSTPG
FT                   SVIASVQYAVSYL"
FT   gene            complement(526069..526860)
FT                   /locus_tag="YpAngola_A0504"
FT   CDS_pept        complement(526069..526860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0504"
FT                   /product="glutamine cyclotransferase"
FT                   /EC_number="2.3.2.5"
FT                   /note="identified by match to protein family HMM PF05096"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87238"
FT                   /protein_id="ABX87238.1"
FT                   /translation="MEILNIPRRCFTFLLIIITYSFPLSFADSKPLKYTFEVIRKIPHD
FT                   ETSFTQGLVIDDGKLYETTGLYKNSKIRELDLTNGKVIRSVNLPDNIFGEGITKLGDSF
FT                   YVLTWKEKKAFVINPNDLKIIKTFNYEGEGWGLTTDGINLIMGDGSDTLYFRNPADFSI
FT                   IKKISVTFDGRRIEKINELEWIDGMIYANVWYSDAILVIEPENGRVVKWIELSGLQFML
FT                   DSVNRNTNTLNGIAYDKSKNKIYLTGKNWSNIFEVKFLTSK"
FT   gene            complement(527099..527380)
FT                   /gene="ppiC"
FT                   /locus_tag="YpAngola_A0505"
FT   CDS_pept        complement(527099..527380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiC"
FT                   /locus_tag="YpAngola_A0505"
FT                   /product="peptidyl-prolyl cis-trans isomerase C"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86380"
FT                   /protein_id="ABX86380.1"
FT                   /translation="MANKASALHILVDDEKQANDILAQLNNGANFQELAKKFSNCPSKR
FT                   NGGDLGEFNKGDMVPAFDKAVFSCELLQPYGPVKTQFGYHIIKVLYRS"
FT   gene            complement(527400..527546)
FT                   /locus_tag="YpAngola_A0506"
FT   CDS_pept        complement(527400..527546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85806"
FT                   /protein_id="ABX85806.1"
FT                   /translation="MYQKATDEKKLPAFLIGNTHAAATKIRYTDALREPIEETLRKITL
FT                   SLK"
FT   gene            527584..529605
FT                   /gene="rep"
FT                   /locus_tag="YpAngola_A0507"
FT   CDS_pept        527584..529605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="YpAngola_A0507"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM TIGR01074"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85864"
FT                   /protein_id="ABX85864.1"
FT                   /translation="MRLNPSQQEAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRQCGY
FT                   QPKHIAAVTFTNKAAREMKERVAQTLGRKEARGLMIATFHTLGLEIIKKEYVALGMKSN
FT                   FSLFDAQDQMGLLKDLTHKWLEDDKTLLQQLVSAISNWKNDLLDPAAAAATARSERDKL
FT                   FVHCYGLYDAHLKACNVLDFDDLISLPTLLLQKNLEVRERWQNRLRYLLVDEYQDTNTS
FT                   QYQMVKLLVGNRARFTVVGDDDQSIYSWRGARPQNLVLLNEDFPALRVIKLEQNYRSSG
FT                   RILKAANILIANNPHVFEKKLFSELSYGDELKVITANNEDHEAERVVGELIAHHFVKKT
FT                   QYSDYAILYRGNHQSRLFEKLLMQNRIPYRISGGDSFFSRPEIKDLLAYLRVLTNQDDD
FT                   SAFLRIVNTPKREIGAATVQKLGEWANLRNKSLFRASFDLGLGEHLKGRGLESLQRFTH
FT                   WMDGIIRLVEREPVAAVRDLIHGIDYESWLFETAPSPKAAEMRMKNVNLLFSWMTEMLE
FT                   GSELDEPMTLTQVVTRFTLRDMMERGESDEELDQVQLMTLHASKGLEFPYVFLVGMEEG
FT                   LLPHQSSIDEDNVDEERRLAYVGITRAQRELFFTLCKERRQYGELIRPEPSRFLMELPQ
FT                   DDLNWENERKAVSPEERMQKGQSHLANLRAQLANAKKP"
FT   gene            complement(529773..531269)
FT                   /gene="gppA"
FT                   /locus_tag="YpAngola_A0508"
FT   CDS_pept        complement(529773..531269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gppA"
FT                   /locus_tag="YpAngola_A0508"
FT                   /product="guanosine-5'-triphosphate,3'-diphosphate
FT                   pyrophosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="identified by match to protein family HMM PF02541"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85529"
FT                   /db_xref="GOA:A9R8H6"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8H6"
FT                   /protein_id="ABX85529.1"
FT                   /translation="MMLSSTSLYAAIDLGSNSFHMLVVREVAGSIQTLARIKRKVRLAA
FT                   GLDNQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRVVATATLRLASNADEFLRTATEI
FT                   LGCPIQVISGEEEARLIYHGVAHTTGGPEQRLVVDIGGGSTELVTGNGAQANILVSLSM
FT                   GCVTWLERYFGDRHLAKENFERAELAAHEMIKPVAQRFREHGWQVCVGASGTVQALQEI
FT                   MVAQGMDELITLAKLQQLKQRAIQCGKLEELEIPGLTLERALVFPSGLSILIAIFQELS
FT                   IESMTLAGGALREGLVYGMLHLPVEQDIRRRTLRNLQRRYLLDTEQAKRVSCLADNFFL
FT                   QVEKEWHLDGRCREFLQNACLIHEIGLSVDFKHAPQHAAYLIRNLDLPGFTPAQKLLLS
FT                   ALLQNQSDTIDLSLLNQQNALPADMAQHLCRLLRLAIIFSSRRRDDTLPAVRLRADNNA
FT                   LYVLVPQGWLEQHPYRAEALEQESHWQSYVQWPLLLEELS"
FT   gene            complement(531273..532544)
FT                   /gene="rhlB"
FT                   /locus_tag="YpAngola_A0509"
FT   CDS_pept        complement(531273..532544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="YpAngola_A0509"
FT                   /product="ATP-dependent RNA helicase RhlB"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85005"
FT                   /protein_id="ABX85005.1"
FT                   /translation="MTEQKFSDFALHPLVVEALENKGFQYCTPIQALALPLTLSGRDVA
FT                   GQAQTGTGKTLAFLASTFHYLLSHPAEEGRQTNQPRALIMAPTRELAVQIHSDAESLSQ
FT                   VTGLKLGLAYGGDGYDKQLKVLESGVDILIGTTGRLIDYAKQNYINLGAIQVVVLDEAD
FT                   RMYDLGFIKDIRWLFRRMPSVDKRLNMLFSATLSYRVRELAFEQMNNAEYVEVEPLQKT
FT                   GHRIKEELFYPSNEEKMRLLQTLIEEEWPDRCIIFANTKHRCEEIWGHLAADGHRVGLL
FT                   TGDVAQKKRLRILEDFTKGDLDILVATDVAARGLHIPLVTHVFNYDLPDDCEDYVHRIG
FT                   RTGRAGESGHSISLACEEYALNLPAIETYTGHSIPVSKYNSDALLTDLPAPKRLARTRT
FT                   GNGPRRNSAPRRSGAPRNNRKRPG"
FT   gene            532678..533004
FT                   /gene="trx"
FT                   /locus_tag="YpAngola_A0510"
FT   CDS_pept        532678..533004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="YpAngola_A0510"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87971"
FT                   /protein_id="ABX87971.1"
FT                   /translation="MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDE
FT                   IAEEYEGRLTIAKLNIDDNQGTAPKYGIRGIPTLLLFRDGEVVATKVGALSKGQLKAFL
FT                   DANL"
FT   gene            533484..534743
FT                   /gene="rho"
FT                   /locus_tag="YpAngola_A0511"
FT   CDS_pept        533484..534743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="YpAngola_A0511"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF07497; match to protein
FT                   family HMM PF07498; match to protein family HMM PF08206;
FT                   match to protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88018"
FT                   /protein_id="ABX88018.1"
FT                   /translation="MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFSILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVAGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIATSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDFNRSGTRKEELLTTTDELQKMWILRRILHPMGEIDAMEFL
FT                   ISKLATAKTNDQFFDNMRRS"
FT   gene            535278..536375
FT                   /gene="wecA"
FT                   /locus_tag="YpAngola_A0512"
FT   CDS_pept        535278..536375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecA"
FT                   /locus_tag="YpAngola_A0512"
FT                   /product="undecaprenyl-phosphate alpha-N-acetylglucosaminyl
FT                   1-phosphatetransferase"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by match to protein family HMM PF00953;
FT                   match to protein family HMM TIGR02380"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88611"
FT                   /protein_id="ABX88611.1"
FT                   /translation="MNLLTMSTELIYIFLFSMAFLFVARKVAIKIGLVDKPNYRKRHQG
FT                   LIPLVGGISVFAGVCFAFLITNQQIPHFRLYLACAGLLVFVGALDDRFDISVKIRAFVQ
FT                   ALVGIAMMAVAGLYLRSLGHAFGPWEMVLGPFGYVVTLFAVWAAINAFNMVDGIDGLLG
FT                   GLSCVSFGAMGILLYQSGQMSLALWCFAMIATIIPYILLNLGLLGRRYKVFMGDAGSTL
FT                   IGFTAIWILLQATQGNAHPINPVTALWIIAIPLMDMIAIMYRRLRKGMSPFSPDRQHIH
FT                   HLIMRAGFTSRQAFVLITLAAALLAMIGVIGERLTFIPEWVMLALFLLAFLLYGYCIKR
FT                   AWRVARFIKRFKRRMRRASKNKHES"
FT   gene            536453..537472
FT                   /locus_tag="YpAngola_A0513"
FT   CDS_pept        536453..537472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0513"
FT                   /product="chain length determinant family protein"
FT                   /note="identified by match to protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85835"
FT                   /protein_id="ABX85835.1"
FT                   /translation="MDNELDIRGLCRTLWRGKVWIIGMAIIFAAIALGVSYLVKQQWGA
FT                   TAITDKPTVNNLGGYYSQQQFLRNLDIRLNSGLVSEQPGISDEAYGEFITQLAAYDTRR
FT                   DFWLQSDYYKQRLEGDAKADAALLDELVNNIVFTARDDKKIPNDSIKLTAETASDANKL
FT                   LRGYIDFASQRASSHLNDEIQGAWAARTQSMKAQVKRQEAVAQAVFDREVAAVKQALKV
FT                   AGQQGITRSQTDTPAEQLADSKMFMLGKPMLEARLETLLATGPSFDIDYDQNRAMLATL
FT                   NVGPTLDDKFQTYRYLRTPEDPVTRDSPRRVFLLIMWGAIGALVGAGVVLVRRSSKAL"
FT   gene            537821..538951
FT                   /locus_tag="YpAngola_A0514"
FT   CDS_pept        537821..538951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0514"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="identified by match to protein family HMM PF02350;
FT                   match to protein family HMM TIGR00236"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86387"
FT                   /protein_id="ABX86387.1"
FT                   /translation="MKVLTVFGTRPEAIKMAPLVHALAQDDAFESRVCVTAQHREMLDQ
FT                   VLRLFEIQPDYDLDIMRPGQGLTEITCRILEGLKPVLEEFKPDVILVHGDTTTTLSASL
FT                   AGFYHRIPVGHVEAGLRTGDLYSPWPEEANRQLTGHLAMYHFAPTENSRQNLLREWVPE
FT                   NRIFVTGNTVIDALFWVRDRVMNTPDLRANLAQRYAFLDTNKKMILVTGHRRESFGGGF
FT                   ERICSALAEIARKHPEVQVVYPVHLNPNVSEPVNRILKGIDNIILIDPQDYLPFVYLMN
FT                   HAYLILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDSGTVLLVGTNINKIVDAVTRLL
FT                   TDETAYHQMTRAHNPYGDGYACQRILKALKNHQVTL"
FT   gene            538948..540210
FT                   /locus_tag="YpAngola_A0515"
FT   CDS_pept        538948..540210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0515"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03720; match to protein
FT                   family HMM PF03721; match to protein family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84995"
FT                   /protein_id="ABX84995.1"
FT                   /translation="MSFETISVIGLGYIGLPTAAAFASRKKKVIGVDVNAHAVETINRG
FT                   AIHIVEPDLDKVVKIAVEGGYLQAVTKPQAADAFLIAVPTPFKGDHEPDMIFVESAAKS
FT                   IAPVLKKGDLVILESTSPVGATEQMAQWLAEARPDLSFPQQAGEAADINIAYCPERVLP
FT                   GQVMVELIQNDRVIGGMTPKCSARASALYKIFLEGECVVTNSRTAEMCKLTENSFRDVN
FT                   IAFANELSLICDEQGINVWELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVSQNPQL
FT                   ARLIHTARLVNDGKPLWVVDRVKAAVADCLAASDKRASEVKIACFGLAFKPDIDDLRES
FT                   PAVGVARLIAEWHVGETLVVEPNVEQLPKSLMGLVTLKDTATALQQADVLVMLVDHKQF
FT                   KAIKPEDIKQQWIVDTKGVWR"
FT   gene            540207..541274
FT                   /gene="rfbB"
FT                   /locus_tag="YpAngola_A0516"
FT   CDS_pept        540207..541274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="YpAngola_A0516"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF07993; match to protein family HMM TIGR01181"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85517"
FT                   /protein_id="ABX85517.1"
FT                   /translation="MRRILVTGGAGFIGSAVVRHIIDGTSDSVVVVDKLTYAGNLESLS
FT                   VVAGSERYAFEQVDICDSSELDRVFAQYQPNVVMHLAAESHVDRSIDGPAAFIETNVVG
FT                   TYTLLEAARHYWQQLSVEAKQAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSAS
FT                   KASSDHLVRAWLRTYGLPTLVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGNGAQ
FT                   VRDWLYVEDHARALYQVVTEGVVGETYNIGGHNERKNIEVVETICALLDELVPAKPAGI
FT                   AHYRDLITYVKDRPGHDMRYAIDAGKIERELGWRPQETFESGIRKTVLWYLNNESWWRR
FT                   VQDGSYAGERLGLSD"
FT   gene            541552..542433
FT                   /gene="rfbA"
FT                   /locus_tag="YpAngola_A0517"
FT   CDS_pept        541552..542433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="YpAngola_A0517"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01207"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85566"
FT                   /protein_id="ABX85566.1"
FT                   /translation="MKGIILAGGSGSRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAG
FT                   IRDVLIISTPEDLPSFQRLLGNGDEFGINLSYAAQPSPDGLAQAFIIGEAFIDNEPCCL
FT                   VLGDNIYFGQGFSPKLKAVAARQQGATVFGYQVMDPERFGVVEFDDNFRALSIEEKPSQ
FT                   PKSNWAVTGLYFYDNQVVDFAKQVKPSARGELEITSINQMYLDRGELTVELLGRGFAWL
FT                   DTGTHDSLIEASTFVQTVEKRQGFKIACLEEIAWRNGWLDDDGVKRAATALAKTGYGKY
FT                   LLDLLHARPRQY"
FT   gene            542411..543148
FT                   /gene="wecD"
FT                   /locus_tag="YpAngola_A0518"
FT   CDS_pept        542411..543148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecD"
FT                   /locus_tag="YpAngola_A0518"
FT                   /product="TDP-D-fucosamine acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR02382"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88163"
FT                   /protein_id="ABX88163.1"
FT                   /translation="MPVHASIEPLGWESEFFQRQSAKLIFSDSAPPLNPAELAAFTLVQ
FT                   AKVPTHRLDLIDALSQLDFHLVEGEIDLSLVVGEKEGIGTENATSEPNMGAYSLRVATE
FT                   ADIPQLRRVAASAFALSRFRAPWYDAQDSGRFYALWVEKAVLGTFDHQCLLVLDPTDQP
FT                   VGFVTLRDLQDGSARIGLLAVFPGAQSKGIGLRLMSAAKQWCQHHGLHRLRVATQMSNI
FT                   AALRLYIRSGASIESTAYWLCRG"
FT   gene            543114..544280
FT                   /locus_tag="YpAngola_A0519"
FT   CDS_pept        543114..544280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0519"
FT                   /product="TDP-4-keto-6-deoxy-D-glucose transaminase"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM TIGR02379"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88358"
FT                   /protein_id="ABX88358.1"
FT                   /translation="MRVPRIGYAGDEMIPFNTPPIVGTELGYMQAAMSSGKLCGDGGFT
FT                   RRCQQWMEKRFNCPKVLLTPSCTASLEMAALLLDIKPGDEVIMPSFTFVSTANAFVLRG
FT                   AKMVFVDIRPDTMNIDETKIEAAITDKTRVIVPVHYAGVACEMDTIMALAKKHNLFVVE
FT                   DAAQGVMSTYKGKALGTIGHIGCFSFHETKNYTAGGEGGATLINDPSLIDRAEIIREKG
FT                   TNRSQFFRGQVDKYTWRDIGSSYLMSDLQAAYLWGQLEAAEQINERRLALWHGYYNAFK
FT                   PLADAGRIDLPVIPGNVVQNAHMFYIKLRDIEERSAFISYLKEADIMAVFHYIPLHACP
FT                   AGEAFGRMAGEDRFTSKESERLVRLPIFYNLTDVNQSTVINTVLSFFV"
FT   gene            544282..545538
FT                   /locus_tag="YpAngola_A0520"
FT   CDS_pept        544282..545538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0520"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87117"
FT                   /protein_id="ABX87117.1"
FT                   /translation="MSLAKASIWTACSTLIKIGVGLLVVKLLAVTFGPSGVGQAGNFRQ
FT                   LIIVLGVLSGAGIFNGITKYVAEYHQQPERLRAMLGTSSTIVLGFSTLLALVFLLAAKP
FT                   VSIALFGHADYQNVVRAIAFIQMGIAYGNLFLAILKGYRDAMGNALAIIGGSLIGVVAY
FT                   YICFQIGGYSGALVGLGLVPALVVLPAAAMLYRRRTIPLRYLKPHWDKALASHLGKFTL
FT                   MALITSVTLPVAYVMMRHLLANNYGWDAVGIWQGVSSISDAYLQFITASFTVYLLPTLS
FT                   RLKDKGAISREIFRSLKFVLPAVAAASLTVWLLRDFAIWLLFSHQFTAMRDLFAWQLVG
FT                   DVLKVGSYVFGYLVIAKASLRFYILAEVSQFLLLTGFAYWLIPMNGSLGAAQAYMATYI
FT                   VYFALCSCAFLVYRRHSAP"
FT   gene            545561..546646
FT                   /gene="wecF"
FT                   /locus_tag="YpAngola_A0521"
FT   CDS_pept        545561..546646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecF"
FT                   /locus_tag="YpAngola_A0521"
FT                   /product="4-alpha-L-fucosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF07429"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87981"
FT                   /db_xref="GOA:A9R8I9"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8I9"
FT                   /protein_id="ABX87981.1"
FT                   /translation="MITLTHVLGSDIPHHNLTVLRFFNDVLAKCLPVEQVRHFMVAAKE
FT                   TAPFSSFPQLDINTYSDKKALAEAVIARAQADRSARFFWHGQFNVTLWLALLSGKIKPG
FT                   QVYWHVWGADLYEDAKSLKFRLFYLLRRIAQGRVGHVFATRGDLIHYQQRHPRVPASLL
FT                   YFPTRMDPALTAINIDKPLAGPMTILVGNSGDTTNRHIEALKAIHQQFGPDVRVIIPMG
FT                   YPANNEAYIEQVRQAGLALFSQDNLRILTEQIPFDDYLNILRECDLGYFIFNRQQGIGT
FT                   LCLLTQFGVPFVLSRKNPFWQDLAEQHIPVFFYGDTLDEPMIREAQRQLAGLDKQAIAF
FT                   FNPNYIEGWKQALALAAGEHP"
FT   gene            546643..548007
FT                   /locus_tag="YpAngola_A0522"
FT   CDS_pept        546643..548007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0522"
FT                   /product="ECA biosynthesis protein WzyE"
FT                   /note="identified by match to protein family HMM PF06899"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88110"
FT                   /db_xref="GOA:A9R8J0"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8J0"
FT                   /protein_id="ABX88110.1"
FT                   /translation="MTLGQFGGLFCIYLIAVIFILTLTYQEFRRVKFNFNVLFSMLYLL
FT                   TFYFGFPLTCMLVFQFGVAVVPVEYLLYAMLSATAFYGIYYVTYKTRLRQPRSQPRTPI
FT                   FTMNRVETNLTWVLLALVAVGTVGIFFMQNGFLLFKLDSYSKIFSSDVSGVALKRFFYF
FT                   FIPAMLVVYFLKQDRRAWFFFLASTVAFGILTYVIVGGTRANIIIAFSLFLFIGIVRGW
FT                   ITLWMLAAAGVFGIVGMFWLALKRYGLDVNGAEAFYTFLYLTRDTFSPWENLGLLLQNY
FT                   DKIDFQGLAPIVRDFYVFIPSALWPERPDLVLNTANYFTWDVLDNHSGLAISPTLIGSL
FT                   VVMGGVLFIPLGAIVVGLIIKWFDWLYEQGKAESNRYKAAILQSFCFGAVFNIIVLARE
FT                   GLDSFVSRVVFFCVIFGACLVLAKLLYWLFDTAGLIKRQGIKSNRLSTPNAGNQL"
FT   gene            548016..548756
FT                   /locus_tag="YpAngola_A0523"
FT   CDS_pept        548016..548756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0523"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="identified by match to protein family HMM PF03808;
FT                   match to protein family HMM TIGR00696"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85007"
FT                   /db_xref="GOA:A9R8J1"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8J1"
FT                   /protein_id="ABX85007.1"
FT                   /translation="MEPNTVIPKYNVRGFEIWGFRDMAQVLDHLLGSGPVKTGTLVAMN
FT                   AEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQAELSRVAGADLWEALMQRA
FT                   GQQGTPVFLVGGKPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFARIAASGAAI
FT                   VTVAMGSPKQEIFMRDCRKFYPDALYMGVGGTYDVFTSHVKRAPKIWQNMGLEWLYRLL
FT                   AQPSRIRRQLKLLKFVGYYYSGRL"
FT   gene            549280..550671
FT                   /locus_tag="YpAngola_A0524"
FT   CDS_pept        549280..550671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0524"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86476"
FT                   /protein_id="ABX86476.1"
FT                   /translation="MADNAEKKGLHRGLEARHIELIALGGTIGVGLFMGSASTLKWAGP
FT                   SVLLAYIIAGLFVFFIMRAMGEMLYLEPVAGSFAVYAHKYLSPYFGYLTAWGYWFMWIA
FT                   VGISEITAIGVYVQFWFPEIPQWLPAIAGVAIVALANLAAVKLYGELEFWFAMIKVTTI
FT                   IVMILVGLGVIFFGFGNHGQPIGFDNLTAHGGFFAGGWKGFLFALCIVVASYQGVELVG
FT                   ITAGEARNPQVTLRRAINNILWRILIFYVGAIFVIVTIFPWNGIGTEGSPFVLTFAKIG
FT                   IVAAAGIINFVILTAALSGCNSGMYSGGRMLYALAKNRQLPAGLTKLSASGVPVYCIAI
FT                   TILCLLVGSSLNYIIPNPQQVFVYVYSASVLPGMVPWFVVLVCQLRFRQVHKAALQQHP
FT                   FKSILFPYVNYLTIAFLICVLVGMGINPDTRLSLLVGAIFLALVTGCYFVLGMHKPKAM
FT                   EAERL"
FT   gene            550820..550896
FT                   /locus_tag="YpAngola_A0525"
FT   tRNA            550820..550896
FT                   /locus_tag="YpAngola_A0525"
FT                   /product="tRNA-Arg"
FT   gene            550979..551056
FT                   /locus_tag="YpAngola_A0526"
FT   tRNA            550979..551056
FT                   /locus_tag="YpAngola_A0526"
FT                   /product="tRNA-His"
FT   gene            551071..551159
FT                   /locus_tag="YpAngola_A0527"
FT   tRNA            551071..551159
FT                   /locus_tag="YpAngola_A0527"
FT                   /product="tRNA-Leu"
FT   gene            551233..551311
FT                   /locus_tag="YpAngola_A0528"
FT   tRNA            551233..551311
FT                   /locus_tag="YpAngola_A0528"
FT                   /product="tRNA-Pro"
FT   gene            551438..551692
FT                   /locus_tag="YpAngola_A0529"
FT   CDS_pept        551438..551692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0529"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87558"
FT                   /protein_id="ABX87558.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLV"
FT   gene            551774..552796
FT                   /locus_tag="YpAngola_A0530"
FT   CDS_pept        551774..552796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0530"
FT                   /product="transposase for insertion sequence"
FT                   /note="identified by match to protein family HMM PF00665;
FT                   match to protein family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87144"
FT                   /protein_id="ABX87144.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            552796..553575
FT                   /locus_tag="YpAngola_A0531"
FT   CDS_pept        552796..553575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0531"
FT                   /product="putative transposition helper protein"
FT                   /note="identified by match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87258"
FT                   /protein_id="ABX87258.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            553661..553906
FT                   /locus_tag="YpAngola_A0532"
FT   CDS_pept        553661..553906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0532"
FT                   /product="transposase for the insertion element"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88487"
FT                   /protein_id="ABX88487.1"
FT                   /translation="MSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTVG
FT                   KNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(554099..555319)
FT                   /gene="hemY"
FT                   /locus_tag="YpAngola_A0533"
FT   CDS_pept        complement(554099..555319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="YpAngola_A0533"
FT                   /product="hemY protein"
FT                   /note="identified by match to protein family HMM PF07219;
FT                   match to protein family HMM PF07719; match to protein
FT                   family HMM TIGR00540"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87819"
FT                   /protein_id="ABX87819.1"
FT                   /translation="MLRVLLLFLVLTVGIVLGPMLAGHQGYVLIQTDNYNVTTSVTGLA
FT                   IMLVLLLVAFFIVEWVLRRIFRTGARTRGWFLGRKRTRARNQMKAALIKLAEGDFLQVE
FT                   KLLTRNADHAEQPMVNYLLAAEAAQQRGDEFRTNQYLERAAEVADGDQLPVNITRVRIQ
FT                   LAQGHIHAARHGVDRLLDQAPRHPEVLRLAEQAYLRSGAYRSLLDILPAMSKTQIHTPE
FT                   EVAALEQQAYIGIMNQCMADEGSEGLKRWWKDQSRKVRNEIPLQVALAEHLIECDDHDV
FT                   AQKIILDSLKHQYDERLALLIPRLKAGNPEPLEKSLRQQIKQHGATPLLNSTLGQLMLK
FT                   HGEWEKASEAFKAALAQRPDGYDYAWLADALDKLHRPEDAAQARREGLLLTLRQNGESS
FT                   ALTKLIH"
FT   gene            complement(555322..556446)
FT                   /locus_tag="YpAngola_A0534"
FT   CDS_pept        complement(555322..556446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0534"
FT                   /product="putative uroporphyrinogen III methylase"
FT                   /note="identified by match to protein family HMM PF04375"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85727"
FT                   /protein_id="ABX85727.1"
FT                   /translation="MTEQNTPSAPVEEPTTAVERPQQPEPKGHREKRTGPILGVIAIAL
FT                   VIALGAGLYYHGQQQAQLQSAENIALQEQLVALKQTLLQEKQQLESLLQQQGKALESAE
FT                   NQQASLTRQLNELQEKVATISGSDAKTWLLAQADFLVKMAGRKLWSDQDVTTAVTLLKS
FT                   ADASLADMNDPSLIDVRRAITEDISALSAVSQVDFDGIILKLNQLSNQVDNLRLADNNI
FT                   DDSPMDANSDELSSSLSEWRQNLSKSWHSFMSDFISIRRRDSSAEPLLAPNQDVYLREN
FT                   IRSRLLVAAQAVPRHQDEVYKQSLETISTWVRAYFDVNDPSTKAFLDELENLSQQPISM
FT                   DVPDQLKSQPILEKLMQTRVRNLLAQTPVDAQGE"
FT   gene            complement(556477..557226)
FT                   /gene="hemD"
FT                   /locus_tag="YpAngola_A0535"
FT   CDS_pept        complement(556477..557226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="YpAngola_A0535"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="identified by match to protein family HMM PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88250"
FT                   /protein_id="ABX88250.1"
FT                   /translation="MTILVTRPSPAGEQLVTRLRALGRVAYHAPLIDFSPGRDLPKLPE
FT                   LLQDMQAGDLVFALSQNAVRYANPLLKRNKLSWPVQLSYYAIGRTTALALHTASRLHVT
FT                   FPPMGETSEMLLSLPLLQNLAGKKALLLRGNGGRELLGASLAERGAAVTFCECYQRSPI
FT                   YYDGSEQSAHWQRAGVDILVVTSGEMLQQIYTLVPDYYRSSWLLRCRLIVVSDRLAALA
FT                   TQMGWTEVRVAENADNDALIRALQDLQ"
FT   gene            complement(557223..558164)
FT                   /gene="hemC"
FT                   /locus_tag="YpAngola_A0536"
FT   CDS_pept        complement(557223..558164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="YpAngola_A0536"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="identified by match to protein family HMM PF01379;
FT                   match to protein family HMM PF03900; match to protein
FT                   family HMM TIGR00212"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86127"
FT                   /db_xref="GOA:A9R8K0"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8K0"
FT                   /protein_id="ABX86127.1"
FT                   /translation="MLDKIIRIATRQSPLALWQAHYVQHLLQANHPGLQIELVPMVTRG
FT                   DIILDTPLAKVGGKGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICEREDP
FT                   RDAFVSSHYAHLDDLPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGD
FT                   YQAIILAVAGLKRLGLENRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAPLNHR
FT                   HTELRVCAERAMNIRLEGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAA
FT                   EAEQMGIELADELLSLGAREILAAVYLDNPAR"
FT   gene            complement(558385..558585)
FT                   /locus_tag="YpAngola_A0537"
FT   CDS_pept        complement(558385..558585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0537"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86557"
FT                   /protein_id="ABX86557.1"
FT                   /translation="MLKNTKNILFEEYLANYCWKRDQSNTLPINRKESKAISTIVKPLY
FT                   ARITGSNEFLGVISADHRAAA"
FT   gene            558658..561210
FT                   /gene="cyaA"
FT                   /locus_tag="YpAngola_A0538"
FT   CDS_pept        558658..561210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="YpAngola_A0538"
FT                   /product="adenylate cyclase, class I"
FT                   /EC_number="4.6.1.1"
FT                   /note="identified by match to protein family HMM PF01295"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87395"
FT                   /protein_id="ABX87395.1"
FT                   /translation="MYLYIETLKQRLDAINQLRVDRALAAMGPAFQKVYSLLPILLHCH
FT                   HPQMPGYLDGNVPHGVCLFTPNEIQQDYLADVEARWGEPLAPSAGGELPITGVYSMGST
FT                   SSIGQCHTSDLDIWVCHQAWLDTEERNQLQQKCSLLEKWAASMGVEVSFFLVDENRFRH
FT                   NASGSLGGEDCGSTQHILLLDEFYRSAVRLAGKRILWNMVPVKEEEHYDDYVLSLYAQG
FT                   VLTPNEWLDLGGLSTLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNSQLL
FT                   AMEIKQHLHAGEIVSFGLDAYCMMLDRVTRYLIQINDTTRLNLVRRCFYLKVCEKLSRT
FT                   PASTGWRREVLSQLVSEWGWSNEKLAVLDNRANWKIERVREAHNELLDAMMQSYRNLIR
FT                   FARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEEHLTFIHVPAGR
FT                   ANRPGWYLYNQAPSMDAIVSHQPLEYNRYLNKLVSWAYFNGLLTSKTHLHIKSANLCDT
FT                   VKLQELVTDISHHFPLRLAAPTPKALYSPCEIRHLAIIVNLEHDPTTTFRNQVVHFDFR
FT                   KLDVFSFGEQQQCLVGSIDLLYRNSWNEVRTLHFSGEQAVLEALKTILGKMHQDAAPPE
FT                   SVDVFCYSQHLRGLIRTRIQQLVSECIDLRLSSTRQEPGRFKAVRVSGQTWGLFFERLS
FT                   VSVQKLENAVEFYGAISNNKLHGLSVQVETNQIHLPPVVDGFASEGIIQFFFEGTADEK
FT                   GFNIYILDEANRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQIV
FT                   QLDGRTQVIPFRSNTLSQLCANIAEKEASLPTKQCQLH"
FT   gene            complement(561454..561774)
FT                   /locus_tag="YpAngola_A0539"
FT   CDS_pept        complement(561454..561774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0539"
FT                   /product="protein CyaY"
FT                   /note="identified by match to protein family HMM PF01491"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86988"
FT                   /db_xref="GOA:A9R8K3"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8K3"
FT                   /protein_id="ABX86988.1"
FT                   /translation="MNDSEFHQLADQLMLYIEETLDSFTGDSDIDYETNGGVMTLTFEN
FT                   GSKIVINRQEPLHQVWLATKAGGYHFNYRDGHWYCSRSGEEFLAKLSEAASAQAGENVS
FT                   FG"
FT   gene            561926..562114
FT                   /locus_tag="YpAngola_A0540"
FT   CDS_pept        561926..562114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0540"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88218"
FT                   /protein_id="ABX88218.1"
FT                   /translation="MKKELRWPMAAMMVLALAGCGLKGPLYFPPADKAPVDAAPQVEKN
FT                   QQDLSATPQTPSTAESQ"
FT   gene            562298..563122
FT                   /gene="dapF"
FT                   /locus_tag="YpAngola_A0541"
FT   CDS_pept        562298..563122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="YpAngola_A0541"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="identified by match to protein family HMM PF01678;
FT                   match to protein family HMM TIGR00652"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87783"
FT                   /db_xref="GOA:A9R8K5"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8K5"
FT                   /protein_id="ABX87783.1"
FT                   /translation="MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQM
FT                   LVVEPPYDPELDFHYRIFNADGSEVSQCGNGARCFARFVRLKGLTNKREISVSTQTGRM
FT                   ILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKTYILRAAEHTVLCGVVSMGNPHCVMQ
FT                   VDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYERGAGETQACGSGAC
FT                   AAVAVGVVQDLLNENVHVELPGGSLHIRWQGPGHPLYMTGPATHVYDGFIHL"
FT   gene            563187..563891
FT                   /locus_tag="YpAngola_A0542"
FT   CDS_pept        563187..563891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04340"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85695"
FT                   /protein_id="ABX85695.1"
FT                   /translation="MKNYEEQALAGIELDDDAVMQYLLQNPDFFIRNARLVEQMHIPHP
FT                   VRGSVSLVEWQLGRQRNQIGQLEEEITLLMEQAGLNEVLFSRLLQLQANLAAADSLQDM
FT                   LNRLQRWARDFGLAGANIRLFSDRWQIGAPSDFTHLALSRHAFEPLRIQRLGNRHHYLG
FT                   SLNGPELLLLLPQAKLVGSVALSLLGADGDLGVVIFSSRDAQHYQQGMGTVMLNQLSTL
FT                   LPGLLARWIEPV"
FT   gene            563888..564799
FT                   /gene="xerC"
FT                   /locus_tag="YpAngola_A0543"
FT   CDS_pept        563888..564799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="YpAngola_A0543"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899; match to protein
FT                   family HMM TIGR02224"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85256"
FT                   /protein_id="ABX85256.1"
FT                   /translation="MTEFSASLAPQVEAFLRYLSIERQLSPLTVTSYRRQLSALMEIGE
FT                   QMGLAHWQTLDAAQVRSLVSRSKRAGLHASSLALRLSALRSFLNWLVSQGVLPANPAKG
FT                   VSTPRSGRHLPKNIDVDEVNKLLSIDLNDPLAVRDRAMLEVMYGAGLRLSELVGMNCKH
FT                   VDLASGDVWVMGKGSKERKVPLGKTAVTWLQHWLALRELFEPQDDAIFLANTGKRISAR
FT                   NVQKRFAEWGVKQGVSSHIHPHKLRHSFATHMLESSGDLRAVQELLGHANLTTTQIYTH
FT                   LDFQHLATVYDAAHPRAKRGKS"
FT   gene            564799..565515
FT                   /locus_tag="YpAngola_A0544"
FT   CDS_pept        564799..565515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0544"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86534"
FT                   /protein_id="ABX86534.1"
FT                   /translation="MHFYRPLERISAITFDLDDTLYDNRPVIARTEQQSVAFLQQYHPN
FT                   LALLQPADFQRLRAELLAQDPGIYHDVTQWRWQAIELGLMRHGLSKAEAQAGADAAMAN
FT                   FALWRSRIDVPQATHDTLSALAEHYPLVAITNGNADPKACGLDRYFQFVLRSGPHGRAK
FT                   PFRDMYHKAANHLDIPLKHILHVGDDLTTDVAGSLRCGMQACWINDRQQNLMTARDSRL
FT                   LPHIEISQLASLTALL"
FT   gene            565617..567779
FT                   /gene="uvrD"
FT                   /locus_tag="YpAngola_A0545"
FT   CDS_pept        565617..567779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="YpAngola_A0545"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM TIGR01075"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85223"
FT                   /protein_id="ABX85223.1"
FT                   /translation="MDVSDLLDSLNEKQRDAVAAPRGNLLVLAGAGSGKTRVLVHRIAW
FT                   LLSVENASPYSIISVTFTNKAAAEMRHRIEHLIGTSQGGMWIGTFHGLAHRLLRAHHLD
FT                   ANLPQDFQILDSDDQLRLLKRLVKALNLDEKQWPPRQAMWYINGKKDEGLRPQHIESYG
FT                   NPVEATWLRIYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILNHYRERFTNILVDEF
FT                   QDTNNIQYAWIRLLAGERSNVMIVGDDDQSIYGWRGAQVENIQRFLKDFPGAETIRLEQ
FT                   NYRSTSIILAAANALIANNDGRMGKNLWTDGAEGEPISLYCAFNELDEARFVVNRIKAW
FT                   QDNGGVLNDCAILYRSNAQSRVLEEALLQTATPYRIYGGQRFFDRQEIKDSLAYLRLIS
FT                   NRNDDAAFERVVNTPTRGIGDRTLDVVRQTARDRQLTLWQSTRAMLQEKVLAGRAASAL
FT                   QRFVELIDSLARETADMPLHVQTDRVIRDSGLWSMYEQEKGEKGQARIENLEELVTATR
FT                   QYSYQDEDQDLMPLQAFLSHAALEAGDGQADAYQDAVQLMTLHSAKGLEFPQVFIVGME
FT                   EGMFPSQMSLDEGGRLEEERRLAYVGLTRAMQKLTLCYAESRRLYGKEVNHRPSRFIGE
FT                   LPQECVEEVRLRASVSRPVNHRRMGTPMHENDSGFSLGQRVRHPKFGEGTIVNLEGSGE
FT                   HNRLQVAFPGEGIKWLVAAYARLEPV"
FT   gene            complement(567893..568579)
FT                   /locus_tag="YpAngola_A0546"
FT   CDS_pept        complement(567893..568579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0546"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85409"
FT                   /protein_id="ABX85409.1"
FT                   /translation="MNTQNKQEGFSPSLTTIRARTRRLLIDTAMSMYERGAFPSITEVA
FT                   SAAQLSRATAYRYFPTQSALVSAMVDESLGPILAWQPTQPDARQRIAELLSFAYPRMLQ
FT                   HEGVLRAALHLSLQQWADARNSDSNNNSNDSNNNSNEEKLIRGNRKRLLKLAVEPLEET
FT                   LAPEALQRVIHAFSLIYGSEVFMVLKDIWHLDEAGIQDVTQWMGKAILLQAETDSQLAA
FT                   QDKTHS"
FT   gene            569007..570224
FT                   /locus_tag="YpAngola_A0547"
FT   CDS_pept        569007..570224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06792"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86831"
FT                   /protein_id="ABX86831.1"
FT                   /translation="MPRHIYIATTTDTKGQELAYVSELIQATGLTTVTVDLSTKESQRD
FT                   SGADICAETVAGYHPDGRQAVFCGDRGQAINAMAIAFERFMVSRVDVAALLGMGGSGGT
FT                   ALITPAMQRLPIGIPKLMVSTMASGDVSGYIGASDIAMMYSVTDIAGLNRISRRVLSNA
FT                   AHQVAGAVYFAQEASPVDDKPALGLTMFGVTTPCIQAVSAELSDEYDCLVFHATGSGGK
FT                   AMEKLAESGLLAGVLDLTTTEVCDLLFDGVLACGPERFDAIAHTHIPYVGSCGALDMVN
FT                   FGSPATIPAKYADRLFYKHNAQVTLMRTTEQENIEMARWIGEKLNRCQGEVRFLIPEGG
FT                   FSALDAPGQPFWDEKALTAFIRTLEETVIQTDKRRVVHYPFNINDPLFAQAAIENFKEI
FT                   VNRPSH"
FT   gene            570250..571080
FT                   /locus_tag="YpAngola_A0548"
FT   CDS_pept        570250..571080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87372"
FT                   /protein_id="ABX87372.1"
FT                   /translation="MPKFQRQAILAKFREMIARREPIIGGGAGTGLSAKCEEAGGIDLI
FT                   VIYNSGRYRMAGRGSLAGLLAYGNANDIVVDMAKEVLPVVKNTPVLAGVNGTDPFCQFD
FT                   HFLDHLKALGFSGVQNFPTVGLIDGNFRANLEETGMGYGLEVEMIRLAHQKDLLTTPYV
FT                   FSAEDAIAMTQAGADIIVPHMGLTTGGNIGADTALKLADCVPLINDWAAAAKSVREEVI
FT                   VLCHGGPISTPEDAQYIMDHCPQCDGFYGASSMERLPTEIALTDTTQKFKNITR"
FT   gene            571285..571794
FT                   /locus_tag="YpAngola_A0549"
FT   CDS_pept        571285..571794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0549"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86200"
FT                   /protein_id="ABX86200.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEILPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(571991..572125)
FT                   /locus_tag="YpAngola_A0550"
FT   CDS_pept        complement(571991..572125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0550"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86733"
FT                   /protein_id="ABX86733.1"
FT                   /translation="MQLLPIKLIVRQHGLPHSPKSRSSSAYNTNFISQLLLVISPLAH"
FT   gene            572441..573391
FT                   /gene="corA"
FT                   /locus_tag="YpAngola_A0551"
FT   CDS_pept        572441..573391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="YpAngola_A0551"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="identified by match to protein family HMM PF01544;
FT                   match to protein family HMM TIGR00383"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85090"
FT                   /protein_id="ABX85090.1"
FT                   /translation="MLSAFKLHNNRLSRLELDESDDLASSLWVDLVEPEEGERERVQTE
FT                   LGQSLATRPELDDIEASARFFEDEDGLHIHSFFYYEDADDHAGNSTVAFTIRDGRLYTL
FT                   RERELPAFRLYRMRARNQTLVDGNAYELLLDLFETKIEQLADEIENIYSDLEALSRVIM
FT                   EGQQGDEYDAALSTLAEQEDIGWKVRLCLMDTQRALNFLVRKARLPSSQLEQAREVLRD
FT                   IESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFE
FT                   FMPELRWSFGYPGAIALMIIAGLAPYLYFKRKNWL"
FT   gene            complement(573489..574379)
FT                   /gene="rarD"
FT                   /locus_tag="YpAngola_A0552"
FT   CDS_pept        complement(573489..574379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="YpAngola_A0552"
FT                   /product="RarD protein"
FT                   /note="identified by match to protein family HMM PF00892;
FT                   match to protein family HMM TIGR00688"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85616"
FT                   /protein_id="ABX85616.1"
FT                   /translation="MDKQQTRQGIFFALAAYFIWGLAPAYFKLIQQVPADEILTHRVIW
FT                   SFFFMLILLTVSRHWPQVRDACKNRKRLLLLAVTAVLIASNWLLFIWAVNHNHMLEASL
FT                   GYFINPLVNVLFGMLFLGERFRRMQWVAVALAFAGVLIQLWQFGSLPVIGLGLAITFAL
FT                   YGLLRKKLGVDAQTGMLIETMWLLPVAAVYLFFIADSPTSHLSANAWSLNLLLAAAGVI
FT                   TTIPLLFFTAAATRLRLSTLGFFQYLGPTLMFILAVTFYGETIGNDKMVTFIFIWAALL
FT                   LFTLDALYTQRKLRR"
FT   gene            complement(574466..574936)
FT                   /locus_tag="YpAngola_A0553"
FT   CDS_pept        complement(574466..574936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0553"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85552"
FT                   /protein_id="ABX85552.1"
FT                   /translation="MSVTPLTLEDARRMIGETFVYHMPFNRELGLKLVRFEQDYAEITF
FT                   DNDDKLVGNIAQKILHGGVIAAVLDVAAGLVCVGNSLIRHEPLIQEQLQIKLAKMGTID
FT                   LRVDYLRPGRGEHFIARSSILRSGNKVAVARVELHNEKQIHIASATATYLVG"
FT   gene            575158..576036
FT                   /locus_tag="YpAngola_A0554"
FT   CDS_pept        575158..576036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0554"
FT                   /product="phospholipase A1"
FT                   /note="identified by match to protein family HMM PF02253"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87747"
FT                   /protein_id="ABX87747.1"
FT                   /translation="MARFWQILIALLLVPTLAQAEEATIEKIHDAPAVRGSIIAAILQD
FT                   HDNPFLLYPYETNYLLYTYTNEINKQAISSYDWAEQANKDEVKFQLSLAFPIWRGIAGD
FT                   NSLLGASYTQRSWWQASNSEESSPFRETNYEPQLFLAWSTDYELAGWTFREVEFGFNHQ
FT                   SNGKADPTSRSWNRVYTRVMAQRGNLEIDLKPWYRIPESDSKDDNPDITKYMGYYRLKV
FT                   GYALGDSVFSLDGRYNWNTGYGGAEMGWSYPITKHVRFYTQVFSGYGESMIDYNFRQTR
FT                   VGVGIMLNDVL"
FT   gene            576114..577946
FT                   /gene="recQ"
FT                   /locus_tag="YpAngola_A0555"
FT   CDS_pept        576114..577946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="YpAngola_A0555"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF00570; match to protein family HMM TIGR00614;
FT                   match to protein family HMM TIGR01389"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85620"
FT                   /protein_id="ABX85620.1"
FT                   /translation="MSTAAVINRELLAVQVLRDTFGYQQFRPGQQEIINATLSGQDCLV
FT                   VMPTGGGKSLCYQIPALVTDGLTLVVSPLISLMKDQVDQLLAYGVGAGCLNSSQTREQQ
FT                   LAVMDGCRSGQIKLLYIAPERLVMESFLDQLYQWRPALLAVDEAHCISQWGHDFRPEYR
FT                   ALGQLKQRFPDLPVIALTATADEATRGDIVRLLNLDQPLIQISSFDRPNIRYTLVEKFK
FT                   PLDQLWRFVQDQRGKSGIIYCNSRAKVEDTTARLQSRGLSVAAYHAGLDNERRAQVQEA
FT                   FQRDDLQVVVATVAFGMGINKPNVRFVVHFDIPRTIESYYQETGRAGRDGLPAEAVLLY
FT                   DPADMAWLRRCLEEKPAGAQQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGKQQPCGN
FT                   CDICLDPPKRYDGLADAQKALSCVYRVGQRFGLGYIVEVLRGANNQRIREMGHDKLSVY
FT                   GIGREQTHEHWVSVLRQLIHLGLLSQNIAQFSALQLTEAARPVLRAELPLQLAVPRIQS
FT                   LKVRSSANQKSYGGNYDRKLFAKLRKLRKSIADEGNIPPYVVFNDATLLEMAEQMPITA
FT                   SELLSVNGVGQRKLERFGAPFMALIRDHVDNNDD"
FT   gene            578053..578673
FT                   /gene="rhtC"
FT                   /locus_tag="YpAngola_A0556"
FT   CDS_pept        578053..578673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtC"
FT                   /locus_tag="YpAngola_A0556"
FT                   /product="threonine efflux protein RhtC"
FT                   /note="identified by match to protein family HMM PF01810;
FT                   match to protein family HMM TIGR00949"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86072"
FT                   /protein_id="ABX86072.1"
FT                   /translation="MLMLFLTVAFIHLVALISPGPDFFFVSQTAASRSRGEAMMGVLGI
FT                   SLGIVIWAGVALMGLNLILQKMAWLHQIIMVGGGMYLCWMGWQLLKSARAKHDVAEEEV
FT                   QVVLPARGRTFIRGLLTNLSNPKAVIYFGSVFSWFVGDDVGAGARWGLFILIVGETFLW
FT                   FTVVACVFALPTMRRGYQRLSKWIDGLAGVLFAGFGIQLILSR"
FT   gene            complement(578724..579344)
FT                   /gene="rhtB"
FT                   /locus_tag="YpAngola_A0557"
FT   CDS_pept        complement(578724..579344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtB"
FT                   /locus_tag="YpAngola_A0557"
FT                   /product="homoserine Rht transporter RhtB"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86705"
FT                   /protein_id="ABX86705.1"
FT                   /translation="MTLDWWLTYLLTTLILSLSPGSGAINTMSTAISHGTRGVVASIGG
FT                   LQLGLAVHIVLVGVGLGALVSQSLLAFEILKWLGAAYLIWLGIQQWRAAGSLDLHALAN
FT                   SMPRRKLFKRAVFVNLTNPKSIVFLAALFPQFVLPQQPQVAQYLILGSTSVIVDIIVMI
FT                   GYATLATRIARWIKSPQQMKLLNRIFGGLFMLIGALLATARKV"
FT   gene            579540..580553
FT                   /gene="pldB"
FT                   /locus_tag="YpAngola_A0558"
FT   CDS_pept        579540..580553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pldB"
FT                   /locus_tag="YpAngola_A0558"
FT                   /product="lysophospholipase L2"
FT                   /EC_number="3.1.1.5"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86268"
FT                   /protein_id="ABX86268.1"
FT                   /translation="MLLGHHMNNWLTREEQFAAFINGPLLDFWQQRDEQTFMGVDNIPI
FT                   RYVRFRAPHHTQVVVVVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRMLDDH
FT                   NRGHVIKFDDYIEDFAQLVQIEITGSHYQQRFALAHSMGGAILTRFLAREPDVFNAVAL
FT                   CAPMFGIHLPLPGWLARRIVNWAEGHQKLRDYYAIGTGHWRPLPYLVNMLTHSRERYRR
FT                   YLRQYSDTPEIRVGGPTYHWLRESLLVGEQIIAEAEKITTPVLLLQASEDRVVHNPAHD
FT                   AFSQAMTLAGHPCEGGRPQVIQGARHEILFERDTLRAEALSAILRFFAQHQSSVGH"
FT   gene            580588..581397
FT                   /locus_tag="YpAngola_A0559"
FT   CDS_pept        580588..581397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0559"
FT                   /product="hydrolase, Cof family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85622"
FT                   /protein_id="ABX85622.1"
FT                   /translation="MYHVVASDLDGTLLSPNHTLTPYTKETLKLLTQRDVHFVFATGRH
FT                   HIDVAQIRDNLEISAFMITSNGARVHNTEGELIFSHNLDADIARDLYNLEHHNPDILTN
FT                   VYLGDEWFMNRECPEQEEFFRESVFNYQVFEPALLPTDGVCKVYFTCEDHDKLLILEEA
FT                   INARWGDRVNVSFSFPTCLEVMGGGVSKGHALEQVAKIIGYSLKDCIAFGDGMNDVEML
FT                   SMSGKGCIMRDAHQRLKDVLPNLEVIGSNADDAVPHYLRKMFLGKEE"
FT   gene            581416..581544
FT                   /locus_tag="YpAngola_A0560"
FT   CDS_pept        581416..581544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0560"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85107"
FT                   /protein_id="ABX85107.1"
FT                   /translation="MMMLWSRVAFGHPSSLALQGGLAVRTHLSKSSFKIMYSMNQF"
FT   gene            581674..582873
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0561"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of sequencing error"
FT   gene            complement(582947..583216)
FT                   /locus_tag="YpAngola_A0562"
FT   CDS_pept        complement(582947..583216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0562"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   (Glycerophosphodiester phosphodiesterase)"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87939"
FT                   /protein_id="ABX87939.1"
FT                   /translation="MDRLGPDYHMLVVKTSTAKDIKLTDLVKEAHASNMMVHPFTIRAD
FT                   RLPKYATDINQLFDIIYNQAQVDGVFTDFPDQGIQFLQKQQQHK"
FT   gene            complement(583240..584448)
FT                   /locus_tag="YpAngola_A0563"
FT   CDS_pept        complement(583240..584448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0563"
FT                   /product="IS285, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87291"
FT                   /protein_id="ABX87291.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            complement(584510..585385)
FT                   /locus_tag="YpAngola_A0564"
FT   CDS_pept        complement(584510..585385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0564"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   (Glycerophosphodiester phosphodiesterase)"
FT                   /EC_number="3.1.4.46"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86872"
FT                   /protein_id="ABX86872.1"
FT                   /translation="MQTHVKTLLASLILAASMAAPAYAAKPASADKSASAIDKVVIAHR
FT                   GASGYLPEHSLPAKAMAYAQGADYLEQDLVMTKDNELVVLHDHYLDRVTDVAERFPDRA
FT                   RKDGRYYAIDFTLPEIKSLKFTEGFDIDKNGKKVQSYPNRFPMGKSDFRVHTFQEEIEF
FT                   IQGLNHSTGKNTGIYPEIKAPWFHHQEGKDISTKVLEVLKEYGYTNKDDKVYLQSFDVN
FT                   ELKRIKNELEPKMGMDLKLIQLIAYTDWNETYEQLPDGKWVNYNYDWMFKPGAMKEVAH
FT                   YADGIGPERL"
FT   gene            586010..587665
FT                   /pseudo
FT                   /gene="glpA"
FT                   /locus_tag="YpAngola_A0565"
FT                   /note="anaerobic glycerol-3-phosphate dehydrogenase subunit
FT                   A, authentic point mutation; this gene contains a premature
FT                   stop which is not the result of sequencing error;
FT                   identified by similarity to SP:P0A9C0; match to protein
FT                   family HMM PF01266"
FT   gene            587655..588929
FT                   /gene="glpB"
FT                   /locus_tag="YpAngola_A0566"
FT   CDS_pept        587655..588929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpB"
FT                   /locus_tag="YpAngola_A0566"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase, B
FT                   subunit"
FT                   /EC_number="1.1.5.3"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM TIGR03378"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86390"
FT                   /protein_id="ABX86390.1"
FT                   /translation="MKFDVIIIGGGLAGLACGIRLAEQGKYCAIVSSGQNALHFSSGSL
FT                   DLLAKLPDGQAVSQPLSALSALAELAPEHPYSKMRNITQLDELVQEAEALLRRCGLDIV
FT                   GSSAENHLRLTPLGSCRPTWLSLADIPVAPLNGPLPWQRVAVIGIEGFLDFQPQMVASA
FT                   LQDQGIDATADYLHLPALDRLRDNPSEFRAVNIARILDLPENRQPLADELSRLSSTAEM
FT                   ILLPACIGLDKSAPLDALRAVVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLGGLVMPG
FT                   DAVLRAELVDNRITGLYSRNHGDIPLRAAQMVLASGSFFSNGLVATFDKIYEPILDLDI
FT                   LSLPHRADWSHSNLFAPQPYLQFGVNTDNHLRPLRGGVALENLHAIGAVLGGYDPLQQG
FT                   CGAGVSLTSAVFVAEQIISEMAVTL"
FT   gene            588926..590221
FT                   /gene="glpC"
FT                   /locus_tag="YpAngola_A0567"
FT   CDS_pept        588926..590221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpC"
FT                   /locus_tag="YpAngola_A0567"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase, C
FT                   subunit"
FT                   /EC_number="1.1.5.3"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02754; match to protein
FT                   family HMM TIGR03379"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84915"
FT                   /protein_id="ABX84915.1"
FT                   /translation="MTGLPKHDASPEQDGMMVGDSRLTRDNSFESCIKCTVCTTYCPVA
FT                   KVNPLYPGPKQAGPDGERLRLKDPALYDDALKYCTNCKRCEVACPSDVKIGDIIQRAKA
FT                   SHSTNKPKLRDAILSHTDIMGTLSTPFAPVINAVTGLKPVRVLLDKALKIDHRRELPKY
FT                   SFGTFRRWYRKQAEKQQQYTEQVAFFHGCFVNYNHPQLGKDLVSVFNAMNIGVQLLKRE
FT                   KCCGVPLIVNGFIEQAKKQARVNLESLTDTVIGRDIPVVATSSSCTFTLRDEYPHLLDV
FT                   DTTPVRDKVELATRYLYRLLDQGRELPLKPLFSLNPLLASQEAPLRIAYHTPCHMEKMG
FT                   WTAYTLALLQRIPGVELVVLDSQCCGIAGTYGFKSENYATSQGIGASLFQQIEDSGVDL
FT                   VITDCETCKWQIEMSTSKKCEHPITLLARALA"
FT   gene            complement(590383..590910)
FT                   /locus_tag="YpAngola_A0568"
FT   CDS_pept        complement(590383..590910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0568"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87659"
FT                   /protein_id="ABX87659.1"
FT                   /translation="MYKKIVRFLAVGLLVAGLSACDNSSDNNVGQTVSLLDGKVTFNLP
FT                   ADLSDQSGKMGNQANNMHVYANNTGDKAVIVILGEGTNEKLEVLTNRLAEQQRARDANL
FT                   QVVTNKTININGQPFQQLDSIITSSGQKAYSSIVMGTVGNQLMTLQITLPAENQQQAQT
FT                   EAESIISTLKLK"
FT   gene            complement(591040..591708)
FT                   /locus_tag="YpAngola_A0569"
FT   CDS_pept        complement(591040..591708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0569"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02592;
FT                   match to protein family HMM TIGR00697"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86214"
FT                   /protein_id="ABX86214.1"
FT                   /translation="MFSFTVQQRMTALVWLSLFHIVIITSSNYLVQLPIAIFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPLARRIILSVMVPALLISYLISALFYQGSWQGFPALTSF
FT                   NLVVARIAVASFMAYVLGQILDVQVFNRLRQRNAWWVAPTAAMFFGNISDTMAFFFIAF
FT                   YRSSDPFMAAHWVEIALVDYSFKLLICMLFFLPAYGVMLNVLLKYFARQTGQPVLATER
FT                   "
FT   gene            591851..592246
FT                   /gene="tusA"
FT                   /locus_tag="YpAngola_A0570"
FT   CDS_pept        591851..592246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tusA"
FT                   /locus_tag="YpAngola_A0570"
FT                   /product="sulfurtransferase TusA"
FT                   /EC_number="2.8.1.-"
FT                   /note="identified by match to protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88542"
FT                   /protein_id="ABX88542.1"
FT                   /translation="MVKLFAFVKPSDFVKLAAFVSLLTFYLSIKPLTDELLNRLLTNKR
FT                   TAMTDIFANPDKTLDALGLRCPEPVMMVRKTVRHMEEGQTLLIIADDPATTRDIPGFCR
FT                   FMDHQLLAQDTEQTPYRYLVRKGITAG"
FT   gene            complement(592330..594678)
FT                   /gene="cadA"
FT                   /locus_tag="YpAngola_A0571"
FT   CDS_pept        complement(592330..594678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="YpAngola_A0571"
FT                   /product="cadmium-translocating P-type ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01512; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87072"
FT                   /protein_id="ABX87072.1"
FT                   /translation="MHSHSEHQKSVETNSNCGCGHTHDKHQTGCSNLATAANSDAISHD
FT                   SVSEHSHHDGESCSHTHADEADEESDRLDTTIVSGTQRFSWQVKGMDCPSCARKIENAI
FT                   SGLDGVEKVKVLFTTEKLVVDARADVRSLVQKAVIATGFSLVNTQTTAGQKNVATESRL
FT                   REYLPLALLSTLMLISWGLSFFNTELSQTAFTITTIVGLIPFVIKSWKLIRSGTPFAIE
FT                   TLMSVAAIGAVFIGATAEAAMVLLLFMVGELLESYAVNRARRGVTALMALVPEEALLLK
FT                   DGKRTLVPVADLRPGDIIEIPPGGRLPADAELQASFASFDESALTGESIPVERQQGEKV
FT                   AAGCLSVDRAVEMCVVSEPGNNAIDRILQLIELAEERRAPIERFIDRFSRIYTPIIILF
FT                   SILVILVPPLVFAAPWEPWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKG
FT                   GAALEQLGRSQIIAFDKTGTLTEGKPKVTDVLPISGISETRLLTLAAAVEAGSHHPLAI
FT                   AIIQCTQQNQRAQQNTPMLPLAEERRALAGVGIEGVVDGLMVRVSAPSKLSPALLTDEW
FT                   QAQIDQLESSGKTAVVVLEDEKFIGLLALRDTLRTDAKQAIDALKKLGIQGVMLTGDNP
FT                   RAAAAIAGELGIDYRAGLLPADKVQAVMALNALQPTVMVGDGINDAPAMKASSIGVAMG
FT                   SGTDVALETADTALTHNRLTGLAEIILLSRAANANIRQNITIALGLKAIFLVTTLLGLT
FT                   GLWLAVLADSGATALVTANALRLLRKRDV"
FT   gene            complement(595092..595718)
FT                   /locus_tag="YpAngola_A0572"
FT   CDS_pept        complement(595092..595718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0572"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF07947"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85055"
FT                   /protein_id="ABX85055.1"
FT                   /translation="MSWPFLAVFFSGWLFVDATYRGPRWQRWVFKPVTLLLLLLLAWQA
FT                   PALGPAGYLIVLGLLATLLADALLLLPSERLLYALGAFFLSHLLYTISFASQMTLTLFW
FT                   PLPLVLIVVGALLLAALWTQLQDMRWPVVAFIGMTLLMVWMAGEQYFARSTDLGFSLLA
FT                   GSVLLLLSHAVWLLNRYRFSFRASDAIAAGCYFIGHFLIVRSLYL"
FT   gene            596008..596328
FT                   /locus_tag="YpAngola_A0573"
FT   CDS_pept        596008..596328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08850"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85491"
FT                   /protein_id="ABX85491.1"
FT                   /translation="MANEQLLYRIQFINNGKNYQLYVREIGSSSLFGFIEIADFVFDSQ
FT                   STLLVDPSTEKLKTEFSGVNRSYIPLHAVIRIDSVTEKGSARISELGNNVMNFPYLPGN
FT                   KP"
FT   gene            596540..596959
FT                   /locus_tag="YpAngola_A0574"
FT   CDS_pept        596540..596959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85066"
FT                   /protein_id="ABX85066.1"
FT                   /translation="MSKLPLLFIAVVVLIVVLATRQYWQKKQQDAENDRAPVRSVQVEV
FT                   VDKREVLAPNRRSRQREEIVAEEKRYEVYFRPLSSGIEIKNSLGLSGGNEIKSGSEIKM
FT                   VLPQQEYNRIEQGAQGILRLQGTRYIGFIPDAPHP"
FT   gene            complement(597152..597424)
FT                   /locus_tag="YpAngola_A0575"
FT   CDS_pept        complement(597152..597424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06611"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84936"
FT                   /protein_id="ABX84936.1"
FT                   /translation="MWINLGRLLMLGVWFFILLNLFQPYPKPLRYFIHVAMIFMVLMHG
FT                   LQLVLLKSTQPKDQPISGLQQFKIFVFGVFELLAWQKKQPQLPKK"
FT   gene            complement(597414..598076)
FT                   /locus_tag="YpAngola_A0576"
FT   CDS_pept        complement(597414..598076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0576"
FT                   /product="putative methyltransferase"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87345"
FT                   /protein_id="ABX87345.1"
FT                   /translation="MAKQPIAKRSIVKKASPQSAGQIRIIGGKWRGRKLPVPDSPGLRP
FT                   TTDRVRETLFNWLAPMIQGARCLDCFAGSGALGLEALSRYASETTLLEADRQVAKQLSD
FT                   NLMLLKAENGQVVNTNSLQWLAQPGQPFNLVFLDPPFRKGLLAETINLLEQFNWLAADA
FT                   WIYVEAEAESAVADVPANWLLHREKIAGQVAYRLFIRQQTDLPACASVAEQEQHHVD"
FT   gene            598358..600019
FT                   /locus_tag="YpAngola_A0577"
FT   CDS_pept        598358..600019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0577"
FT                   /product="cell division protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86793"
FT                   /protein_id="ABX86793.1"
FT                   /translation="MAKEKKRGFFSWLGLGRQSEEPAAEPLATEKEGVTEQEDVIEQTG
FT                   VIEPTDVIEQTVEHVISEKTTEAPAENAFIEVELREQVAAVIPTEPNNAIMSEGVPDTL
FT                   PERAVAESVVAELVETGDNAAIVHDEIIEPITQVTEAGGELSLVKPGIEGDTTEQGGPT
FT                   DNLPKRSLTEDNLIIDVPTPQAVVEESRVDAVEQPTETSEVEEVEEVEEVEEVEEVEEV
FT                   EEVEEVEEVEEKIIPVAAQEQERPTKEGFFARLKRSLIKTKQNLGSGFMGLFSGKKIDD
FT                   DLFEELEEQLLIADVGVETTRKIITSLTEHTSRKQLKDADALYGKLKEEMSEILSKVDK
FT                   PLDVSGKSPYVILMVGVNGVGKTTTIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVW
FT                   GERNKIAVVAQHTGADSASVIFDAIQAAKARGIDVLLADTAGRLQNKAHLMEELKKIVR
FT                   VMKKLDGDAPHEVMLTLDASTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIA
FT                   DQFEIPIRYIGVGEGIEDLRPFKADEFIEALFARED"
FT   gene            600025..600693
FT                   /gene="ftsE"
FT                   /locus_tag="YpAngola_A0578"
FT   CDS_pept        600025..600693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="YpAngola_A0578"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00960; match to protein
FT                   family HMM TIGR02673"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88516"
FT                   /protein_id="ABX88516.1"
FT                   /translation="MIRFEQVSKAYLGGRQALQGVDFHLRPAEMAFLTGHSGAGKSTLL
FT                   KLICGIERPSAGHIWFGGHDISRLKNREVPFLRRQIGMIFQDHHLLLDRTVYDNVAMPL
FT                   IIAGASSEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADE
FT                   PTGNLDDALSEGILRLFEEFNRVGVTVLMATHDTSLIARRRYPILTLSQGRMSGAHHGE
FT                   "
FT   gene            600683..601636
FT                   /locus_tag="YpAngola_A0579"
FT   CDS_pept        600683..601636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0579"
FT                   /product="putative protein insertion permease FtsX"
FT                   /note="identified by match to protein family HMM PF02687;
FT                   match to protein family HMM TIGR00439"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87944"
FT                   /protein_id="ABX87944.1"
FT                   /translation="MANNARKAKTKALKGGWREQWRYSWVNAIADMMRQPMATLLTVMV
FT                   ISISLTLPSVCYIVWKNVSQAAEQWYPTPQLTVYLDKALDDNAAENVVVTLKAEAGVEK
FT                   VNYLSREEAMGEFRNWSGFGGALDMLEENPLPAVAIITPKLNFQSAETLNTLRDRISQV
FT                   EGVAEVRMDDSWFARLAALTGLVGQVAAMVGVLMVVAVFLVIGNSVRLSIFSRRDTINV
FT                   MKLLGATDGFILRPFLNGGAMLGFGGAVLSLILSEALVWQLGSVVKQVATVFGTQFTLH
FT                   GLSWDESLLLVLISAMIGWIAAWLATVQHLRRFTPQ"
FT   gene            601947..602804
FT                   /gene="rpoH"
FT                   /locus_tag="YpAngola_A0580"
FT   CDS_pept        601947..602804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="YpAngola_A0580"
FT                   /product="alternative sigma factor RpoH"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02392; match to protein family HMM
FT                   TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85724"
FT                   /protein_id="ABX85724.1"
FT                   /translation="MTKEMQTLALVPQGSLEAYIRAANAYPMLTAEEERELAERLHYQG
FT                   DLGAAKQLILSHLRFVAHVARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSF
FT                   AVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVELVAKELGV
FT                   TSKDVREMESRMSAQDMTFDPSPDDEARDGQFMAPVLYLQDKTSDFADGIEEDNWDSHA
FT                   ADKLSYALEGLDERSQHIIRARWLDDENKSTLQELADQYGVSAERVRQLEKNAMKKLRM
FT                   AIEA"
FT   gene            602967..603476
FT                   /locus_tag="YpAngola_A0581"
FT   CDS_pept        602967..603476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0581"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85189"
FT                   /protein_id="ABX85189.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            603937..604410
FT                   /gene="bfr"
FT                   /locus_tag="YpAngola_A0582"
FT   CDS_pept        603937..604410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="YpAngola_A0582"
FT                   /product="bacterioferritin"
FT                   /note="identified by match to protein family HMM PF00210;
FT                   match to protein family HMM TIGR00754"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84886"
FT                   /protein_id="ABX84886.1"
FT                   /translation="MKGDKKIIAHLNKLLGNELVAINQYFLHARMFKNWGLMRLNDKEY
FT                   HESIDEMKHADKYIERILFLEGIPNLQELGKLNIGEDVEEMLKSDLALELSGATDLREG
FT                   IAYADSIHDYVSRDLLKEILVDEEEHIDWLETELSLIDRLGIQSYSQAQLAKD"
FT   gene            604824..605135
FT                   /gene="rpsJ"
FT                   /locus_tag="YpAngola_A0583"
FT   CDS_pept        604824..605135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="YpAngola_A0583"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86239"
FT                   /db_xref="GOA:A9R8Z5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8Z5"
FT                   /protein_id="ABX86239.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            605168..605797
FT                   /gene="rplC"
FT                   /locus_tag="YpAngola_A0584"
FT   CDS_pept        605168..605797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="YpAngola_A0584"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86028"
FT                   /db_xref="GOA:A9R8Z6"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8Z6"
FT                   /protein_id="ABX86028.1"
FT                   /translation="MIGLVGKKVGMTRIFTEDGVSIPVTVIEIEANRVTQVKSLENDGY
FT                   RAVQVTTGAKKANRVTKPEAGHFAKAGVEAGRGLWEFRLPEGQEFTAGQEISVEIFADV
FT                   KKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAG
FT                   HMGDERVTVQSLDVVRVDAERNLLLVKGAVPGATGGNLIVKPAVKA"
FT   gene            605814..606419
FT                   /gene="rplD"
FT                   /locus_tag="YpAngola_A0585"
FT   CDS_pept        605814..606419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="YpAngola_A0585"
FT                   /product="ribosomal protein L4"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85212"
FT                   /db_xref="GOA:A9R8Z7"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8Z7"
FT                   /protein_id="ABX85212.1"
FT                   /translation="MELVMKDAPGALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARAGSVKSPIWRSGGVTFAAKPQDHSQKVNKKMYRGA
FT                   LKSILSELVRQDRLIIVEKFSVEAPKTKLLAQKLKDMALEDVLIVTGELDENLFLAARN
FT                   LYKVDVRDVAGIDPVSLIAFDKVVMTADAVKQVEEMLA"
FT   gene            606416..606718
FT                   /gene="rplW"
FT                   /locus_tag="YpAngola_A0586"
FT   CDS_pept        606416..606718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="YpAngola_A0586"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88384"
FT                   /protein_id="ABX88384.1"
FT                   /translation="MIREERLLKVLRSPHVSEKASAAMEKNNTIVLKVAKDATKAEIKA
FT                   AVQKLFEVEVEDVNTLLVKGKSKRHGQRVGRRSDWKKAYVTLKEGQNLDFIGGAE"
FT   gene            606735..607559
FT                   /gene="rplB"
FT                   /locus_tag="YpAngola_A0587"
FT   CDS_pept        606735..607559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="YpAngola_A0587"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87738"
FT                   /db_xref="GOA:A9R8Z9"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R8Z9"
FT                   /protein_id="ABX87738.1"
FT                   /translation="MAIVKCKPTSPGRRHVVKVVNPELHKGKPYAPLLEKLSKSGGRNN
FT                   NGRITTRHIGGGHKQHYRLVDFKRNKDGIPAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLKAGDQIQSGVDAAIKAGNTLPMRNIPVGSTVHNVEMKPGKGGQLARSAGAYVQ
FT                   IVARDGSYVTLRLRSGEMRKVQADCRATLGEVGNAEHMLRVLGKAGASRWRGIRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRSKK"
FT   gene            607574..607852
FT                   /gene="rpsS"
FT                   /locus_tag="YpAngola_A0588"
FT   CDS_pept        607574..607852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="YpAngola_A0588"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86955"
FT                   /db_xref="GOA:A9R900"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R900"
FT                   /protein_id="ABX86955.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPIRTWSRRSTVFPNMI
FT                   GLTIAVHNGRQHVPVFVSDEMVGHKLGEFAPTRTYRGHAADKKAKKR"
FT   gene            607867..608199
FT                   /gene="rplV"
FT                   /locus_tag="YpAngola_A0589"
FT   CDS_pept        607867..608199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="YpAngola_A0589"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86285"
FT                   /db_xref="GOA:A9R901"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R901"
FT                   /protein_id="ABX86285.1"
FT                   /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAG
FT                   LVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   gene            608217..608915
FT                   /gene="rpsC"
FT                   /locus_tag="YpAngola_A0590"
FT   CDS_pept        608217..608915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="YpAngola_A0590"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86575"
FT                   /db_xref="GOA:A9R902"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R902"
FT                   /protein_id="ABX86575.1"
FT                   /translation="MGQKVHPNGIRLGIVKAWNSTWYANTKEFADNLDSDFKVRQFLTK
FT                   ELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIA
FT                   EVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQ
FT                   PKKQQRKGRK"
FT   gene            608928..609338
FT                   /gene="rplP"
FT                   /locus_tag="YpAngola_A0591"
FT   CDS_pept        608928..609338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="YpAngola_A0591"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86155"
FT                   /db_xref="GOA:A9R903"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R903"
FT                   /protein_id="ABX86155.1"
FT                   /translation="MLQPKRTKFRKMHKGRNRGLAQGTDVSFGEFGLKACGRCRLTARQ
FT                   IEAARRAMTRAIKRQGKVWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLFE
FT                   MAGVPEETAREAFKLAAAKLPVGTTFVTKTVM"
FT   gene            609338..609529
FT                   /gene="rpmC"
FT                   /locus_tag="YpAngola_A0592"
FT   CDS_pept        609338..609529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="YpAngola_A0592"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85286"
FT                   /db_xref="GOA:A9R904"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R904"
FT                   /protein_id="ABX85286.1"
FT                   /translation="MKAQELREKSVEELNTELLNLLREQFNLRMQAASGQLQQTHLLKQ
FT                   VRRNVARVKTLLTEKAGA"
FT   gene            609964..610335
FT                   /gene="rplN"
FT                   /locus_tag="YpAngola_A0593"
FT   CDS_pept        609964..610335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="YpAngola_A0593"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88523"
FT                   /db_xref="GOA:A9R905"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R905"
FT                   /protein_id="ABX88523.1"
FT                   /translation="MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDGNACVILNNNSEQPIGTRIFGPVT
FT                   RELRNEKFMKIISLAPEVL"
FT   gene            610346..610660
FT                   /gene="rplX"
FT                   /locus_tag="YpAngola_A0594"
FT   CDS_pept        610346..610660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="YpAngola_A0594"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87820"
FT                   /db_xref="GOA:A9R906"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R906"
FT                   /protein_id="ABX87820.1"
FT                   /translation="MAAKIRRDDEVIVLTGKDKGKRGKVKNVLSSGKVIVEGINLVKKH
FT                   QKPVPALNQPGGIVEKEAAIQVSNLALFNATTGKADRVGFRFEDGKKVRFFKSTSETIK
FT                   "
FT   gene            610675..611214
FT                   /gene="rplE"
FT                   /locus_tag="YpAngola_A0595"
FT   CDS_pept        610675..611214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="YpAngola_A0595"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86822"
FT                   /db_xref="GOA:A9R907"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R907"
FT                   /protein_id="ABX86822.1"
FT                   /translation="MAKLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEAIA
FT                   DKKLLDNAAADLAAISGQKPFITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLI
FT                   TIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSD
FT                   DEGRALLAAFKFPFRK"
FT   gene            611228..611533
FT                   /gene="rpsN"
FT                   /locus_tag="YpAngola_A0596"
FT   CDS_pept        611228..611533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="YpAngola_A0596"
FT                   /product="ribosomal protein S14"
FT                   /note="identified by match to protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85863"
FT                   /db_xref="GOA:A9R908"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R908"
FT                   /protein_id="ABX85863.1"
FT                   /translation="MAKQSMKAREVVRVKLANKYRAKREELKAIISGVNSSDEDRWDAV
FT                   LKLQSLPRDSSPSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW"
FT   gene            611567..611959
FT                   /gene="rpsH"
FT                   /locus_tag="YpAngola_A0597"
FT   CDS_pept        611567..611959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="YpAngola_A0597"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86386"
FT                   /db_xref="GOA:A9R909"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R909"
FT                   /protein_id="ABX86386.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIANVLKEEGF
FT                   IEDFKIEGDTKPVLELALKYFQGKAVVESIQRISRPGLRIYKKKDELPKVMAGLGIAVI
FT                   STSKGVMTDRAARQAGLGGEIICYVA"
FT   gene            611974..612507
FT                   /gene="rplF"
FT                   /locus_tag="YpAngola_A0598"
FT   CDS_pept        611974..612507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="YpAngola_A0598"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85013"
FT                   /db_xref="GOA:A9R910"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R910"
FT                   /protein_id="ABX85013.1"
FT                   /translation="MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELTRTVHSAVEVKQ
FT                   EENTLTFAPREGAVDGWAQAGTTRALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVVN
FT                   LALGFSHPVDHELPAGITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVR
FT                   YADEVVRTKEAKKK"
FT   gene            612517..612870
FT                   /gene="rplR"
FT                   /locus_tag="YpAngola_A0599"
FT   CDS_pept        612517..612870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="YpAngola_A0599"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85535"
FT                   /db_xref="GOA:A9R911"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R911"
FT                   /protein_id="ABX85535.1"
FT                   /translation="MDKKAARIRRATRARRKLKELGATRLVVHRTPRHIYAQVIAPNGS
FT                   EILVAASTVEKAINEQLKYAGNKDAAAAVGKTIAERALEKGITKVSFDRSGFQYHGRVQ
FT                   ALADAAREAGLQF"
FT   gene            612885..613388
FT                   /gene="rpsE"
FT                   /locus_tag="YpAngola_A0600"
FT   CDS_pept        612885..613388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="YpAngola_A0600"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88442"
FT                   /protein_id="ABX88442.1"
FT                   /translation="MSHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRAMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTG
FT                   IIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIAALEDMKSPEMVAAKRGKSVEE
FT                   ILGK"
FT   gene            613574..614008
FT                   /gene="rplO"
FT                   /locus_tag="YpAngola_A0601"
FT   CDS_pept        613574..614008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="YpAngola_A0601"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87094"
FT                   /db_xref="GOA:A9R913"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R913"
FT                   /protein_id="ABX87094.1"
FT                   /translation="MRLNTLSPAEGAKHAPKRVGRGIGSGLGKTAGRGHKGQNSRSGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSRKAMITAEVRLSELALVEGDVIDLNTLKAANVVGIQ
FT                   MEFVKVILSGEVNRAVTLRGLRVTKGARAAIEAAGGKIEE"
FT   gene            614016..615347
FT                   /gene="secY"
FT                   /locus_tag="YpAngola_A0602"
FT   CDS_pept        614016..615347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="YpAngola_A0602"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87589"
FT                   /protein_id="ABX87589.1"
FT                   /translation="MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGID
FT                   ATVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPALAE
FT                   IKKEGEAGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVS
FT                   LVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLLLLL
FT                   VAVLVFAVTFFVVFIERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFAS
FT                   SIILFPATIASWFGGGTGWNWLTTISMYLQPGQPLYVLLYASAIIFFCFFYTALVFNPR
FT                   ETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLIGAMYITFICLIPEFMRDAMKVPF
FT                   YFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYNR"
FT   misc_feature    615566..615677
FT                   /note="alpha operon ribosome binding site"
FT   gene            615645..616001
FT                   /gene="rpsM"
FT                   /locus_tag="YpAngola_A0603"
FT   CDS_pept        615645..616001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="YpAngola_A0603"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by match to protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86167"
FT                   /db_xref="GOA:A9R915"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R915"
FT                   /protein_id="ABX86167.1"
FT                   /translation="MARIAGINIPDQKHTVIALTAIFGIGKTRSQAICVAAGIAEHVKI
FT                   SELSEEQIEKLRDEVAKYVVEGDLRREVTLSIKRLMDLGTYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            616018..616407
FT                   /gene="rpsK"
FT                   /locus_tag="YpAngola_A0604"
FT   CDS_pept        616018..616407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="YpAngola_A0604"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85211"
FT                   /db_xref="GOA:A9R916"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R916"
FT                   /protein_id="ABX85211.1"
FT                   /translation="MAKAPIRARKRVRKTVSDGVAHIHASFNNTIVTITDRQGNALGWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   gene            616438..617058
FT                   /gene="rpsD"
FT                   /locus_tag="YpAngola_A0605"
FT   CDS_pept        616438..617058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="YpAngola_A0605"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by match to protein family HMM PF00163;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86863"
FT                   /db_xref="GOA:A9R917"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R917"
FT                   /protein_id="ABX86863.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQPPGQHGARK
FT                   PRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGANLLQLLEGRLDNVVYR
FT                   MGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAE
FT                   QREKPTWLEVDAVKMEGVFKRIPERTDLSADINEHLIVELYSK"
FT   gene            617084..618073
FT                   /gene="rpoA"
FT                   /locus_tag="YpAngola_A0606"
FT   CDS_pept        617084..618073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="YpAngola_A0606"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87299"
FT                   /protein_id="ABX87299.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNK
FT                   SGIGPVTAADITHDGDVEIVKPQHVICHLTDENASINMRIKVQRGRGYVPASARIHSEE
FT                   DERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAAT
FT                   ILAEQLEAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
FT   gene            618114..618503
FT                   /gene="rplQ"
FT                   /locus_tag="YpAngola_A0607"
FT   CDS_pept        618114..618503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="YpAngola_A0607"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86258"
FT                   /db_xref="GOA:A9R919"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R919"
FT                   /protein_id="ABX86258.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDNVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRAASQAEVVAAE"
FT   gene            618941..619375
FT                   /gene="zntR"
FT                   /locus_tag="YpAngola_A0608"
FT   CDS_pept        618941..619375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntR"
FT                   /locus_tag="YpAngola_A0608"
FT                   /product="Zn(II)-responsive transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF09278; match to protein
FT                   family HMM TIGR02043"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85153"
FT                   /protein_id="ABX85153.1"
FT                   /translation="MDNMLKIGQLAKLADVTPDTIRYYEKQGMMDHGERTDGGYRLYTD
FT                   QDLQRLRFIRYAKQLGFTLDTIAELLSIRIDPDHHTCQESKSIVDSRLSDVEGKIRELE
FT                   RMRDSLKRLSEACCGTSHATTYCSILEALEQGATEELIKV"
FT   gene            619463..619663
FT                   /locus_tag="YpAngola_A0609"
FT   CDS_pept        619463..619663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0609"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03889"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87846"
FT                   /protein_id="ABX87846.1"
FT                   /translation="MTTYRHTKGKIKDNALEALLHDPLFRQRIEKNSKGKGSYQRKEKY
FT                   AKGSNWEASGKQSIDFLLLAF"
FT   gene            complement(619794..621002)
FT                   /locus_tag="YpAngola_A0610"
FT   CDS_pept        complement(619794..621002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0610"
FT                   /product="IS285, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88416"
FT                   /protein_id="ABX88416.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            complement(621096..621509)
FT                   /gene="mscL"
FT                   /locus_tag="YpAngola_A0611"
FT   CDS_pept        complement(621096..621509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="YpAngola_A0611"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01741;
FT                   match to protein family HMM TIGR00220"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86811"
FT                   /db_xref="GOA:A9R923"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R923"
FT                   /protein_id="ABX86811.1"
FT                   /translation="MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPL
FT                   GLLLGGVDFKQFHFVLRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRR
FT                   EKAEEEPATPPAPTTEEILLAEIRDLLKAQHTK"
FT   gene            complement(621648..623024)
FT                   /gene="trkA"
FT                   /locus_tag="YpAngola_A0612"
FT   CDS_pept        complement(621648..623024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="YpAngola_A0612"
FT                   /product="Trk system potassium uptake protein TrkA"
FT                   /note="identified by match to protein family HMM PF02080;
FT                   match to protein family HMM PF02254; match to protein
FT                   family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86835"
FT                   /protein_id="ABX86835.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITVVDIDSGRLRQLQDKFDL
FT                   RVVQGYGSHPRVLREAGAEDADMLVAVTNSDETNMIACQIAYSLFNTPNRIARIRSTEY
FT                   IREADKLFLPEAVPIDHLISPEQLVIDYIYKLIEYPGALQVVNFAEGKVSIAAVKAYYG
FT                   GPLVGNALSSLREHMPHIDTRVAAIFRQDRPIRPQGSTIIEAGDEVFFVAASQHIRAVM
FT                   SELQRLEKPYKRIMIVGGGNVGAGLALRLEKDYSVKLIERDQQRAAELAEMLHDTIVFY
FT                   GDASDQELLAEEHIEQVDVFIAITNDDEANIMSAMLAKRMGAKKAMVLIQRSAYVDLVQ
FT                   GSVIDIVISPQQATISALLGHVRKADIVSVSSLRRGVAEAIEAIAHGDESTSKVVGRMV
FT                   EDIKLPPGTTIGAIVRGDEVIIANSNSIIKQGDHVIMFITHKKFVPDVERLFQPSPFFL
FT                   "
FT   gene            complement(623080..624387)
FT                   /gene="rsmB"
FT                   /locus_tag="YpAngola_A0613"
FT   CDS_pept        complement(623080..624387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="YpAngola_A0613"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM PF01189; match to protein
FT                   family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87362"
FT                   /db_xref="GOA:A9R925"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023541"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R925"
FT                   /protein_id="ABX87362.1"
FT                   /translation="MSAFLVMKNTYNLRSIAAKAISQVLDQGQSLSAVLPELQKNISDK
FT                   DRALLQELCFGTLRVLPQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAA
FT                   LAETVEGATVLKRPQLKGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAY
FT                   PAQWQQILDANNQRPPMWLRVNRQHHSRSEYLELLTQADINAEPHPIYRDAVRLITPCA
FT                   VNHLPGFELGWVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLA
FT                   VDIDEQRLSRVKENLQRLQLQAVVRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRH
FT                   PDIKWLRRDRDISELAQLQSEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRH
FT                   PEAQLTETGTTAAPGKQNLPHPEDGDGFFYAKIIKK"
FT   gene            complement(624463..625410)
FT                   /gene="fmt"
FT                   /locus_tag="YpAngola_A0614"
FT   CDS_pept        complement(624463..625410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="YpAngola_A0614"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86223"
FT                   /db_xref="GOA:A9R926"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R926"
FT                   /protein_id="ABX86223.1"
FT                   /translation="MSDSLRIIFAGTPDFAARHLGALLSSQHKIVGVFTQPDRPAGRGN
FT                   KLTPSPVKILAEHHGIPVFQPKSLRPEENQHLVADLNADIMVVVAYGLILPAAVLAMPR
FT                   LGCINVHGSLLPRWRGAAPIQRSVWAGDEKTGITIMQMDIGLDTGAMLHKIECAIQPED
FT                   TSATLYDKLAQLGPQGLLITLQQLAAGTALAEVQNETQATYAEKLSKEEAKLDWTLSAT
FT                   QLERCIRAFNPWPVSYFIVDEQPIKVWQAQVLPAGEDAEPGTIIHADKHGIQVATADGV
FT                   LNITQLQPAGKKAMSAADLLNSRREWFIPGSQLV"
FT   gene            complement(625435..625947)
FT                   /gene="def"
FT                   /locus_tag="YpAngola_A0615"
FT   CDS_pept        complement(625435..625947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="YpAngola_A0615"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85024"
FT                   /db_xref="GOA:A9R927"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R927"
FT                   /protein_id="ABX85024.1"
FT                   /translation="MSVLQVLHYPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGI
FT                   GLAATQVDVHQQIIVIDISENRDQRLVLINPELLEKSGETGIEEGCLSIPEQRALVPRA
FT                   EKVKIRALDRDGKPFELETDGLLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKLEKMA
FT                   KLNARAN"
FT   gene            626082..626825
FT                   /gene="dprA"
FT                   /locus_tag="YpAngola_A0616"
FT   CDS_pept        626082..626825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dprA"
FT                   /locus_tag="YpAngola_A0616"
FT                   /product="DNA protecting protein DprA"
FT                   /note="identified by match to protein family HMM PF02481;
FT                   match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87188"
FT                   /protein_id="ABX87188.1"
FT                   /translation="MLAAELWLRMTQVKGLGVVKRSALAKRLLASGDIHPGRLAAYGLD
FT                   SQQCHQFAQLSPRYIADTLEWLSDPNHHLLTYGEPGYPPRLVHIAGAPLVLFVSGELDV
FT                   LYRPQIAMVGSRHFSHYGEQWGRYFASELARTGLVITSGLAVGIDGICHQAALNIQGRT
FT                   IAVLGSGLENIYPQRHSRLAKEIEYQGGALVSEFLTTALPIAAHFPRRNRIISGLSDAV
FT                   LVVEATLKSGSLIVPRKPPARLGVQ"
FT   gene            626879..627388
FT                   /locus_tag="YpAngola_A0617"
FT   CDS_pept        626879..627388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0617"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87349"
FT                   /protein_id="ABX87349.1"
FT                   /translation="MRSGNSKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            627513..627914
FT                   /locus_tag="YpAngola_A0618"
FT   CDS_pept        627513..627914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0618"
FT                   /product="protein smf"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88053"
FT                   /protein_id="ABX88053.1"
FT                   /translation="MDQGRDVFALPGPLGSASSEGTHWLIQQGAYLATSVKDVSEQVSG
FT                   SLQWLSLPEEVIISSPQEQVELPFADVLANVGDEVTPVDVVAERAGQPVQDIASKLLEL
FT                   ELAGWIAAVPGGYVRIRRAGHVRRSNLLI"
FT   gene            627886..628359
FT                   /gene="smg"
FT                   /locus_tag="YpAngola_A0619"
FT   CDS_pept        627886..628359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smg"
FT                   /locus_tag="YpAngola_A0619"
FT                   /product="smg protein"
FT                   /note="identified by match to protein family HMM PF04361"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88472"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R931"
FT                   /protein_id="ABX88472.1"
FT                   /translation="MFDVLIYLFETYMHNEPEMLVDQDKITDDLADAGFYREDINNALN
FT                   WLEVLADLQEGQKAPYLYTADPQALRIYTVEECRRLGAACRGFILFLEQIQVLQFDTRE
FT                   MVIDRIMALDSPEIDLEDLKWVVLMVLFNIPGYENAYKQMEELLFEVNDGYLH"
FT   gene            628400..628939
FT                   /locus_tag="YpAngola_A0620"
FT   CDS_pept        628400..628939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0620"
FT                   /product="topoisomerase DNA binding C4 zinc finger domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01396"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84983"
FT                   /protein_id="ABX84983.1"
FT                   /translation="MTKKVITKDNGSCPECGSALVIRSGGHGPFLGCSHYPDCQYIRPL
FT                   KAQADGHVVKTLEGQPCPECGSDMMLRQGRFGMFIGCSQYPQCDHTEVIDKPDETSIDC
FT                   PQCGQGKLLQRKSRFGKVFHACNRYPDCQFTLNQPPIAGKCGYCHYPLLIEKRTARGIK
FT                   RICASKLCGKAVASES"
FT   gene            628941..629513
FT                   /gene="rimN"
FT                   /locus_tag="YpAngola_A0621"
FT   CDS_pept        628941..629513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimN"
FT                   /locus_tag="YpAngola_A0621"
FT                   /product="ribosomal modification protein RimN"
FT                   /note="identified by match to protein family HMM PF01300"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88046"
FT                   /db_xref="GOA:A9R933"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R933"
FT                   /protein_id="ABX88046.1"
FT                   /translation="MNQQENNFVLADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNT
FT                   LLALKQRPWQKGLILVAANYAQLEPYINDSMLNEIQRETLFSTWPGPITWVIPARVETP
FT                   QWLTGCFDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLSGHEPCRTEEEVRIQFGPSLP
FT                   VLSGHVGGRLNPSEIRDALTGKRFRQG"
FT   gene            629522..630343
FT                   /gene="aroE"
FT                   /locus_tag="YpAngola_A0622"
FT   CDS_pept        629522..630343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="YpAngola_A0622"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by match to protein family HMM PF01488;
FT                   match to protein family HMM PF08501; match to protein
FT                   family HMM TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85898"
FT                   /db_xref="GOA:A9R934"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R934"
FT                   /protein_id="ABX85898.1"
FT                   /translation="MDQKFAVFGNPISHSKSPRIHTLFSEQTGIEHRYGKVLAPSEAFE
FT                   NTLVSFFADGAQGANITTPFKERAYDQCDELTDRASLAGAVNTIKRLEDGRLLGDNTDG
FT                   IGLLSDLERQNLIRTTDHILLVGAGGAARGVILPLLSYGCTVVVTNRTHTRAQQLAKVF
FT                   NHIGDIDVCEMSELAGQRFDLVINATASGLHGEVPNLPAAILTSQTRCYDMFYQAGTTP
FT                   FLAWAQRLGLADYADGLGMLVGQAAHAFKLWHGVMPEITPVLAQLRSELGK"
FT   gene            complement(630398..630940)
FT                   /locus_tag="YpAngola_A0623"
FT   CDS_pept        complement(630398..630940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0623"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86315"
FT                   /protein_id="ABX86315.1"
FT                   /translation="MCDSIRPYLHHSPTLGKRVMIDRSSVIIGNVILGDDVSVWPLVAI
FT                   RGDVNQVIIGARSNIQDGSVLHVTHQSEHNPEGYPLIIGEDVTIGHKAMLHGCTIGNRV
FT                   LVGMGSILLDGTIIEDDVMIGAGSLITPGKRLVSGYLYVGSPAKQIRPLTPLELEGLLY
FT                   SAGNYVRWKDDYLAESK"
FT   gene            complement(631301..631447)
FT                   /locus_tag="YpAngola_A0624"
FT   CDS_pept        complement(631301..631447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87405"
FT                   /protein_id="ABX87405.1"
FT                   /translation="MLKDYFLQIGILTEVKMFTALVTLQDLILFLPAETGGDIVLRVPT
FT                   QIV"
FT   gene            631516..632993
FT                   /gene="rrs"
FT                   /locus_tag="YpAngola_A0625"
FT   rRNA            631516..632993
FT                   /gene="rrs"
FT                   /locus_tag="YpAngola_A0625"
FT                   /product="16S ribosomal RNA"
FT   gene            633136..633214
FT                   /locus_tag="YpAngola_A0626"
FT   tRNA            633136..633214
FT                   /locus_tag="YpAngola_A0626"
FT                   /product="tRNA-Ile"
FT   gene            633264..633341
FT                   /locus_tag="YpAngola_A0627"
FT   tRNA            633264..633341
FT                   /locus_tag="YpAngola_A0627"
FT                   /product="tRNA-Ala"
FT   gene            633559..636465
FT                   /gene="rrl"
FT                   /locus_tag="YpAngola_A0629"
FT   rRNA            633559..636465
FT                   /gene="rrl"
FT                   /locus_tag="YpAngola_A0629"
FT                   /product="23S ribosomal RNA"
FT   gene            636575..636690
FT                   /gene="rrf"
FT                   /locus_tag="YpAngola_A0630"
FT   rRNA            636575..636690
FT                   /gene="rrf"
FT                   /locus_tag="YpAngola_A0630"
FT                   /product="5S ribosomal RNA"
FT   gene            636705..636782
FT                   /locus_tag="YpAngola_A0631"
FT   tRNA            636705..636782
FT                   /locus_tag="YpAngola_A0631"
FT                   /product="tRNA-Thr"
FT   gene            636822..636937
FT                   /gene="rrf"
FT                   /locus_tag="YpAngola_A0632"
FT   rRNA            636822..636937
FT                   /gene="rrf"
FT                   /locus_tag="YpAngola_A0632"
FT                   /product="5S ribosomal RNA"
FT   gene            637167..637307
FT                   /locus_tag="YpAngola_A0633"
FT   CDS_pept        637167..637307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86409"
FT                   /protein_id="ABX86409.1"
FT                   /translation="MIKNLFYSPLNKGITALKGTSVAVTNGAIVIHTQRLKSDPGGNLL
FT                   S"
FT   gene            637321..638343
FT                   /locus_tag="YpAngola_A0634"
FT   CDS_pept        637321..638343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0634"
FT                   /product="transposase for insertion sequence"
FT                   /note="identified by match to protein family HMM PF00665;
FT                   match to protein family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85988"
FT                   /protein_id="ABX85988.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            638343..639122
FT                   /locus_tag="YpAngola_A0635"
FT   CDS_pept        638343..639122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0635"
FT                   /product="putative transposition helper protein"
FT                   /note="identified by match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88350"
FT                   /protein_id="ABX88350.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            639161..639349
FT                   /locus_tag="YpAngola_A0636"
FT   CDS_pept        639161..639349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0636"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87921"
FT                   /protein_id="ABX87921.1"
FT                   /translation="MDHFSSVVDSGLRHYGFNSIFSLCLILLVVNRSASHRYFVATQLP
FT                   SNGQYDSDKNVTDEFKI"
FT   gene            639636..640565
FT                   /gene="metA"
FT                   /locus_tag="YpAngola_A0637"
FT   CDS_pept        639636..640565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metA"
FT                   /locus_tag="YpAngola_A0637"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="identified by match to protein family HMM PF04204;
FT                   match to protein family HMM TIGR01001"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85578"
FT                   /db_xref="GOA:A9R941"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9R941"
FT                   /protein_id="ABX85578.1"
FT                   /translation="MPIRVPDELPAVSFLRNENVFVMASSRAKTQEIRPLKVLILNLMP
FT                   KKIETENQFLRLLSNSPLQVDIQLLRVDSRESKNTPTEHLNNFYCDFEDIQDQNFDGLI
FT                   VTGAPLGLVDFCDVAYWPQIERIIAWAKEHVTSTLFVCWAVQAALNILYGIPKMTREVK
FT                   LSGIYQHQTLEPLALLTRGFDETFLAPHSRYADFPVEVLQQYTDLDILVSSEEAGAYLF
FT                   ASKDKRVAFVTGHPEYDVDTLAGEYQRDLAAGLNPQVPLNYFPSDDASLRPKASWRSHG
FT                   HLLFANWLNYYVYQITPFDLRHMNPTLD"
FT   gene            complement(640765..640908)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0638"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by glimmer; putative"
FT   gene            640986..642584
FT                   /gene="aceB"
FT                   /locus_tag="YpAngola_A0639"
FT   CDS_pept        640986..642584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceB"
FT                   /locus_tag="YpAngola_A0639"
FT                   /product="malate synthase A"
FT                   /EC_number="2.3.3.9"
FT                   /note="identified by match to protein family HMM PF01274;
FT                   match to protein family HMM TIGR01344"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85890"
FT                   /protein_id="ABX85890.1"
FT                   /translation="MRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTELVVKFSESRNQ
FT                   LLATRASWQQTIDQGALPDFILETNSIRDGDWKIQGIPADLRDRRVEITGPVERKMVIN
FT                   ALNANVKVFMADFEDSLAPSWDKVIDGQINLHDAVKGTISYTNESGKVYQLKPNPAVLI
FT                   ARVRGLHLPEKHVKWQDEAIPGGLFDFALYFYHNYQQLLAKGSGPYFYLPKMQSYQEAA
FT                   WWSDVFNFTEQRFGLSQGTIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFS
FT                   YIKTLKNHPDRVLPDRQSVTMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPDKDAEK
FT                   NKLVLDKVRADKELEASNGHDGTWVAHPGLADTVMDVFNKVLGSRPNQLEVSREQDKPI
FT                   TAAELLEPCSGERTEAGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIW
FT                   QWIHHQKSLSNGQTVTKELFRSMLSEEIQVVKLELGAERFDRGRFEEAARLMERITTQD
FT                   ELIDFLTLPGYALLA"
FT   gene            642631..643938
FT                   /gene="aceA"
FT                   /locus_tag="YpAngola_A0640"
FT   CDS_pept        642631..643938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceA"
FT                   /locus_tag="YpAngola_A0640"
FT                   /product="isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /note="identified by match to protein family HMM PF00463;
FT                   match to protein family HMM TIGR01346"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86252"
FT                   /protein_id="ABX86252.1"
FT                   /translation="MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECT
FT                   FAQNGAKKLWELLHGGSRKGYINCLGALTGGQALQQAKAGVEAIYMSGWQVAADANTAS
FT                   SMYPDQSLYPVDSVPAVVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGF
FT                   GGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAAD
FT                   VLGVPTLLIARTDADAADLLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYA
FT                   PYADLVWCETSTPDLALAKRFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDE
FT                   LSAMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFAS
FT                   HQQEVGTGYFDKVTNIIQGGASSVTALTGSTEEQQF"
FT   gene            644247..645461
FT                   /locus_tag="YpAngola_A0641"
FT   CDS_pept        644247..645461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0641"
FT                   /product="YeeE/YedE family protein"
FT                   /note="identified by match to protein family HMM PF04143"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86984"
FT                   /protein_id="ABX86984.1"
FT                   /translation="MSWPEFKSQYLVRFWAPLPAVIAAGILATYYFGLTGTFWAVTGEF
FT                   TRWGGHIMQLFGAQPQEWGYFKVIGLEGTPLDRIDGMMIIGMFAGCIAAALWANNIKLR
FT                   KPQHTIRIAQALVGGIIAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAAGSYFGA
FT                   KFTLLPLFRIPIKLQKVTAASPLTQHPARAARRFRLGMVVLVLALGWSLIELFRQPKLG
FT                   IAMLCGIGFGLLIERAQICFTSAFRDLWITGRTHMAKAIILGMAVSTLGIFSYVQLGVE
FT                   PKILWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQIHYWWVGLGNIIGATLLAYY
FT                   WDDFAPALATNYDKVNLLETFGPMGGLLVTYLMLALAFAAMLWWEKRFFRKQKATTSAL
FT                   IKESL"
FT   gene            645458..645727
FT                   /locus_tag="YpAngola_A0642"
FT   CDS_pept        645458..645727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0642"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86792"
FT                   /protein_id="ABX86792.1"
FT                   /translation="MSHSPSVETPQLAAPIVPDYRLDMVGEPCPYPAVATLEAMPQLKP
FT                   GEILEVISDCPQSINNIPLDARNYGYTVLDIQQDGPTIRYLIQR"
FT   gene            complement(645805..646788)
FT                   /locus_tag="YpAngola_A0643"
FT   CDS_pept        complement(645805..646788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0643"
FT                   /product="substrate-binding transcriptional regulator, LysR
FT                   family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85357"
FT                   /protein_id="ABX85357.1"
FT                   /translation="MSIDENTFAFSAKINNHAIYKHLENFIKIVECNSLSIAAHKLNIT
FT                   PSSTSRSLAQLEEKLGVVLLKRTTRSIVLTDAGDYLFHQARQLLLDLDETLVNTHSFYN
FT                   HPQGQLKITCSIAFGVCHLMHLFSQYKETNSDVCLSVDLNDQLVNLNEEHFDIALRITS
FT                   IPPPNFAIRRICTINWVYCGSKEYLMKRGVPATIEDLEQHDCLVNPNVSDAWLYKSTEG
FT                   ESVPLKIKNTVQANSSLGLLHAALHHQGIVCLPTYMLGDYITSGKLVPILLDYNAKDKE
FT                   YGLYALYYPSKYNDPKIRSFIDFMLDELSMDVPWDKWRADYQISLS"
FT   gene            646958..648244
FT                   /locus_tag="YpAngola_A0644"
FT   CDS_pept        646958..648244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0644"
FT                   /product="putative serine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84878"
FT                   /protein_id="ABX84878.1"
FT                   /translation="MSEISSSKSELKKLYKSVPFTQYDVGWVILCIGMAIGSGIVFMPV
FT                   QVGIKGIWVFIAAVIISYPAIYLLQNLYLRTLSESDNCTDYTSVITQYLGKNWGVGLGI
FT                   AYFLMLLHGMFSYSLAVTFDSASYIKTFGLTEGLLSDSIWYGLIILTVLVAIAAQGEKI
FT                   LFKVSGPMVCVKFGIIVVLGVVMVPYWDFNNISAFPELFSFLRDVLLTLPFTLFSILFV
FT                   QILSPMNIAYRKVESDKRIATYRAIRANRVAYIILAVAVLFFAFSFTFSISHEQAVSAF
FT                   EQNISALAIAAQVIPGSIVRIMTALLNIFAILTAFLGIYLGFQEAIKGIVVNIISRFIP
FT                   EENINQKVLHIGVCVGVILTLWLWVSTRFSILFFLQLGGPLFGVVSCLIPCYLVYKVPV
FT                   LHKLKGPTIWFISFFGILLCLSPFFKFFE"
FT   gene            648290..649471
FT                   /gene="metC2"
FT                   /locus_tag="YpAngola_A0645"
FT   CDS_pept        648290..649471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC2"
FT                   /locus_tag="YpAngola_A0645"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM TIGR01324"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86440"
FT                   /protein_id="ABX86440.1"
FT                   /translation="MNKKDISSFGISTQITQLGRNPQEQTGFVNTPIYRGSTVIFNTVD
FT                   DIVNNRAVFNYGTAGTPTIANLESAWTALAGAAGTVISPSGLGVIALALLTTLKAGDHL
FT                   LMPDSVYKPTRLLCAGLIARMGVETTYYDPLIGAEIETLMKPNTSTLFLESPGSQSFEI
FT                   QDIPMMTAITKRRGIATIIDNTWASPLFFAAHKHGCDLSLEAGTKYLGGHSDLLMGLVS
FT                   ANEQWWPKLRETYDSMAMLPGAEDCFLALRGLRTLHLRIKEAEKRGLEMAQWLKERPEV
FT                   LRVLHPAFPDCPGHEFWKRDFTGSSGLFSIVLKPEFTQKGLAEMLDNMSIFAMGFSWGG
FT                   YESLVIPFDCSEYRTVTKWNPGGLTIRLQIGLEDMEDLKEDLAQGFIRLASNS"
FT   gene            complement(649612..650412)
FT                   /gene="hmuV"
FT                   /locus_tag="YpAngola_A0646"
FT   CDS_pept        complement(649612..650412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="YpAngola_A0646"
FT                   /product="hemin ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85639"
FT                   /protein_id="ABX85639.1"
FT                   /translation="MVDMAVTPVALLEASHLHYHVQQQALINDVSLHIASGEMVAIIGP
FT                   NGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSVSE
FT                   VIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLWQPQ
FT                   PTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDLNLAALYADRIMLLA
FT                   QGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALPQIYLRQ"
FT   gene            complement(650405..651409)
FT                   /gene="hmuU"
FT                   /locus_tag="YpAngola_A0647"
FT   CDS_pept        complement(650405..651409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="YpAngola_A0647"
FT                   /product="hemin ABC transporter, permease protein HmuU"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87047"
FT                   /protein_id="ABX87047.1"
FT                   /translation="MNGRVQPRLMLGFLLILLVILALGSANMGALSLSFRTLWNTSTND
FT                   AMWHIWLNIRLPRVLLAVVVGCALAVSGTIMQGLFRNPLADPGLLGISSGAALCVGLII
FT                   VMPFSLPPLLALYSHMVGAFIGSLAISTIIFTLSRWGHGNLARLLLAGIAINALCGAAV
FT                   GVLTYISDDQQLRQFSLWSMGSLGQAQWSTLLVASSLILPTCILGLLQARQLNLLQLGD
FT                   EEAHYLGVNVRQAKLRLLLLSAILIGAAVAVSGVIGFIGLVVPHLIRMRIGADHRWLLP
FT                   GAALGGACLLLTADTLARTLVAPAEMPVGLLTSLLGGPYFLWLILRQREQRSG"
FT   gene            complement(651406..652245)
FT                   /gene="hmuT"
FT                   /locus_tag="YpAngola_A0648"
FT   CDS_pept        complement(651406..652245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuT"
FT                   /locus_tag="YpAngola_A0648"
FT                   /product="hemin ABC transporter, periplasmic hemin-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86753"
FT                   /protein_id="ABX86753.1"
FT                   /translation="MRLRLLSLPFILSLCAPLLPLNTLAAERIVTIGGDVTEIAYALGA
FT                   GDEIVARDSTSQQPQAAQKLPDVGYMRTLNAEGILAMKPTMLLVSELAQPSLVLTQIAS
FT                   SGVNVVTVPGQTTPESVAMKINAVATALHQTEKGQKLIEDYQQRLAAVNKTPLPVKVLF
FT                   VMSHGGLTPMAAGQNTAADAMIRAAGGSNAMQGFSRYRPLSQEGVIASAPDLLLITTDG
FT                   VKALGSSENIWKLPGMALTPAGKHKRLLVVDDMALLGFGLETPQVLAQLREKMEQMQ"
FT   gene            complement(652242..653279)
FT                   /gene="hmuS"
FT                   /locus_tag="YpAngola_A0649"
FT   CDS_pept        complement(652242..653279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuS"
FT                   /locus_tag="YpAngola_A0649"
FT                   /product="hemin transport protein HmuS"
FT                   /note="identified by match to protein family HMM PF05171"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88097"
FT                   /protein_id="ABX88097.1"
FT                   /translation="MNASLYQQYVQAKAEHPGKYARDLATLMGISEAELTHSRVGHDAK
FT                   RLQSDARALLAALESVGEVKAITRNTYAVHEQVGRYENQHLNGHAGLILNPRALDLRLF
FT                   LNQWASAFTLTEETRHGVRHSIQFFDHQGDALHKVYVTEQTDMSAWEALLAQFIIPENP
FT                   ALQLEPLSTPEAVEPTADDATVDSEWRAMTDVHQFFQLLKRNNLTRQQAFRAVGDDLAY
FT                   QVDNNSLTQLLHIAQQDQNEIMIFVGNRGCVQIFTGLIEKVTPHNEWINVFNQRFTLHL
FT                   IETAIAESWITRKPTKDGFVTSLELFAADGTQLAQLYGQRTEGQPEQNQWREQIARLIN
FT                   KDIAA"
FT   gene            complement(653398..655428)
FT                   /gene="hmuR"
FT                   /locus_tag="YpAngola_A0650"
FT   CDS_pept        complement(653398..655428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuR"
FT                   /locus_tag="YpAngola_A0650"
FT                   /product="TonB-dependent hemin receptor HmuR"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01785; match to protein family HMM
FT                   TIGR01786"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87333"
FT                   /protein_id="ABX87333.1"
FT                   /translation="MLRSTSDRFRWSSLSLAIACTLPLATQAADTTTTQTSSKKHSTDT
FT                   MVVTATGNERSSFEAPMMVTVIEGNAPTSQTAATAADMLRQVPGLTVTGSGRTNGQDVV
FT                   MRGYGKQGVLTLVDGVRQGTDTGHLNSTFLDPALVKRIEIVRGPAALLYGSGALGGVIA
FT                   YETVDAADMLQPGQNSGYRVYSSAATGDHSFGLGASAFGRTDDLDGILSFGTRDIGNIR
FT                   QSNGFNAPNDETISNVLAKGTWQIDSIQSLSANLRYYNNSAIEPKNPQTSAPSSTNVMT
FT                   NRSTIQRDAQLRYNIKPLDQEWLNATAQVYYSEVEINARPQGSAEEGREQTTEGVKLEN
FT                   RTRLFIESPASHLLTYGTETYKQEQTPGGATESFPQAKIRFSSGWLQDEITLRDLPVSI
FT                   LAGTRYDNYSGSSDGYADVDADKWSSRGAISITPTDWLMLFGSYAQAFRAPTMGEMYND
FT                   SKHFAIPIRPGLTLTNYWVPNPNLKPETNETQEYGFGLRFSDLLMAEDDLQFKVSYFDT
FT                   KAKDYISTRVDMQAMTTTSVNIDQAKIWGWDASMSYKTALFNWDLAYNRTRGKNQNTDE
FT                   WLDTINPDTVTSIVDVPVANSGFSVGWIGTFANRSSRVSSSTPQAGYGVNDFYVSYKGQ
FT                   EAFKGMTTTMLLGNVFEKEYYTPQGIPQDGRNVKFFVSYQW"
FT   gene            complement(655558..655749)
FT                   /gene="hemP"
FT                   /locus_tag="YpAngola_A0651"
FT   CDS_pept        complement(655558..655749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemP"
FT                   /locus_tag="YpAngola_A0651"
FT                   /product="hemin uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86178"
FT                   /protein_id="ABX86178.1"
FT                   /translation="MDKQLNKVPMLNDEPAAEYSVARKPLSIASEQLLGEHGVAFIVHQ
FT                   GECYQLRQTKSGKLILTK"
FT   gene            complement(655835..656485)
FT                   /locus_tag="YpAngola_A0652"
FT   CDS_pept        complement(655835..656485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0652"
FT                   /product="NmrA family protein"
FT                   /note="identified by match to protein family HMM PF05368"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86950"
FT                   /protein_id="ABX86950.1"
FT                   /translation="MRPWLIFGAGRGVGAHLLALANQHADSASNPRPVTLLIRNQQQAE
FT                   ELRNKGLTVVCGDACDPASVREACQLAGEDAAIISTLGNNNANYQGNRLIIDTAEQLGL
FT                   KRMLLVTSIGCGDSWPTLSPAARAAFGQAVREKSLAESWLQTSNLIYTLIRPGGLLDQP
FT                   ATGNAIRLQTEAHGMVTRADVAHHISQMIEDPATYYQAYALIEPGLARKVKMN"
FT   gene            complement(656519..657028)
FT                   /locus_tag="YpAngola_A0653"
FT   CDS_pept        complement(656519..657028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0653"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06228"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87480"
FT                   /protein_id="ABX87480.1"
FT                   /translation="MNRSPLAEFLATQPDGTLEQIAQDYQVSVLDVVRALPERVLVGAE
FT                   HFDRIWDSMTEWGDVTTLVHTADVILEHKGPLPSGTHRHGYFNLRSKQGLSGHIRAQNC
FT                   QAIALLERPFMGMATASVQFFNQQGEVMFKVYVGRDEHRQLRADGLAAFHQLAQQLLIE
FT                   DPTLVK"
FT   gene            complement(657061..658305)
FT                   /locus_tag="YpAngola_A0654"
FT   CDS_pept        complement(657061..658305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0654"
FT                   /product="radical SAM domain/HemN domain protein"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85852"
FT                   /protein_id="ABX85852.1"
FT                   /translation="MPWRDSRPLPAESLQDSWQSLLQKALPRNKRLLYLHIPFCATHCT
FT                   FCGFYQNPLQSGSTERYTDYLLRELSMEADSPLLQGGPIHAIYFGGGTPSALSAQQLHS
FT                   IISQLRKSLPLAPDCEITVEGRIFNFDDERIDACLEAGANRFSIGVQTFNTRIRQRMGR
FT                   KADRDQAIRFLTDLATRDRAAVVCDLMFGLPHQTPEIWQEDLAIVRQLPLDGVDLYALN
FT                   LLPTTPLAKSVENNRVELPTLAQQCDFYCSGADSLAQAGWHQLSNSHWARTTRERNLYN
FT                   LLIKQGADCLALGSGAGGSLQGHAYMQHRSLDNYYRLIDSGQKPLMMMTQASGEHPWRA
FT                   KLQSGIEVGRLDLSELIADPYPLMPLISQWYQSNLLKDNSFCLRLTDSGRFWASNIMQA
FT                   LQNIIPSLITAESHS"
FT   gene            complement(658710..659510)
FT                   /locus_tag="YpAngola_A0655"
FT   CDS_pept        complement(658710..659510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0655"
FT                   /product="Methylenetetrahydrofolate reductase"
FT                   /note="identified by match to protein family HMM PF02219"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86378"
FT                   /protein_id="ABX86378.1"
FT                   /translation="MERKLSFEMNSAKNEKEMENIFKLIEFTDTLDPIYYTVNTEIGSS
FT                   VWSDTYRTVIELREKTDVPLIPHITINNKKEREIMQIIEKYINVGICEFFVIRGDKHVY
FT                   DQDNPINYGVELIELIRRSHKHIGIKTSLYPDFHKETTEVKEEIDWNERKYQLGVNEFI
FT                   SQLTLNTNALDFLSHWVDKERPFTPSIMPLGNFSFIEKFTSSNSIDYPLWIKKFANSKS
FT                   NSNEDKENIGIEIIRFLCREYLNQRERLHVFTLNKVDVMKKIFQ"
FT   gene            complement(659825..660313)
FT                   /locus_tag="YpAngola_A0656"
FT   CDS_pept        complement(659825..660313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0656"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85232"
FT                   /protein_id="ABX85232.1"
FT                   /translation="MLLSTKQFRHYTLALLLASGKPVDADDIYDKLSCSGPTLTRALKE
FT                   LRETYNAEIRYSKSTHSYQLTEKGTLTPKVLRHIKDAIASHMIIKSHEELVASHVILDK
FT                   EKKRSISLSLRMSVIRKIDRVVNQLEITRSEAVEILVNTYISELMLSVSQPPKGKKSV"
FT   gene            complement(660711..661670)
FT                   /locus_tag="YpAngola_A0657"
FT   CDS_pept        complement(660711..661670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85776"
FT                   /protein_id="ABX85776.1"
FT                   /translation="MKSTPSAYALGATLYMPATRTDIADIIIHNKISGLRSLVICLEDA
FT                   VSEDDVPLAISQLSTLLGTLAVEKKRDGSAHWPLIFVRPRHEAMGLALITRFNLSAING
FT                   FVLPKFTQASITTWWEIMKETHLCMMPTLETEDVFDVAKMSTLARELENHPSRQRIVAL
FT                   RIGGNDLMSVISMRRSRKLTLYDGPMGYVIKMLVSVFCPKNFALTAPVCEQIDNPQLLE
FT                   TELALDIAHGLVGKTAIHPSQIEVIQRALMVDTHDHADALRILNSTQAVFKSQGAMCEP
FT                   STHKRWAAAILERAQYYGIMPDFTAMAVRDAPRKHQSG"
FT   gene            complement(661670..662749)
FT                   /locus_tag="YpAngola_A0658"
FT   CDS_pept        complement(661670..662749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87991"
FT                   /protein_id="ABX87991.1"
FT                   /translation="MHDITPFSGSYLPDDIQFLLKPIQIEMTPVEVKEKLIQSGARHYS
FT                   DMLSQEPAPTEHHLTLFARALDQGATRMAREVVMLAKALINRFGDTPIVLASLVRAGVP
FT                   LGVMLHHTLRALGKTSFHYGISIIRDRGIDEVALSYIEQKHGTEGLVFVDGWTGKGAIT
FT                   GELTRSLQGRPGYPELPRLVVLADPCGCSWLSATDDDWLIPFGIMGAPVSGLVSRSLWS
FT                   EKGLHGCVHCEHLQEFECSQLLVNTVADCRQQLDLSQIPAAEWDYQQNAALRIQSHQVV
FT                   KKMAEQFEINSVNRIKPGIAEATRAVLRRVPDHVLVRHIDDPDVSLLVYLAKQKKIAIK
FT                   EVGNELGQYRAITIIKKVI"
FT   gene            complement(662742..663554)
FT                   /locus_tag="YpAngola_A0659"
FT   CDS_pept        complement(662742..663554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0659"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88545"
FT                   /protein_id="ABX88545.1"
FT                   /translation="MNKPVFLCDLDDTLFQTRRKMVDELDLPPFRVGALDRSLTPRSFM
FT                   TEEQSMLVDWLLEHAEFIPVTARGTEEISRVNIPFSSWAITTHGAVILTPDRQPDAGWQ
FT                   DTVLTNLQPYRDRLIAMESRINDMMAERGLNAWCRINYEYGDTPVYFVMKHRDSTQIAE
FT                   LYAFNDQLESLFSTDGFYIHRNSNNIAWLPVCIEKGLATTYLLDKLRHEHGAFPVLGFG
FT                   DSLSDFSFMRHCHWFGMPAKSQFSQALTSHLFDNTTFNKNNVNGDNDA"
FT   gene            complement(663547..664683)
FT                   /locus_tag="YpAngola_A0660"
FT   CDS_pept        complement(663547..664683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88329"
FT                   /protein_id="ABX88329.1"
FT                   /translation="MMTTQPPVYRRELSGGTLTVIPNSSNIPLDSLFDIAERRNPKRAF
FT                   LFVSKVLGRHIPVSPATMRNVYRQLAERFPADLPGPVLFIGMAETAVGLAAGVFQELRG
FT                   TVAEPVFLTSTRHPVDGDLLCEFKENHSHATDHLLYLPSDPVLRARLQRARSVVLIDDE
FT                   ATTGNTFINLLQALRDANLNGLEKVVAVTLTDWSGSALTERCPLPVTTVSLITGEWNWS
FT                   PIPDAPVPVMPACNVTARGKVAITDKQNWGRLGMDETRADIGHKVHVLAGEKVLVLGTS
FT                   EFVWQPFLLAERLEHAGANVKFSSITRSPIAQGHAINSIIAFSDNYGLGIPNFLYNVAH
FT                   QHFDRIIVCVETPAESIDPTLIEQLRTVAPCVEVIAYE"
FT   gene            complement(664695..665753)
FT                   /locus_tag="YpAngola_A0661"
FT   CDS_pept        complement(664695..665753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87023"
FT                   /protein_id="ABX87023.1"
FT                   /translation="MKKNIWFMGGLSSQRDIISGVKNTSELHGNAIQVFASHHQHRYEI
FT                   LEKADVAFIEPSDLDTKMAFIRHIVKAFDIEAIHTGRSCLWFEQHRAAIEGLGVKLTTG
FT                   AQCPATFTLADNKVEYAAYMAQKGLPVVPSIQIASPDELREWLANPPFDTEKLCIKPVT
FT                   GIYGMGFWKLDQSISAMDCFDRTDNRVVHPDLLAALERTEKMQPMVLMPYLPGPESSVD
FT                   MLVEKGKVIAAVARRKEGSVQHLHQSGAAFELAKSSAELMQADGLVNVQTRCDHHGQPL
FT                   LLEINLRPSGGIDYTRHSGVNLPGLFALRQLDLMSQDEVSSQAVAHFKPVSVRAMTDAL
FT                   PFPAELQNLTHF"
FT   gene            665996..666622
FT                   /gene="terZ"
FT                   /locus_tag="YpAngola_A0662"
FT   CDS_pept        665996..666622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terZ"
FT                   /locus_tag="YpAngola_A0662"
FT                   /product="tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85815"
FT                   /protein_id="ABX85815.1"
FT                   /translation="MFNNFILKGNVMISLSKNQTISLAKESSALSRVQFGLGWDPVKKK
FT                   KSFLGGLFGGGSASDSIDLDASCVMLSQAGKPVDTVSFRHLTSKCRSVQHTGDNLTGEG
FT                   DGDDEVINVDLSRLPAEVEYLAFTVNSFRGQTFNEVENAFCRVVDQTGKELARYVLTEQ
FT                   GSHTGIVISSLRRNNGQWDFTAHGRACRGRTIEDMMSEIIETVVR"
FT   gene            666622..667806
FT                   /gene="terA"
FT                   /locus_tag="YpAngola_A0663"
FT   CDS_pept        666622..667806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terA"
FT                   /locus_tag="YpAngola_A0663"
FT                   /product="tellurite resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85548"
FT                   /protein_id="ABX85548.1"
FT                   /translation="MNLMPGGNAPVASQTLTVRVLSGASVDVSAFRLYASGKVRGDTDM
FT                   VFYGQPVTDDSTIRLSGQGVNTAFSVNLQAINHDVQKIAFTATCDGNQTLSQLGNLSIQ
FT                   VELNGSVLMKGDVETQGRQEAALILGELYRRNTEWKFRFVAQGFNGGLKPLAEHFGVVV
FT                   EDEPAAPTPVPTPVSTPAPTAPPVAKPINLSKVSLTKEKPVISLTKRDDFGEIRVNLNW
FT                   HRGGGAPAKGFLQGIFNSNKGIDLDLGAFVALNDGSRGVIQALGNNFGSYHSEPYVQLQ
FT                   GDDRTGDVSDGEWMHINGREWKHVKEVLIFAFIYEGVPSWGSTDGIVTINVPGQAPIET
FT                   QMNEGNDRKNMCAVARLVNESGNIKVERINRYFSGHKEMDEAFGWGFRWKAGSK"
FT   gene            667839..668294
FT                   /gene="terB"
FT                   /locus_tag="YpAngola_A0664"
FT   CDS_pept        667839..668294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terB"
FT                   /locus_tag="YpAngola_A0664"
FT                   /product="tellurite resistance protein"
FT                   /note="identified by match to protein family HMM PF05099"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85011"
FT                   /protein_id="ABX85011.1"
FT                   /translation="MSFFNKVKNAISAGRTELTNQVGRFKNRKFMEGTVAVCAHISMAS
FT                   NGAGPEEKQKMIMFIKQSPELSVFDTNEVIEFFNKLVTSYEFDADIGKGEAMKYIMALK
FT                   SQPEAAQLALRVGIAVAKSDGVFDEMEEAAAREICVTLGFVPADFQL"
FT   gene            668316..669353
FT                   /gene="terC"
FT                   /locus_tag="YpAngola_A0665"
FT   CDS_pept        668316..669353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terC"
FT                   /locus_tag="YpAngola_A0665"
FT                   /product="tellurite resistance protein"
FT                   /note="identified by match to protein family HMM PF03741"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88557"
FT                   /protein_id="ABX88557.1"
FT                   /translation="MESTHIGFPIETVAVFILLSVGAICIDLFMHRHDKPISLKSAALW
FT                   SLFWVAIAFVFAGFLYLHHGAEAASLFVTGYALEKVLSIDNLFVMMAIFSWFAVPDRLR
FT                   YRVLYWGIIGAIVFRGIFVAIGTGLLMLGPWVEVVFAIVVAWTAVMMLRKGDDDDAIED
FT                   YSQHIAYRLVKRFFPIWPKLRGNAFILSQKEVDAELAKPENADVQVGRKGGVARYATPL
FT                   MLCLAVVELSDVMFAFDSVPAVIAVSREPLIVYSAMMFAILGLRTLYFVLEALKQYLVH
FT                   LEKAVIVLLFFIAAKLGLNASDHFFNHGYDISANVSLFVVIGVLAIGIVASFLFPEKDS
FT                   KEGQH"
FT   gene            669417..669995
FT                   /gene="terD"
FT                   /locus_tag="YpAngola_A0666"
FT   CDS_pept        669417..669995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terD"
FT                   /locus_tag="YpAngola_A0666"
FT                   /product="tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88005"
FT                   /protein_id="ABX88005.1"
FT                   /translation="MGVSLSKGGNVSLSKEAPTMTNVLIGLGWDARSTDGQDFDLDASA
FT                   FLLTANGKVRNDADFIFYNNLKSSDGSVMHTGDNRTGEGEGDDESLKIKLPLIPADVDK
FT                   IVFVVTIHDAQARRQSFGQVANAFIRLVNDDNGVEIARYDLSEDASTETAMLFGELYRH
FT                   NAEWKFRAVGQGYAGGLSSVCAQYGINAS"
FT   gene            670179..670754
FT                   /gene="terE"
FT                   /locus_tag="YpAngola_A0667"
FT   CDS_pept        670179..670754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terE"
FT                   /locus_tag="YpAngola_A0667"
FT                   /product="tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87716"
FT                   /protein_id="ABX87716.1"
FT                   /translation="MAVSLVKGGNVSLTKEAPTMNIAVVGLGWDARVTDGSEFDLDASV
FT                   FMVGENGKVLSDQHFIFFNNKVSPCGSVVHQGDNRTGAGDGDDEQIKIDLKKVPADVKK
FT                   IIFSVTIYDAEARKQNFGMVSNSFMRVVNEDNSAEIARFDLSEDASTETAMIFGELYRN
FT                   NDEWKFKAVGQGFAGGLSALASQHGVSV"
FT   gene            670895..671404
FT                   /locus_tag="YpAngola_A0668"
FT   CDS_pept        670895..671404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0668"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86366"
FT                   /protein_id="ABX86366.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            672177..672815
FT                   /locus_tag="YpAngola_A0669"
FT   CDS_pept        672177..672815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0669"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06551"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85845"
FT                   /protein_id="ABX85845.1"
FT                   /translation="MKKPLTQIAILSSLVVSISAASAAVPTAELKVVGTMTVPSCTVVS
FT                   PDAGIYDIGKLSSSLVKPGTTVTVLAQINKTWTVNCDANTYLNFTPVDNRVGSSSDGSA
FT                   AAFGLGKINDTGKIGYYTVQMRNATVDGKKSGVFTASSASFSQADTSYLNRGQRTGWAA
FT                   GANTQNSGKVFVADLLVTPVLAGTNTMNGAITEDAKIDGSLTMNFAFGI"
FT   gene            673066..675444
FT                   /locus_tag="YpAngola_A0670"
FT   CDS_pept        673066..675444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0670"
FT                   /product="fimbrial usher protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85472"
FT                   /protein_id="ABX85472.1"
FT                   /translation="MVARCINLQCIAFLFSFFPTLAFPVTEKGEVVFDIETLERLGYSA
FT                   ELAKFFSGQDRFLPGQHDVTIIINASKTYRIAATFDSEGKLCMDKALLMALKLRNTESD
FT                   GSCENMEARWPGMVVKLFPGQFRVEITLPQEAFDPEMEGSEYQQGGHALLLNYNIFGQR
FT                   VESNNSRFNLVQGQFEPGINFKNWVLRNRGSYSYNQGVSQYYNQETSALRAVESLKSVV
FT                   QLGEFGLVGNTFSGLPVTGIQLYSDNAQRDDTQLIVPIEGIANTNATIEIRQRGRVIYR
FT                   TIVAPGPFSLSNISNFSSGVNTDVSIIEEDGTQQNFTVTSALDINAEQQASIYQLAVGR
FT                   YRDMFTGEDRPSPLLLSGEMSFNPAATFYMTSAGLLSSGYQNIRVQNLYSGWDQAWFSA
FT                   AASYANTKDAGQGYQFSVQNQMTINGNFGVSWSSVYGSANYWLPDDALSSSNNLNDLMF
FT                   GKLKNATSVAVSWVHPRWGAFSYALSNNMYYQASGRTYHIFSISEQFGRATTILSSQLS
FT                   SQGQNSLYVGINMPLGNGTLSGRVQRNNGNVALGSTYQGRWGDNKDYSVGISGDNRQRR
FT                   INGSMNIRTAYSQLTGGVSQATNNSRSAYLSSRGSVAYVNNTFATSSSSVGDTFAVVNI
FT                   PNQPGLRVSSPSSGIAITDYAGIALLPLVRPYTASKVQISTQTLPLNIRLNNTSADLLM
FT                   TRGSVATHHFETTETRQLLLTIRGSDGEMLPIGANVLDEKGNFLGTIIGDGNFMLENKA
FT                   IGVTLRVKANNRDECRVNYREPEKFDPDVLYEVADAVCQ"
FT   gene            675516..676259
FT                   /locus_tag="YpAngola_A0671"
FT   CDS_pept        675516..676259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0671"
FT                   /product="putative gram-negative pili assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85184"
FT                   /protein_id="ABX85184.1"
FT                   /translation="MQNFPTHHRDIGATIIYVNSVNRFNIFFVFTLLILLSSWSAVSYA
FT                   SFKLESTTVILQESEARTSFTIDNISSNPILLVTKLTDLDGKSFSKQILISPPVTRINA
FT                   GQSQQVNFVLKKGSVLNNEVLLKASFEGVEQVPGNAAVMPIRQEIGFLIQPSAVPQIRM
FT                   PWQTLVFSISGNNLVIKNPGKHVVRLGPQIILVPSNEVVALGNPYIMPETSKLFPITSS
FT                   PTAVKVTPLSRYGFVQTEVTLPVTR"
FT   gene            676270..676524
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0672"
FT                   /note="putative membrane protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            677030..677152
FT                   /locus_tag="YpAngola_A0673"
FT   CDS_pept        677030..677152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0673"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86015"
FT                   /protein_id="ABX86015.1"
FT                   /translation="MKFTYTFNNIWLSRLLYEISYKSMWRVIFLVTVLVVFCYI"
FT   gene            677718..679034
FT                   /locus_tag="YpAngola_A0674"
FT   CDS_pept        677718..679034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0674"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85432"
FT                   /protein_id="ABX85432.1"
FT                   /translation="MHTENNSPSGLIPLPDWYPVAFSHLDAMEYASVTRLWHHEPVLRD
FT                   LVDELDKRNPGLITFTHCPHCHSADICPGTRPEEYRCRTCHRCSSPYTHIPFFDLHHAR
FT                   HSRLYAVLVTLWGTWQVEDAAWLSDCKSKQIWKQYCHRLKPILALIGGRAVTHTPRYLR
FT                   GFTPGQQGLHCPACASTQLVYSETMPVGNPEVHCQVCQTDFVMYPDIPKGIDPFAVNTP
FT                   QYDIPLPRWFSRLFSHASQAQYQHLREVWQREPVLREAVDRLDAQNPEQGAVYACPYCQ
FT                   NKHISPRKTASSIEGYYCPACDNPFTATTGTVFTRMRQEHFWRLYAVLVMLWTQWRPTQ
FT                   IFELCQLRSVHPFLTYHKRLAPLLAEFDGAPITPYPRNLLGFTPGQQGVCCVYCQSTKL
FT                   ITEGITVMPLDNPYICCLDCGQRFMLRVWRKQVKSNEKK"
FT   gene            679629..679754
FT                   /locus_tag="YpAngola_A0675"
FT   CDS_pept        679629..679754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0675"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88572"
FT                   /protein_id="ABX88572.1"
FT                   /translation="MFTQKIKNGKTKTQRGKMDILTIDSTGKHIIFMAKNNILNT"
FT   gene            680043..682100
FT                   /locus_tag="YpAngola_A0676"
FT   CDS_pept        680043..682100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0676"
FT                   /product="putative oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF00041;
FT                   match to protein family HMM PF01565; match to protein
FT                   family HMM PF02839; match to protein family HMM PF08031"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88369"
FT                   /protein_id="ABX88369.1"
FT                   /translation="MKIIDKNVSTYETLQKGFNLRWPPNVEQGAETIYICTTPDEVFAA
FT                   TNTALAAGNRITVRSGGHCYEGFVSNKLSTERLSIIDLGEMSGLDYDEDKTITSLWDAN
FT                   KNTYRFKSLTGNQNWNGYVSLYKRSGRTIPGGSCYSVGVGGHISGGGYGLLSRLHGLTV
FT                   DWVTGVDILVPVGNAHRLAFRHVRADSVSEVDRELLMACCGAGGGNFGIIIAYYFDDLP
FT                   KAPQKAYWIPLTYPWSSLKATFPAFLKAYWQWFADNDVNATSTKEGVGNGGLFTLLKLN
FT                   HIDASDNVVLAIQYTGPNGQVGGANDIPLNDFIEKMNAAAGMTPTIYDDFILPNIPPFK
FT                   HLYPGRKIGRTVDESASMDWLHVTQMINGSGSNQRGKYKSDYQIKQFSDEMCHALLTHL
FT                   TTATADKRFNQSLVQIDSYGGAINSRGIGATAVSQRNSLLKAQYQTYWTNEADDQTHLT
FT                   WIRNIYAAVHNGKPAPPEFEGCYINYPDIDMKYTDSGEEDPNWLNLYYGWDTQLIKRLI
FT                   ALKARIDPNNIFHHELSIPLVTELPKAPVNLHSTGQTTTSISLMWGSSIGALPVASYAI
FT                   YRDGHEVKLLNGTQTSAEDAGLQPNTEYRYFVAAGDEHGNLSVPSNVLTVSTQGTHPAW
FT                   VLNGSYAVGDVVSNLGKLWRCIQSHVAYDPLWAPGTNGGITLWAGYTAGR"
FT   gene            complement(682444..686230)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0677"
FT                   /note="outer membrane autotransporter barrel domain
FT                   protein; this gene contains a frame shift which may be the
FT                   result of sequencing error; identified by match to protein
FT                   family HMM PF03797; match to protein family HMM TIGR01414"
FT   gene            687061..687585
FT                   /gene="ubiC"
FT                   /locus_tag="YpAngola_A0678"
FT   CDS_pept        687061..687585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiC"
FT                   /locus_tag="YpAngola_A0678"
FT                   /product="chorismate--pyruvate lyase"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by match to protein family HMM PF04345"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86341"
FT                   /db_xref="GOA:A9QYL0"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYL0"
FT                   /protein_id="ABX86341.1"
FT                   /translation="MFIGDASILKPIQWCATEHPELPADIADWLMELGSMTRRFEQHCQ
FT                   RVHVEPQRECFITRDALGEEAEHLPVSQRYWLREIVLFGDNVPWLLGRTVIPEETLSGP
FT                   DRALVDLGTLPLGRYLFSGDALTRDYIHVGRQDNLWARRSLLRLSGNPLLLTEVFLPAS
FT                   PLYTHCDSIPK"
FT   gene            687751..688617
FT                   /gene="ubiA"
FT                   /locus_tag="YpAngola_A0679"
FT   CDS_pept        687751..688617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="YpAngola_A0679"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01474"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85867"
FT                   /db_xref="GOA:A9QYL1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYL1"
FT                   /protein_id="ABX85867.1"
FT                   /translation="MKGSTVHTKWQAYCRLMRIDKPIGSLLLLWPTLWALWLAGRGIPE
FT                   AKILVVFVLGVFFMRAAGCVVNDYADRHIDGFVKRTASRPLPSGTISEKESKILFVVLI
FT                   LLSFGLVLTLNSMTIWLSLAALALAWIYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSE
FT                   SLPLVCWLLLLANICWTVAYDTQYAMVDRDDDLRIGVKSTAILFGQHDKLIIGLLQLAT
FT                   LLLMVAIGWLMNLGGAFYWSILLAGALFTHQQKMIAQREREPCFRAFLNNNYVGLVLFL
FT                   GILISYW"
FT   gene            complement(688811..689320)
FT                   /locus_tag="YpAngola_A0680"
FT   CDS_pept        complement(688811..689320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0680"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85476"
FT                   /protein_id="ABX85476.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(689465..689917)
FT                   /gene="rplI"
FT                   /locus_tag="YpAngola_A0681"
FT   CDS_pept        complement(689465..689917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="YpAngola_A0681"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87703"
FT                   /db_xref="GOA:A9QYL3"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYL3"
FT                   /protein_id="ABX87703.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNVE
FT                   FFEARRAELEAKLADVLAAAEARATKINELVSVTISSKAGDEGKLFGSIGTRDIADAVT
FT                   AAGVEVAKSEVRLPNGVLRTAGEHEVHFQVHSDVFAKLNVVVVPEA"
FT   gene            complement(689957..690184)
FT                   /gene="rpsR"
FT                   /locus_tag="YpAngola_A0682"
FT   CDS_pept        complement(689957..690184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="YpAngola_A0682"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87183"
FT                   /db_xref="GOA:A9QYL4"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYL4"
FT                   /protein_id="ABX87183.1"
FT                   /translation="MARYFRRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARCIKRARYLSLLPYTDRHQ"
FT   gene            complement(690515..690907)
FT                   /gene="rpsF"
FT                   /locus_tag="YpAngola_A0683"
FT   CDS_pept        complement(690515..690907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="YpAngola_A0683"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86372"
FT                   /db_xref="GOA:A9QYL5"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYL5"
FT                   /protein_id="ABX86372.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVK
FT                   AKDERRERHDFASEANDDSEAGDSEE"
FT   gene            complement(691274..692023)
FT                   /locus_tag="YpAngola_A0684"
FT   CDS_pept        complement(691274..692023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0684"
FT                   /product="phospholipase/carboxylesterase family protein"
FT                   /note="identified by match to protein family HMM PF02230"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85714"
FT                   /protein_id="ABX85714.1"
FT                   /translation="MIEMSLENINGIEVIHSAPAGQRQQPLPTIFFYHGYTSSKEVYSY
FT                   FAYAFAQAGFRTISPDADMHGARFNGNETQRLSHFWEILKSNIDELPDLKRHYQQAGLI
FT                   EGERIGVAGASMGGMTALGAFARYPWIRVAADFMGSGYFTSLAHSLFPPRDAGREISQQ
FT                   AFERRLAPLADYELTHQLEKITERPLLVWHGEADDVVPAAESARLVQALRTRGGDNNLT
FT                   YLTEAGIGHKITPTALRAGSDFFTQYL"
FT   gene            complement(692183..692311)
FT                   /locus_tag="YpAngola_A0685"
FT   CDS_pept        complement(692183..692311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0685"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85525"
FT                   /protein_id="ABX85525.1"
FT                   /translation="MAGGGTGVMLKALQPDSPRVSSKKAIVRFIFIIHCLFAAIQA"
FT   gene            692364..692525
FT                   /locus_tag="YpAngola_A0686"
FT   CDS_pept        692364..692525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0686"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84871"
FT                   /protein_id="ABX84871.1"
FT                   /translation="MGTVSAQVYGSPGDVETEIQRRANASGAPYYLIVMISDSVYPGIW
FT                   YANALLYR"
FT   gene            complement(692597..694240)
FT                   /locus_tag="YpAngola_A0687"
FT   CDS_pept        complement(692597..694240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0687"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87840"
FT                   /protein_id="ABX87840.1"
FT                   /translation="MGKGMDWQTHLVFNQPEPLSNSNLFLSDLALREAVVREHAGWDGE
FT                   NLSLIGLQLGSLESLELGRLANAHPPELLRYDGAGQRLGQVRFHPAWHVLMQGLIHHRV
FT                   HNLPWQEDARNGSFVARAARFILHAQVDAGALCPITMTFGAIPLLQQTLPPLFQNWLSP
FT                   LLSDRYDPHLSLGNQKRGLLIGMGMTEKQGGSDVLSNTTRAEPLSIRGQGEVYRLIGHK
FT                   WFFSVPQSDAHLVLAQAEGGLSCFFLPKILPDGTHNAIRLERLKEKLGNCSNASSEVEF
FT                   DNATAWLLGEEGDGIRQILKMGGYTRFDCALGSHGLMRRAFSVALYHALQRQVFGKALV
FT                   EQPLMRQVLSRMALRLEGNTALLLRLARAWEASGEVHEQIFSRLLTPAAKYRVCGQGSA
FT                   FVAEAMEVLGGIGYCEQSELPRLYREMPVNSIWEGSGNIMCLDVLRTLRKLPTAVEMLQ
FT                   QEFYPVRGQNRLFDRAWRQLQQRLKNPKEEQGRALTQQLFDLCCASQLLRFASPRLADA
FT                   WCRMTLDHRDQYMLPEAVCARLLERATGAH"
FT   gene            complement(694393..695172)
FT                   /locus_tag="YpAngola_A0688"
FT   CDS_pept        complement(694393..695172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0688"
FT                   /product="putative transposition helper protein"
FT                   /note="identified by match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87295"
FT                   /protein_id="ABX87295.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(695172..696194)
FT                   /locus_tag="YpAngola_A0689"
FT   CDS_pept        complement(695172..696194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0689"
FT                   /product="transposase for insertion sequence"
FT                   /note="identified by match to protein family HMM PF00665;
FT                   match to protein family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87257"
FT                   /protein_id="ABX87257.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            complement(696607..697347)
FT                   /locus_tag="YpAngola_A0690"
FT   CDS_pept        complement(696607..697347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0690"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86699"
FT                   /protein_id="ABX86699.1"
FT                   /translation="MSEIIYGIHAVKALLERDPQRFLEVFILKGRDDRRLQPLIAELEA
FT                   AGLVIQVASRQWLDSQVEGGVHQGIVARVREGRQYQENDLPALLESVETPFLLVLDGVT
FT                   DPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRV
FT                   LQEHNVWIVGTAGEADHTLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSV
FT                   SSLNVSVATGVCLFEVVRQRGLKA"
FT   gene            697346..697465
FT                   /locus_tag="YpAngola_A0691"
FT   CDS_pept        697346..697465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0691"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85769"
FT                   /protein_id="ABX85769.1"
FT                   /translation="MMLFLHVLADNMTYPPIIKLYAGDKSRPASSTPPLLTDR"
FT   gene            complement(697466..700000)
FT                   /gene="rnr"
FT                   /locus_tag="YpAngola_A0692"
FT   CDS_pept        complement(697466..700000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="YpAngola_A0692"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF00773; match to protein
FT                   family HMM PF08206; match to protein family HMM PF08461;
FT                   match to protein family HMM TIGR00358; match to protein
FT                   family HMM TIGR02063"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86401"
FT                   /protein_id="ABX86401.1"
FT                   /translation="MSQDPFLEREAEKYESPIPSREFILAHLAKRETPASREELANELN
FT                   LTGEEPLEALRRRLRAMERDGQLVFTRRQCYALPERLDLLRGTVIGHRDGYGFLRVEGS
FT                   KDDLYLSAEQMKMAIHGDVVLAQVVGADRKGRREARIVRVLVPKTSQIVGRYFTDAGTG
FT                   FVVPDDSRLSFDILIPAEATCGARMGFVVVVELTQRPTRRTKAVGKIVEVLGENMGTSM
FT                   AVDIALRTHEIPHTWPPQVEKQVADLKEQVPEEAKKGRVDLRDLPLVTIDGEDARDFDD
FT                   AVYCEKKRGGGWRLWVAIADVSYYVRPQTALDDEARSRGNSVYFPSQVIPMLPEVLSNG
FT                   LCSLNPQVDRLCMVCEMTISSQGKLSSYKFYEAVMSSHARLTYTKVWRIIDGEESLREQ
FT                   YKPLVPHLEELHAMYKVLDQARAERGGIAFETEEAKFIFNAERRIERIEPTVRNDAHKL
FT                   IEECMILANIAAARFVEKHEEPALFRVHDRPSDDHIVALRSVLNELGLTLGGGLKPQPK
FT                   DYSVLMDEISDRPDHEMLQTMLLRSMKQAVYDPENRGHFGLALASYGHFTSPIRRYPDL
FT                   AMHRAIKYQLAKEHGNLKDRWTPTGGWHSDFEDMLQLGQHCSMTERRADEATRDVADWL
FT                   KCDFMLDQVGNVFTGIIASVTGFGFFVRLDDLFIDGLVHVSSLDNDYYRYDNIGQRLIG
FT                   ESSGVVYRLGDTVEIRVDAVHMDERKIDFALVSSTRKPRGEGKTARDKAKNNGQRTLRS
FT                   NSAGRGSSSGSSRRDGAPTAGGQKRPRRAKKPVNFEPDSAFRPDAAAAKPDDKALAEKK
FT                   AKAKAKRASAKTKKIAAATKAKRAKKKTTSDQ"
FT   gene            complement(700241..700705)
FT                   /gene="nsrR"
FT                   /locus_tag="YpAngola_A0693"
FT   CDS_pept        complement(700241..700705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nsrR"
FT                   /locus_tag="YpAngola_A0693"
FT                   /product="nitrite-sensitive repressor NsrR"
FT                   /note="identified by match to protein family HMM PF02082;
FT                   match to protein family HMM TIGR00738"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86094"
FT                   /protein_id="ABX86094.1"
FT                   /translation="MGVSRVNGYSGVYVQLTSFTDYGLRALIYMASLPDGQMTSISQVT
FT                   EVYGVSRNHMVKIINQLSRVGLVTAVRGKNGGIRLGKPADQILIGDVVRQMEPLTLVNC
FT                   SSDFCHITPACRLKQVLNQAVQSFLKELDNYTLADMVKDNSPLYKLLLVE"
FT   gene            complement(701035..702333)
FT                   /gene="purA"
FT                   /locus_tag="YpAngola_A0694"
FT   CDS_pept        complement(701035..702333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="YpAngola_A0694"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87502"
FT                   /db_xref="GOA:A9QYM6"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYM6"
FT                   /protein_id="ABX87502.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVISIIGNGVVLAPDALMKEMTELEARGVPVRERLLLSEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVSDLFNKETFAIKLK
FT                   EIVEYHNFQLVHYYKEAAVDYQKVLDDVLAIADILTAMVVDVSELLDNARKQGELIMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPT
FT                   ELNDETGEFLRKQGNEYGATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLK
FT                   EVKLCVGYRMPDGREVDTTPLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQAALNY
FT                   IQRVEELTGVPIDIISTGPDRDETMILRDPFDA"
FT   gene            complement(702433..702645)
FT                   /locus_tag="YpAngola_A0695"
FT   CDS_pept        complement(702433..702645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0695"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87216"
FT                   /protein_id="ABX87216.1"
FT                   /translation="MGQTMNSTILLALGLVLVLEGLGPMLYPKAWRKMIQAMTQLPDAT
FT                   LRRFGGGLVVAGCVIYYMLRSHMGS"
FT   gene            complement(702805..703809)
FT                   /gene="hflC"
FT                   /locus_tag="YpAngola_A0696"
FT   CDS_pept        complement(702805..703809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="YpAngola_A0696"
FT                   /product="HflC protein"
FT                   /note="identified by match to protein family HMM PF01145;
FT                   match to protein family HMM TIGR01932"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88595"
FT                   /protein_id="ABX88595.1"
FT                   /translation="MRKSFLLIVVVVLIALFASLFVVEEGQRGIVLRFGKVLRDSDNKP
FT                   LVYAPGLHFKIPFIETVKRLDARIQTMDNQADRFVTNEKKDLIVDSYLKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLNVRDIVTDSRGRLTSDVRDALNTGSVGDE
FT                   AATTEADDAIASAAARVEQETRGKQPAVNPNSMAALGIEVVDVRIKQINLPAEVSDAIF
FT                   QRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAEAERQARITRGGGDAEAARLF
FT                   AEAFSQDPDFYAFIRSLRAYENSFSSGNDVMVLSPDSDFFRYMKSPDNSSKRP"
FT   gene            complement(703813..705072)
FT                   /gene="hflK"
FT                   /locus_tag="YpAngola_A0697"
FT   CDS_pept        complement(703813..705072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="YpAngola_A0697"
FT                   /product="HflK protein"
FT                   /note="identified by match to protein family HMM PF01145;
FT                   match to protein family HMM TIGR01933"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85416"
FT                   /protein_id="ABX85416.1"
FT                   /translation="MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDI
FT                   FRKLSKKLSSLGGKGSGSGGNGASHGPGFSGRVVGIAVVAVVVIWAASGFYTIKEAERG
FT                   VVTRLGKLSHIVQPGLNWKPTFIDEVVPVNVEAVRELAASGVMLTSDENVVRVEMNVQY
FT                   RVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETI
FT                   RPYQMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQA
FT                   QRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGKTNKVL
FT                   ANDKGNNLMVLPLDQMLRGQGAANKVDGNKDTSLIRLNPAPSSQQTGASNSNTSSGSGS
FT                   IMDQRRVNAQRDTSTRVGRE"
FT   gene            complement(705313..706599)
FT                   /gene="hflX"
FT                   /locus_tag="YpAngola_A0698"
FT   CDS_pept        complement(705313..706599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="YpAngola_A0698"
FT                   /product="GTP-binding protein HflX"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR03156"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84907"
FT                   /protein_id="ABX84907.1"
FT                   /translation="MFDRYEAGEQAVLVHIYFSQNKDTEDLREFEALVSSAGVEALQIV
FT                   TGSRKAPHPKYFVGEGKAEEIADAVKASGASVVLFDHALSAAQERNLERLCQCRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHIATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRDRISLILSRLERVAKQREQGRRARTRADIPTVSLVGYTNAGKSSLFNKITAADV
FT                   YAADQLFATLDPTLRRINVADVGDTVLADTVGFIRHLPHDLVAAFKATLQETRQASLLL
FT                   HIIDAADPRVAENMAAVDTVLAEIEADEIPTLLVMNKIDLLDDFVPRIDRNEDNLPVRV
FT                   WLSAQTGAGIPLLFQALTERLSGEIAHFELRLPPQAGRLRSRFYQLQAIEKEWIDEDGN
FT                   VGMVVRMPIVDWRRLCKQEQELVSYIQNN"
FT   gene            complement(706698..707003)
FT                   /gene="hfq"
FT                   /locus_tag="YpAngola_A0699"
FT   CDS_pept        complement(706698..707003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="YpAngola_A0699"
FT                   /product="RNA chaperone Hfq"
FT                   /note="identified by match to protein family HMM PF01423;
FT                   match to protein family HMM TIGR02383"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86512"
FT                   /db_xref="GOA:A9QYN1"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYN1"
FT                   /protein_id="ABX86512.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE"
FT   gene            complement(707119..708060)
FT                   /gene="miaA"
FT                   /locus_tag="YpAngola_A0700"
FT   CDS_pept        complement(707119..708060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="YpAngola_A0700"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="identified by match to protein family HMM PF01715;
FT                   match to protein family HMM TIGR00174"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85894"
FT                   /db_xref="GOA:A9QYN2"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYN2"
FT                   /protein_id="ABX85894.1"
FT                   /translation="MNDIENLDRPPAIFIMGPTASGKTALSIALRQRLPVELVSVDSAL
FT                   IYRGMDIGTAKPSAQELALAPHRLIDIRDPAESYSAADFRKDALKEMADITAAGRIPLL
FT                   VGGTMLYFKALLDGLSPLPSADPQVRQRIEQQASELGWGALHQQLAVIDPVAAARIHPN
FT                   DPQRLSRALEVFFISGKTLTELTKISGETLPYRVHQFAIAPASRELLHQRIELRFHQML
FT                   DAGFEAEARVLFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYNDMVYRGVCATRQLAKR
FT                   QMTWLRGWSSVQWLDSDKPGEALDSVIQVVSA"
FT   gene            complement(708053..709960)
FT                   /gene="mutL"
FT                   /locus_tag="YpAngola_A0701"
FT   CDS_pept        complement(708053..709960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="YpAngola_A0701"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="identified by match to protein family HMM PF01119;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF08676; match to protein family HMM TIGR00585"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85002"
FT                   /db_xref="GOA:A9QYN3"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYN3"
FT                   /protein_id="ABX85002.1"
FT                   /translation="MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGCGISKDDLALALARHATSKISSLEDLEAILSMGFRGEALASISS
FT                   VSRLILTSRTAEQSEAWQAYAEGRDMAVTIKPAAHPVGSTLEVLDLFYNTPARRKFMRT
FT                   EKTEFGHIDEVVRRIALARFDVAINLNHNGKLIRQYRAAPDPAQHERRLASICGPAFLQ
FT                   HALAIAWQHGDLNIHGWVADPAASHTLSEMQYCYVNNRMMRDRLINHAIRQAYQDRLND
FT                   AQQPAYVLYLDIDPHQVDVNVHPAKHEVRFHQARLVHDFIYQAVTAVLQQTNAPILNIS
FT                   EEGEVDAPRWQQENRVAAGTNKYAQPEAAKSSAAEQAVARERSSARERAALAYKEDHPY
FT                   QKQQGELYRQLLQPSAAAKPATSPAAIPASSVSSPSIPVQRITQAEEPLHGDNYSFGRV
FT                   LTVFPPCYALIEYQGGVALLSLAVAERWLKQAQLSPPEEGLRPQPLLIPLKITLDKNEI
FT                   AACQNHEKLLITMGIELSVEQGRATLRAVSLPLRQQNLQKLIPELLGYLSQHEEISPDT
FT                   LATWLARHLGSEHEVWNVSQAIQLLTEVERLCPQLVQSPPAGLLQPIDIKAALATLTHE
FT                   "
FT   gene            complement(709976..711871)
FT                   /locus_tag="YpAngola_A0702"
FT   CDS_pept        complement(709976..711871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0702"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 3"
FT                   /note="identified by match to protein family HMM PF01476;
FT                   match to protein family HMM PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85388"
FT                   /protein_id="ABX85388.1"
FT                   /translation="MMHSLSLICRWKHGFATIRHFTTVHRVITARRFATVTRMIIGLLT
FT                   LSLFALPPAFAMKLTDIKVTNGASESKVTLSFDGKPIYAFFSLNSPERVVLDVRQSGNI
FT                   SGLPLEFSGQNLLKRIRSSTPKDEQSTRLVLELTQKVKTRAVTQQSGNNYTVVLTMTAV
FT                   ASAPVRQAQASLNQTNTPSPNAGRVVPQVTSKDSVAKNPFNNKPVVVVSSENVTTNTAR
FT                   PIKTVSAANSSRVVVAIDAGHGGQDPGAIGQNGLKEKNVTISIARRLEALLNRDPMFKP
FT                   VLTRNGDYFISVMGRSDVARKQGANVLISIHADAAPNRSATGASVWVLSNRRANSEMGN
FT                   WLEQHEKQSELLGGAGDVLANTASDPYLSQAVLDLQFGHSQRVGYDVATKVLRELQTVG
FT                   DIHKRKPEHASLGVLRSPDIPSLLVETGFISNSTEERLLGSSAYQEKIAQAIYKGLRSY
FT                   FLANPLQSDPKVESRPLIETAAVDSSTQRSGISQPEPIVNNISSNAQSGRSSATLPAGK
FT                   SKIHNVQRGETLSGIASQYGVSMAVLRQNNTLKNDVVWVGQRLKVPASGSTVTAVKPKT
FT                   AAVAKSKPIKHQVKRGDTLSAIAARYGVSMSEIERVNKIKSGNVQLGQTLTIPQS"
FT   gene            complement(711879..712349)
FT                   /locus_tag="YpAngola_A0703"
FT   CDS_pept        complement(711879..712349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0703"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88383"
FT                   /protein_id="ABX88383.1"
FT                   /translation="MKELVLLLPDEAATVALGATLAQAFGGASVIYLFGDLGAGKTTFS
FT                   RGFLQALGHNGHVKSPTYTLVEPYTLTPRPVYHFDLYRLADPEELEFMGIRDYFDPQAI
FT                   CLVEWPQQGAGFLPQADVELHLTYQAAGREARLVAISEAGADVLRRLAAVQG"
FT   gene            complement(712360..713874)
FT                   /locus_tag="YpAngola_A0704"
FT   CDS_pept        complement(712360..713874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0704"
FT                   /product="YjeF family protein"
FT                   /note="identified by match to protein family HMM PF01256;
FT                   match to protein family HMM PF03853; match to protein
FT                   family HMM TIGR00196; match to protein family HMM
FT                   TIGR00197"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87024"
FT                   /protein_id="ABX87024.1"
FT                   /translation="MTDHSKKQTRVSLPHSVFSADWVRQNEAAAAAHFSLTLFDLMVRA
FT                   GNAAFELAHKQYPIARHWLILCGHGNNGGDGYIVANRALAAGIDVTLIACPGNRPLPAE
FT                   AKEAQSQWLAIGGVIHQPDTQWPQDIDLIIDGLLGIGLRAAPQGIYETLIDMANRHRAA
FT                   KVALDIPSGLCADNGAALGSVLRADHTLTFVALKPGLLTGQARDWVGQLHYDDLGLATW
FT                   LDTQSAQIERITADHLPQWLKPRRPCAHKGDYGRLLLVGGDRGFGGAIRMAGEAAIRSG
FT                   AGLVRVLTHFEHVAPILAARPELMVQALTAETLEQSMQWADVLVVGPGLGQSDWSRNAL
FT                   KRLQQSDKPTLWDADALNLLALNPHRRQNWVLTPHPGEAARLLGCRVVDIESDRLLSAR
FT                   NIVKQYGGVVVLKGAGTLIANEQGEMAIADVGNAGMASGGMGDILSGIIGGLIAQKLAL
FT                   YDAACAGCVVHGVAADKLAEVQGTRGLLATDLLPVIPKYINPELAK"
FT   gene            713873..715108
FT                   /locus_tag="YpAngola_A0705"
FT   CDS_pept        713873..715108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0705"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF08331; match to protein
FT                   family HMM TIGR00276"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87687"
FT                   /protein_id="ABX87687.1"
FT                   /translation="MAHPLDLNQLAQHIKQWGQSLGFQQVGICDTDLTAEEPRLQAWLD
FT                   KQYHGEMAWMARHGMLRARPHELLPGTLRVISVRMNYLPAKAAFASTLNNPELGYVSRY
FT                   ALGRDYHKLLRQRLKKLGDQIQHYCLEQNNLDRHDLELHDLEQHDSERQGQPEQHTASE
FT                   INFRPFVDSAPIMERSLAAKAGIGWVGKHSLILNRDAGSWFFLGELLIDLPLPVDKPQE
FT                   EQCGRCVACMTTCPTGAIVAPYTVDARRCISYLTIELEGAIPEEFRPLMGNRIYGCDDC
FT                   QLICPWNRFSQLTDEDDFSPRAVLHTPQLLDLFAWNEEKFLRVTEGSAIRRIGHLRWLR
FT                   NISVALGNAPYLDSIVLALETRRGLHPMLDEHIEWAISQQLARRATQAVEVQLPQKKRL
FT                   IRAIEKGLPRDA"
FT   gene            complement(715420..715495)
FT                   /locus_tag="YpAngola_A0706"
FT   tRNA            complement(715420..715495)
FT                   /locus_tag="YpAngola_A0706"
FT                   /product="tRNA-Gly"
FT   gene            complement(715586..715663)
FT                   /locus_tag="YpAngola_A0707"
FT   tRNA            complement(715586..715663)
FT                   /locus_tag="YpAngola_A0707"
FT                   /product="tRNA-Gly"
FT   gene            complement(716220..716765)
FT                   /gene="orn"
FT                   /locus_tag="YpAngola_A0708"
FT   CDS_pept        complement(716220..716765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="YpAngola_A0708"
FT                   /product="oligoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86159"
FT                   /protein_id="ABX86159.1"
FT                   /translation="MAENQNNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPV
FT                   LAVHQSAEQLGLMDEWNVRTHTGSGLVERVKASPFNDRDAELQTIEFLKQWVPAGVSPI
FT                   CGNSVGQDRRFLFRYMPELEAYFHYRYVDVSTLKELARRWKPEILAGFKKQNTHQALDD
FT                   IRESVAELAYYREHFIQS"
FT   gene            716964..718016
FT                   /gene="rsgA"
FT                   /locus_tag="YpAngola_A0709"
FT   CDS_pept        716964..718016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsgA"
FT                   /locus_tag="YpAngola_A0709"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="identified by match to protein family HMM PF03193;
FT                   match to protein family HMM TIGR00157"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85307"
FT                   /db_xref="GOA:A9QYN9"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYN9"
FT                   /protein_id="ABX85307.1"
FT                   /translation="MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVIS
FT                   RFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTS
FT                   VLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDL
FT                   LDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSL
FT                   LNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPE
FT                   QITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
FT                   PRKTSDSDEK"
FT   gene            718341..719222
FT                   /gene="psd"
FT                   /locus_tag="YpAngola_A0710"
FT   CDS_pept        718341..719222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="YpAngola_A0710"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="identified by match to protein family HMM PF02666;
FT                   match to protein family HMM TIGR00163"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85735"
FT                   /db_xref="GOA:A9QYP0"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYP0"
FT                   /protein_id="ABX85735.1"
FT                   /translation="MLDSIKIKLQYLLPKQGLTQLAGWGANKQGGWLTQLVIKAFARYY
FT                   KVDMKEAQDPEFSAYRTFNEFFVRPLRAGVRPVVAEENLLAQPADGAISQLGAIREGQI
FT                   LQAKGHNYSLEALLAGNYLLAAEFQNGQFVTTYLAPRDYHRVHMPCDGVLREMIYVPGD
FT                   LFSVNPLTAANVPNLFARNERVICIFDTAFGPMAQILVGATIVGSIETVWAGTITPPRE
FT                   GVIRRWTYPQAGCEGAITLEKGQEMGRFKLGSTVINLFAEGKVYFAPQLNSGAVTRMGE
FT                   VLAEAVPTTPSY"
FT   gene            719264..722605
FT                   /locus_tag="YpAngola_A0711"
FT   CDS_pept        719264..722605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0711"
FT                   /product="mechanosensitive ion channel domain protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85471"
FT                   /protein_id="ABX85471.1"
FT                   /translation="MRPIISWSFGLLLSFFLLMPLHAATQPNEEQVRQELKLAESNKTT
FT                   PNQAEIVQALQGALSWLADAKESDIRAQQYQKAIDDFPKLTRELRQQLAQEGDKPLPVP
FT                   SNLSTSDLEQQVLQVSSQLLELNRLSQQEQDRAREISESLGQLPQQQSEARRMLAEIGP
FT                   RIQSQSNPSTPVAQAQLTLLQAEAVARKAKVNELELSQLSANNRQELSRLQVELYKKRE
FT                   ARVQAQLQSLRNNLNNQRQQAAEQALERTELLAEQGGDLPESITQQLQRNRELSQALNQ
FT                   QVQRIDLISSQQRQAVAQTQQVRQALNTIREQAQWLGVSTALGETLRAQVARLPEMPKS
FT                   QQLDRDMAQLRVQRLQYEDMLEKLQQQKTTLKQDDGTPLTPDQQRILDAQWRTQSELLN
FT                   SLLSGYDTQILELTKLKVANSQLVDALNGVREATHRYLFWVADVSPISLSYPLAVAQDL
FT                   TRLLSLDTLSQLSGAFVMMMTNQETLLPIIAALLFVGFSVSSRRHYHAFLERASSRVGK
FT                   VTQDHFSLTLRTVFWSILMALPLPVLWAALGYGLQNAWSYPMAIAIGNAVTATVPVLWV
FT                   FMISASFAHPHGLFITHFRWSPTQVARAMRFYRLSVWLIVPLMMALITFENYNDREFAG
FT                   TLGRLCFILLCIALSLVTNSLKRAGIPLYLDKKGSGENMINVALWGLLLSAPLIAALAS
FT                   ALGYLTTSQALLARLETSVAIWFFLLVVYHIIRRWMLIQRRRIAFDRAKQRRADILAQR
FT                   ARGEEDSPHSNSTEGSIDVEEPIIDLDVISAQSLRLVRSILTMIALVSVIVLWSEIHSA
FT                   FGFLENIRLWDVSSTINGIESVQPITMGSLLIAVLVLIITAQLVRNLPALLELALLQHL
FT                   DLTPGTGYAISTITKYLVILFGGLLGFSLLGIEWAKFQWLVAALGLGLGFGLQEIFANF
FT                   VSGLIILFEKPIRIGDTVTIRDLTGSVTKINTRATTISDWDRKEIIVPNKAFITEQFIN
FT                   WSLSDSITRVVLTVPAPAETSSEEVTNVLMTAAQRCTLVLDTPPPEVYLVDLQQGIQIF
FT                   ELRIYAAEMGHRMPLRHEIHQLILAGYREHGITLPFPPFQARLETLGRGTGRTISSGRS
FT                   RTPGSL"
FT   gene            complement(722726..723703)
FT                   /gene="genX"
FT                   /locus_tag="YpAngola_A0712"
FT   CDS_pept        complement(722726..723703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="genX"
FT                   /locus_tag="YpAngola_A0712"
FT                   /product="lysyl-tRNA synthetase homolog GenX"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF00587; match to protein
FT                   family HMM TIGR00462"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87837"
FT                   /db_xref="GOA:A9QYP2"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYP2"
FT                   /protein_id="ABX87837.1"
FT                   /translation="MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQ
FT                   ATVTDIHLVPFETRFVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEA
FT                   GRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLS
FT                   AEKAQLREVAAKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASL
FT                   AEISTEDHRVAERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDM
FT                   NLIAALKQGLPDCSGVALGVDRLVMLALNAERLSDVIAFPVNIA"
FT   gene            complement(723863..724054)
FT                   /locus_tag="YpAngola_A0713"
FT   CDS_pept        complement(723863..724054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0713"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86126"
FT                   /protein_id="ABX86126.1"
FT                   /translation="MSHYSLGILNIIIPLTYFSAVNLMILRIAISYFLYGIIILNDKSQ
FT                   KFDVIDCFVLFEPPQMHY"
FT   gene            724161..725984
FT                   /gene="frdA"
FT                   /locus_tag="YpAngola_A0714"
FT   CDS_pept        724161..725984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdA"
FT                   /locus_tag="YpAngola_A0714"
FT                   /product="fumarate reductase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF02910; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR01176;
FT                   match to protein family HMM TIGR01812"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0714"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85770"
FT                   /protein_id="ABX85770.1"
FT                   /translation="MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQDHDTFDYHFHDTVAGGDWLCEQDVVDHFVHSCPEEMAQLEIWGCPW
FT                   SRKEDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILV
FT                   DEGQARGVVAMNMMEGTRVQIRANAVIMATGGAGRVYRYNTNGGIVTGDGMGMAFHHGV
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGMGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRAGRTVATPRGDVVYLDLRHLGEKKLLERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETNPQCETRIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRVAGEQAALRAMESGPANGSALDAQTRDVETRLSNLMKQEGTENWSKIRDEMGL
FT                   SMEEGCGIYRTPELMQKTVDKLAELKERFKRVKITDHSSVFNTDLLYTIELGYGLDVAE
FT                   CMAHSALNRKESRGAHQRLDEGCTERDDVNFLKHTLAFHTPGGAPRIEYSDVKITKLVP
FT                   AKRVYGGEATAQDAKDAKDAQDLKDKEQAND"
FT   gene            725977..726711
FT                   /gene="frdB"
FT                   /locus_tag="YpAngola_A0715"
FT   CDS_pept        725977..726711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdB"
FT                   /locus_tag="YpAngola_A0715"
FT                   /product="fumarate reductase, iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00111; match to protein
FT                   family HMM TIGR00384"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85248"
FT                   /protein_id="ABX85248.1"
FT                   /translation="MTDMKVLKMEVMRYNPERDSEPHFETFEVPYDEQTSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLREYTAGMKVEALGNFPIERDLV
FT                   VDMTHFIESLEAIKPYIIGNERLPKDGPNKQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGKKERMPQLNGKNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKIDSAKDFMIAMLKPQ"
FT   gene            726728..727120
FT                   /gene="frdC"
FT                   /locus_tag="YpAngola_A0716"
FT   CDS_pept        726728..727120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdC"
FT                   /locus_tag="YpAngola_A0716"
FT                   /product="fumarate reductase, C subunit"
FT                   /note="identified by match to protein family HMM PF02300"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88314"
FT                   /db_xref="GOA:A9QYP6"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYP6"
FT                   /protein_id="ABX88314.1"
FT                   /translation="MTTKRKAYVRTMAPNWWQQLGFYRFYMLREGTSIPAVWFSVLLIY
FT                   GVFSLKSGPAGWEGFVSFLQNPLVLFLNILTLFAALLHTKTWFELAPKAVNIIVKSEKM
FT                   GPEPMIKALWVVTVVASAIILAVALL"
FT   gene            727137..727493
FT                   /gene="frdD"
FT                   /locus_tag="YpAngola_A0717"
FT   CDS_pept        727137..727493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdD"
FT                   /locus_tag="YpAngola_A0717"
FT                   /product="fumarate reductase, D subunit"
FT                   /note="identified by match to protein family HMM PF02313"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87734"
FT                   /protein_id="ABX87734.1"
FT                   /translation="MNQVPKRSDEPIFWGLFGAGGMWGAIIAPVIILLVAILLPLGAFP
FT                   GDALSYERILAFCQSFIGRVFLLLMIILPLWCGLHRIHHAMHDLKIHVPAGKWVFYGLA
FT                   AILSVVTFIGVLTL"
FT   gene            complement(727658..728119)
FT                   /pseudo
FT                   /gene="sugE"
FT                   /locus_tag="YpAngola_A0718"
FT                   /note="quaternary ammonium compound-resistance protein
FT                   SugE; this gene contains a frame shift which may be the
FT                   result of sequencing error; identified by match to protein
FT                   family HMM PF00893"
FT   gene            complement(728219..728785)
FT                   /gene="efp"
FT                   /locus_tag="YpAngola_A0719"
FT   CDS_pept        complement(728219..728785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="YpAngola_A0719"
FT                   /product="translation elongation factor P"
FT                   /note="identified by match to protein family HMM PF01132;
FT                   match to protein family HMM PF08207; match to protein
FT                   family HMM PF09285; match to protein family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86595"
FT                   /db_xref="GOA:A9QYP8"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYP8"
FT                   /protein_id="ABX86595.1"
FT                   /translation="MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRR
FT                   LLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGDNG
FT                   KWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVK
FT                   VPLFVQVGEIIKVDTRSGEYVSRVK"
FT   gene            728845..729849
FT                   /locus_tag="YpAngola_A0720"
FT   CDS_pept        728845..729849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0720"
FT                   /product="iron-sulfur cluster-binding protein, KamA family"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00238"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86121"
FT                   /protein_id="ABX86121.1"
FT                   /translation="MPIREDWLQQLADVITDPDELLRILFLNEHPHLQQGSGARRLFPL
FT                   RVPRAFVARMQPGNASDPLLLQVLTAREEFITAPGFTHDPLDEQRSVVPGLLHKYRNRA
FT                   LLLVKGGCAVNCRYCFRRHFPYQDNQGNKANWLQALDYIRQHPELDEIIFSGGDPLMAK
FT                   DHELSWLLDQLEDIKHIRRLRIHTRLPVVIPARITATLCQRLGSSRLQVLMVTHINHAN
FT                   EIDPPLRDSMARLKQAGVTLLNQSVLLRGVNNDADVLATLSNALFDAGILPYYIHVLDK
FT                   VQGAAHFMVDDDEARQLMKGLLSRVSGYLVPRLTREVGGEPSKTPLDLRLTQN"
FT   gene            complement(730134..730532)
FT                   /locus_tag="YpAngola_A0721"
FT   CDS_pept        complement(730134..730532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85559"
FT                   /protein_id="ABX85559.1"
FT                   /translation="MRINVLLRSHILLKSNVLLKIKTLLGLSAVLVLAGCSSSNTLSSA
FT                   GEQVKFSDTQPGSECQLVGQVTGTQSNWLSGQGGESSSMRGAANDLRNKAAAMGGNVIY
FT                   GATSPSETFLSSFAPLESKMVGQVYKCP"
FT   gene            complement(731156..732802)
FT                   /gene="groL"
FT                   /locus_tag="YpAngola_A0722"
FT   CDS_pept        complement(731156..732802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="YpAngola_A0722"
FT                   /product="chaperonin GroL"
FT                   /note="identified by match to protein family HMM PF00118;
FT                   match to protein family HMM TIGR02348"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85310"
FT                   /db_xref="GOA:A9QYQ1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYQ1"
FT                   /protein_id="ABX85310.1"
FT                   /translation="MAAKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFG
FT                   SPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIA
FT                   QAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTAGTVISEEIGLELEKTTLEDLGQAKRVVINKDTTIIIDGVGDEA
FT                   AIQGRVAQIRQQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALIRAAHAIAGLKGDNEDQNVGIKVALRAMESPLRQIVVNA
FT                   GEEASVIANKVKAGEGSFGYNAYTEEYGDMIAMGILDPTKVTRSALQYAASIAGLMITT
FT                   ECMVTDLPRDDKGADMGAGGMGGMGGMGGMM"
FT   gene            complement(732849..733142)
FT                   /gene="groS"
FT                   /locus_tag="YpAngola_A0723"
FT   CDS_pept        complement(732849..733142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="YpAngola_A0723"
FT                   /product="chaperonin GroS"
FT                   /note="identified by match to protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84890"
FT                   /db_xref="GOA:A9QYQ2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYQ2"
FT                   /protein_id="ABX84890.1"
FT                   /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGTAAGKSTRGEVLAVGN
FT                   GRILDNGEIKPLDVKVGDVVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
FT   gene            complement(733397..733999)
FT                   /gene="fxsA"
FT                   /locus_tag="YpAngola_A0724"
FT   CDS_pept        complement(733397..733999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="YpAngola_A0724"
FT                   /product="protein fxsA"
FT                   /note="identified by match to protein family HMM PF04186"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85303"
FT                   /protein_id="ABX85303.1"
FT                   /translation="MIKIKENTVRWLPFALIFLLAYIEISIFIKVAAVLGVPITLLLVI
FT                   ISSCVGISLVRNQGIKTFIQMQQKLAAGESPAAEMIKSVSLVLAGILLLIPGFFTDFLG
FT                   LLLLLPWVQKTLTLKLMPHLNIYRGGSFGGAGFGNGGFGNDSFGNRHGSGPMSGGDTFD
FT                   GEFQRKDDDRFTVEHRPDKNEQVANSRSNDDSFKDDK"
FT   gene            734423..735859
FT                   /gene="aspA"
FT                   /locus_tag="YpAngola_A0725"
FT   CDS_pept        734423..735859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="YpAngola_A0725"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00839"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85732"
FT                   /protein_id="ABX85732.1"
FT                   /translation="MSNNIRIEEDLLGTREVPAEAYYGVHTLRAIENFYISNSKISDVP
FT                   EFVRGMVMVKKAAAMANKELHTIPRKIADIIIQACDEVLDKGKCMDQFPVDVFQGGAGT
FT                   SLNMNTNEVLANIGLELMGHQKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYASILKL
FT                   IDAINQLGEGFGRKSKEFEKILKMGRTQLQDAVPMTLGQEFRAFQVLLNEETKNLQRTA
FT                   ELLLEVNLGATAIGTALNTPEGYSQLAVQKLAEISGLACVPAEDLIEATSDCGAYVMVH
FT                   SALKRLAVKMSKICNDLRLLSSGPRTGLNEINLPELQAGSSIMPAKVNPVIPEVVNQVC
FT                   FKVIGNDTCITMAAEAGQLQLNFMEPVIGQAMFESIHTLTNACYNLLEKCINGITANKE
FT                   VCERYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKNVREVVLERGLLTEAELDDIFS
FT                   VENLMHPAYKAKRYTDENEQ"
FT   gene            735979..737280
FT                   /gene="dcuA"
FT                   /locus_tag="YpAngola_A0726"
FT   CDS_pept        735979..737280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuA"
FT                   /locus_tag="YpAngola_A0726"
FT                   /product="anaerobic C4-dicarboxylate transporter DcuA"
FT                   /note="identified by match to protein family HMM PF03605;
FT                   match to protein family HMM TIGR00770"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88093"
FT                   /protein_id="ABX88093.1"
FT                   /translation="MIAVELVIVLLAIFLGARLGGIGIGFAGGIGVLVLAIIGVKPGSI
FT                   PFDVISIIMAVIAAISAMQVAGGMDYLVQQTEKLLRKNPKHITILAPLVTYFLTIFAGT
FT                   GNISLSALPVIAEVAKEQGIKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGQGVS
FT                   YLHLLMIVIPSTLCAVFVMSLIVSWCFSSKLSDDPIYLKRLEEGLVTLRGDTVKVIKPR
FT                   AKTSVLLFLAGVLCVVAYAIINSPSVGLVETPLMNTTNAILIIMLSVATITTLVCSVDT
FT                   DSILNSSTFKAGMSACICILGVAWLGDTFVQHNLEWIKETAGSLIQAHSWLLAVIFFFC
FT                   SALLYSQAATAKALMPMALALNVSPLAAIASFAAVSGLFILPTYPTLVAAVQMDDTGTT
FT                   RIGRFVFNHPFFIPGTIGVALAVCFGFVMGGLVL"
FT   gene            737465..737824
FT                   /gene="cutA"
FT                   /locus_tag="YpAngola_A0727"
FT   CDS_pept        737465..737824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="YpAngola_A0727"
FT                   /product="divalent-cation tolerance protein cutA"
FT                   /note="identified by match to protein family HMM PF03091"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88504"
FT                   /db_xref="GOA:A9QYQ6"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR023700"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYQ6"
FT                   /protein_id="ABX88504.1"
FT                   /translation="MSDSDAMTDPNAVSYSNAIVVLCTAPDEASAQNLAAQVLGEKLAA
FT                   CVTLLPGATSLYYWEGKLEQEYEVQLLFKSNTDHQQALLTYIKQHHPYQTPELLVLPVR
FT                   DGDKDYLSWLNASLL"
FT   gene            737800..739587
FT                   /gene="dsbD"
FT                   /locus_tag="YpAngola_A0728"
FT   CDS_pept        737800..739587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="YpAngola_A0728"
FT                   /product="thiol:disulfide interchange protein DsbD"
FT                   /EC_number="1.8.1.8"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM PF02683"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87002"
FT                   /protein_id="ABX87002.1"
FT                   /translation="MAQRFITLILLLCSVLLAPHSAQSSLFGENASFGTKNSQSRFIPV
FT                   DQAFAFDFHQQGDQLNLSWQIHPGYYLYRQQIKIVPQQAALGAFTLPEGITHHDEFYGE
FT                   VEIFKQQLTLKIPITQAAEQASVSVTYQGCAEAGFCYPPETRVIPLDVVVAASTASGTA
FT                   AVNSSATVNPPATTQPEGDATPVPSTLPFSPLWALLIGIGIAFTPCVLPMYPLISAVIL
FT                   GREKPHSQRRILILAVVYVQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLSVLFVL
FT                   LALSMFGLYSLQLPSSLQTRLTQWSNSQRGGSLAGVFAMGALAGLICSPCTTAPLSAIL
FT                   LYIAQSGNMLAGGGTLYLYALGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAFGFVILAL
FT                   PVFLLERVLGDVWGLRLWSLLAVAFFGWAFVLSLKAHAGWVRVCQLLLLAALLIVARPL
FT                   QDWAFNGNTQQNAVKHINFQPVANLPQLQAVLAQAQGKPVMLDLYADWCVACKEFEKYT
FT                   FSDDKVQRQLANTLLLQADVTANNAEHATLLKKFNVLGLPTILFFDSQGNEITAARVTG
FT                   FMDAAQFLQHLQNTPAVTK"
FT   gene            complement(739649..741796)
FT                   /gene="fdhF"
FT                   /locus_tag="YpAngola_A0729"
FT   CDS_pept        complement(739649..741796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhF"
FT                   /locus_tag="YpAngola_A0729"
FT                   /product="anaerobic formate dehydrogenase, alpha subunit,
FT                   archaeal-type"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM PF04879; match to protein family HMM TIGR01591"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0729"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87446"
FT                   /protein_id="ABX87446.1"
FT                   /translation="MKKILTVCPYCGSGCKLNLLVEDGEIVGAEPADGVTNQGALCLKG
FT                   YYGWDFLNDTRLLTPRLTTPLLRRQRGEAFQPVSWEAAIAFITAKLSAIKERHGPDAIM
FT                   MTGSSRGPGNEANYVMQKFARAAIGTNNIDCCARLCHGPSVAGLQQTLGNGAMSNSIGE
FT                   IENTDCILVFGYNAADSHPIVARRILKAKNKGAKLIVCDPRHIETARIADQWLPLKNGA
FT                   NMALVNAFIHVLIEEKLYDANYVRDHTRGFDELKAGVAAYRPEDVEPITGLSAKAVRQA
FT                   MRTYAAAPAATLLWGMGVTQWGQAVDVVKGLSSLALLTGNLGRPNVGVGPVRGQNNVQG
FT                   ACDMGVLPNTFPGYEKVTDSEARARFAHAWGVAELPAHVGYSITDVPHKVAEGKLKAYY
FT                   VFGEDPIQTEPDLAAMRAAFAALDLVVVQDIFMTKTAELADVVLPATSWGEHEGVYTSA
FT                   DRGFQHFNKAIEPKGDVKPDWEIISLISTAMGYPMAYQNTQQIWDEMRGLCPPFAGVTY
FT                   EKLAGLGYVQWPCPTEDHPGTPYLYTDNQFATADGKGLLSCAPWQPPHEQTDSDYPLAL
FT                   CTVREVGHYSCRSMTGNCGTLKILADEPGYVQIHPEDASYLGVIDQALIWISSRRGKVI
FT                   ARASVTERANRGAVYMTYQWWIGACNELTVDHVDPVSKTPEFKHCAVKVEAISDQTAAE
FT                   QYVEQQYSQLKKRLSDAAVVP"
FT   gene            complement(741819..742376)
FT                   /locus_tag="YpAngola_A0730"
FT   CDS_pept        complement(741819..742376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0730"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85901"
FT                   /protein_id="ABX85901.1"
FT                   /translation="MNRFVIADMTQCIGCRTCEIACVVAHSADNKVSTLMPEQFHPRLS
FT                   VMKSFAVSTPILCHQCEDAPCENACPNGAIITGSHGVQLLASRCIGCKTCMLVCPFGAM
FT                   SIIERPADGQQAADSQPVMASGSGRAQAHKCDLCHQRESGPACIEVCPTNALKLVTPGV
FT                   LEALQREKQLRAARGSAPGIAR"
FT   gene            complement(742399..744357)
FT                   /locus_tag="YpAngola_A0731"
FT   CDS_pept        complement(742399..744357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0731"
FT                   /product="putative anaerobic formate dehydrogenase,
FT                   iron-sulfur subunit"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01318"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86325"
FT                   /protein_id="ABX86325.1"
FT                   /translation="MACVVAHHEGQFPDKPEYFTPRVKVFKGDQCATAVFCHHCEDAPC
FT                   ASTCPNGAIVELNNRVQVIQEKCIGCKTCMIACPFGMMTVVTETVQPASHRLADVYRRT
FT                   EAQKCDLCLDQPDGPACIKTCPTQALTLVDQQYLLHQQQQKRQHMALNEHNGRLFSRAV
FT                   VQAASASSNKSIRDATPVNLLQRPRAPRLEPKKIPLAERKTGFAEIYLPFTESQIHEQA
FT                   ERCLECGDKTICQWTCPLHNAIPKWISLAHQGRIHEAAELSHQTSSLPEVCGRVCPQDR
FT                   LCEQSCTLNDHDGAVTIGQIERHITETALATGWRPDLSQVKPSGKRVAIIGAGPAGLGC
FT                   ADILVRNGITPVVFDRYPEIGGLLTFGIPAFKLEKSVMTRRREIFTEMGVEFCLNTEIG
FT                   RDITMENLLHDFDALFLGVGTYRSMRSGLENEDAQGVYDALPFLIGNTQHLMGYTANGA
FT                   HPYVSMQDQRVVVLGGGDTAMDCVRTSLRQGASRVVCAYRRDEKNMPGSKREVKNAREE
FT                   GAEFMFNLQPMSIVVDESGQVTGIKMVRTEMGQADAQGRRQALPITGSEHLIPADAVIM
FT                   AFGFSPHRMSWLAEHNVVLDKQGRVVAPTISGYPYQTSNPKIFAGGDIVRGADLIVTAI
FT                   AEGRKAAESIAYYLNVL"
FT   gene            744834..745409
FT                   /locus_tag="YpAngola_A0732"
FT   CDS_pept        744834..745409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0732"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86732"
FT                   /protein_id="ABX86732.1"
FT                   /translation="MQREQVLSNALNLLEQQGLANTTLEMLAKALSVEVSDLTRFWPDR
FT                   EALLYDCLRYHSQQIDTWRRQLQLDETLSPQQKLLARYQTLSEQVQNQRYPGCLFIAAC
FT                   SFYPDTEHPIHQLAEQQKQASLHYTKALLQEMDADDADMVAQQMELILEGCLSKLLIKR
FT                   QLADVEVAKCLAEDILTVAQCRKNGALS"
FT   gene            745553..745630
FT                   /locus_tag="YpAngola_A0733"
FT   tRNA            745553..745630
FT                   /locus_tag="YpAngola_A0733"
FT                   /product="tRNA-Phe"
FT   gene            complement(746063..748618)
FT                   /locus_tag="YpAngola_A0734"
FT   CDS_pept        complement(746063..748618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0734"
FT                   /product="viral enhancin protein"
FT                   /note="identified by match to protein family HMM PF03272"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0734"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84905"
FT                   /protein_id="ABX84905.1"
FT                   /translation="MRQVTKSKKIKILPYPEWLVKAGMSKGIDHDRQHLGIILAAGEMI
FT                   KVRQVNAEYKEKLKLYLLNDNKNTQRSISFNTDWIELSVDAISVPFINTPYSDGIIPEI
FT                   VFEYPDTSKLLPVYEKGEDESIFFESWDKQNAEFGVVESEYVIILIPEVSKDRLKSFST
FT                   SGGIDTVLGFYQDIFSFNNSLAGLSFEPQRYSDGNTRNRYFAKADKGGGGAAYYSNNWI
FT                   ASSSGSINTFWLSPNATNWGCLHEIAHGYQGGFIDDKYFSTREVWNNIYAACYQDVMLG
FT                   AEKFNKGWLYNFGKQKEVEKSILNNINNGKEVNAWGERSKLYFIMLMLEKAGVNCFTHF
FT                   NQIYRERKNTDQSVGSVLDMLSNSFATVENRVDVTLFLQMVGGHISKNQYQRNLFSHAK
FT                   AVYPLNQLLQGDELTAVKKTLDLNSELSLVDVDSIEFTDIKSNLTLQFSIDDFAQIYGE
FT                   ELLILNGDNYVYNQSIMDKKQTLYNLPVGAYTLRIPTGRNKKYAPQINYLIVKNEDSQT
FT                   QVDFVHRIGSPIVSQKISLQGLNDYTFATIFFDQENDTVSVDITKTKPHYHFPGMYARI
FT                   RIKDKDNNELLNEVITGTNQSLSKNDFPLSSCYVIDIFHKEPGRVKLTPAYKGVIDNKS
FT                   SYNEFIITPYGLQNIKLNNDPKVFLLENIKSAAEMLRSHPIMWHANFSEAKDNIYLAID
FT                   IFPSPQKEGLLEQYADCISSYYEKPNEDLGNAFSFIFKGINDREFLTTKLNLVTKKLEV
FT                   KIVSGTPHSGFKRTYAVLRYFNADGNELLNLDIIGSKKQAGQEWVFPISGYGGEKLYLQ
FT                   HVEPKNRLVITNIMQGIRLSSRTSIQTYEIESLGLSRCT"
FT   gene            complement(748648..748815)
FT                   /locus_tag="YpAngola_A0735"
FT   CDS_pept        complement(748648..748815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0735"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86253"
FT                   /protein_id="ABX86253.1"
FT                   /translation="MATFSDGSFFIDNKTPYFNLLIMGEVLIIYEVLDIFQNNFLYVNI
FT                   TNELHWGFNL"
FT   gene            749624..750133
FT                   /locus_tag="YpAngola_A0736"
FT   CDS_pept        749624..750133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0736"
FT                   /product="IS1541, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86375"
FT                   /protein_id="ABX86375.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSSPYPGS
FT                   PFTGRK"
FT   gene            751012..752046
FT                   /gene="rhaT"
FT                   /locus_tag="YpAngola_A0737"
FT   CDS_pept        751012..752046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaT"
FT                   /locus_tag="YpAngola_A0737"
FT                   /product="L-rhamnose-proton symporter"
FT                   /note="identified by match to protein family HMM PF06379;
FT                   match to protein family HMM TIGR00776"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0737"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86779"
FT                   /db_xref="GOA:A9QYR5"
FT                   /db_xref="InterPro:IPR004673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYR5"
FT                   /protein_id="ABX86779.1"
FT                   /translation="MNNAIILGIIWHLVGAASAACFYAPFKQVKKWSWETMWSIGGLVS
FT                   WLILPWTVSYLLLPDFWQYYGSFSIATLLPVFLFGAMWGIGNINYGLTMRYLGMSMGIG
FT                   IAIGITLIIGTLMTPILQGRFDVLLGTPGGRMTLLGVFVALIGVAIVSYAGLLKERAMG
FT                   IQAEEFNLKKGLILAVMCGIFSAGMSFAMDAAKPMHEAASALGINSLYVALPSYVIIMG
FT                   GGAIINLSYCFIRLATLKNLSVKADFSVAKPLLITNILFSALAGLMWYLQFFFYAWGHA
FT                   KIPQQYDYMSWMLHMSFYVLCGGIVGLLLKEWKCSTKKPVAVLCIGCLVIILAANIVGL
FT                   GMAA"
FT   gene            complement(752195..753067)
FT                   /gene="rhaR"
FT                   /locus_tag="YpAngola_A0738"
FT   CDS_pept        complement(752195..753067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaR"
FT                   /locus_tag="YpAngola_A0738"
FT                   /product="transcriptional activator RhaR"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0738"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87486"
FT                   /db_xref="GOA:A9QYR6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR023699"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYR6"
FT                   /protein_id="ABX87486.1"
FT                   /translation="MRAPLLLESRDYLLSEQMPVAVTNRYPQETFVEHTHQFCEIVIVW
FT                   RGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHDLVLDNIIYCPERLHLNAQWHKLL
FT                   PPLGPEQNQGYWRLTTQGMAQARPIIQQLAQESRKTDSWSIQLTEVLLLQLAIVLKRHR
FT                   YRAEQAHLLPDGEQLDLIMSALQQSLGAYFDMADFCHKNQLVERSLKQLFRQQTGMSIS
FT                   HYLRQIRLCHAKCLLRGSEHRISDIAARCGFEDSNYFSAVFTREAGMTPRDYRQRFIRS
FT                   PVLPAKNEP"
FT   gene            complement(753091..753222)
FT                   /locus_tag="YpAngola_A0739"
FT   CDS_pept        complement(753091..753222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0739"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0739"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87938"
FT                   /protein_id="ABX87938.1"
FT                   /translation="MICVASFSRLNCPARKGVKGITVKIEGYHGKNWPFQDNEQVIN"
FT   gene            complement(753200..754021)
FT                   /gene="rhaS"
FT                   /locus_tag="YpAngola_A0740"
FT   CDS_pept        complement(753200..754021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaS"
FT                   /locus_tag="YpAngola_A0740"
FT                   /product="transcriptional activator RhaS"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311; match to protein
FT                   family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0740"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85213"
FT                   /db_xref="GOA:A9QYR8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR023609"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYR8"
FT                   /protein_id="ABX85213.1"
FT                   /translation="MTVLHSIDFFSSSSAPVAIEARAPQSAFPEHHHDFYEIVIVEEGA
FT                   GVHVFNGNPYTLSRGCVCFVRDHDRHLFESTDDLFLTNVLFRAPDAFRFLSGVGHFLPR
FT                   ECDGVYPSHWRVNGQVLQQIKCLIACLEHAPKSDQVEDIALHESVFMQLLVKLWQGCQT
FT                   QVGDDQEGRLYQLLDWLQNNYSEAVEWPELADRFALPLRTLHRQLKNKTGMTPQRYLTR
FT                   LRLLQARHQLCYSDNSVTDIAYLCGFGDSNHFSTLFKREFSQSPRDLRSQL"
FT   gene            complement(754103..754246)
FT                   /locus_tag="YpAngola_A0741"
FT   CDS_pept        complement(754103..754246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0741"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0741"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85591"
FT                   /protein_id="ABX85591.1"
FT                   /translation="MTKVKVKQLTVSYLGGSPFPCDPAHTFQHCHAYLKKIAAKVVFNV
FT                   KN"
FT   gene            complement(754243..754449)
FT                   /locus_tag="YpAngola_A0742"
FT   CDS_pept        complement(754243..754449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0742"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0742"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85326"
FT                   /protein_id="ABX85326.1"
FT                   /translation="MCRAAFGDVTADGEHVGCEHMGCAYVDGEHVDGVGMISGLLFLNA
FT                   NSVEICLFDDLLITANRYGLMAE"
FT   gene            754448..755905
FT                   /gene="rhaB"
FT                   /locus_tag="YpAngola_A0743"
FT   CDS_pept        754448..755905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaB"
FT                   /locus_tag="YpAngola_A0743"
FT                   /product="rhamnulokinase"
FT                   /EC_number="2.7.1.5"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM TIGR02627"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0743"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86722"
FT                   /db_xref="GOA:A9QYS1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYS1"
FT                   /protein_id="ABX86722.1"
FT                   /translation="MVAIDLGASSGRVMLASYYPGQQQLTLREVCRFTNQIKSIDGSDV
FT                   WDIDAIEQSIREGLSQLDSEGIALDSIGIDSWGVDFVLLDKQGKRIGQPVYYRDSRTQG
FT                   VMARAQQTLGSNAIYRRTGIQFLPFNTLYQLRALSEQQPHLLADVAHLLLIPDYLHYRL
FT                   TGQLNWEYTNASTTQLLNIETGDWDSDLLAYAGVPAHWFAKPGKPGNTIGYWHSANGQQ
FT                   VPVVAVATHDTASAVLAAPLIDADAAYLSSGTWSLMGFESGTPLTHQQAQCSNITNEGG
FT                   AEGRYRVLKNIMGLWLLQRATDELQIDDLPQLIEQAARQPACRSLINPNDSRFINPPNM
FT                   CREIQNACREHQFPVPNTAAQLARCIFDSLAMLYRQVAQELATLRGRPISHLHIVGGGC
FT                   QNQFLNQLCADACGLNVSMGPVEASTLGNIGSQLISLGEVADVTHYRRIVANNFPLHHL
FT                   SPHDNSDFAAHWLQFQSLSQLPKELCI"
FT   gene            755902..757158
FT                   /gene="rhaA"
FT                   /locus_tag="YpAngola_A0744"
FT   CDS_pept        755902..757158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaA"
FT                   /locus_tag="YpAngola_A0744"
FT                   /product="L-rhamnose isomerase"
FT                   /EC_number="5.3.1.14"
FT                   /note="identified by match to protein family HMM PF06134;
FT                   match to protein family HMM TIGR01748"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0744"
FT                   /db_xref="EnsemblGenomes-Tr:ABX84872"
FT                   /db_xref="GOA:A9QYS2"
FT                   /db_xref="InterPro:IPR009308"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYS2"
FT                   /protein_id="ABX84872.1"
FT                   /translation="MTNSIEQAWDLAKQRFAAVGVDVDAALTRLDTLPVSMHCWQGDDV
FT                   TGFEDPDGVLTGGIQATGNYPGKARNATELRSDLELALALIPGPKRLNLHAIYLESDTP
FT                   VARNKIEPRHFSHWVAWAKKHQLGLDFNPSCFSHPLSADGFTLSHADPEIRQFWIEHCQ
FT                   ASRRVSAYFGEQLGTPSVMNIWIPDGMKDTPIDRLAPRQRLLSALDEVISEKLNPAHHI
FT                   DAVESKLFGIGAESYTVGSNEFYMGYAASRQTALCLDAGHFHPTEVISDKISSAMLYVP
FT                   RLLLHVSRPVRWDSDHVVLLDDETQAIASEIIRHNLFDRVHIGLDFFDASINRIAAWVI
FT                   GTRNMKKALLRALLEPTDRLRQLELRGDYTARLALLEEQKSLPWQAIWEGYCQRNDVPV
FT                   DARWLDAVREYEQQILSQR"
FT   gene            757171..757995
FT                   /gene="rhaD"
FT                   /locus_tag="YpAngola_A0745"
FT   CDS_pept        757171..757995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaD"
FT                   /locus_tag="YpAngola_A0745"
FT                   /product="rhamnulose-1-phosphate aldolase"
FT                   /EC_number="4.1.2.19"
FT                   /note="identified by match to protein family HMM PF00596;
FT                   match to protein family HMM TIGR02624"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0745"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85270"
FT                   /db_xref="GOA:A9QYS3"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR013447"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYS3"
FT                   /protein_id="ABX85270.1"
FT                   /translation="MQAILSSWFIQGMIKATSDMWHKGWDERNGGNISLRLLAEEVEPY
FT                   RRDFYQQPRKVELTQPAPELANSWFLVTGSGKFFRNVELNPAENLVLLQVSNDGMAYHI
FT                   HWGLTQGGLPTSELAAHFQSHIVRMQVSGGTNRVIMHCHATNLIALSYVQKLENASFTR
FT                   LLWEGSTECLVVFPDGIGIVPWMVPGTDGIGTQTAEQMREHSLVLWPFHGIFGSGPTLD
FT                   DAFGLIDTAEKSAEIMVKVLSMGGKKQTISREQLIALAARFDVTPMAAALDA"
FT   gene            758062..759210
FT                   /gene="fucO"
FT                   /locus_tag="YpAngola_A0746"
FT   CDS_pept        758062..759210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucO"
FT                   /locus_tag="YpAngola_A0746"
FT                   /product="lactaldehyde reductase"
FT                   /EC_number="1.1.1.77"
FT                   /note="identified by match to protein family HMM PF00465;
FT                   match to protein family HMM TIGR02638"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87902"
FT                   /protein_id="ABX87902.1"
FT                   /translation="MSFMLALPKISLHGTGAIGDMVKLLSDKQWGKALIVTDGQLVELG
FT                   LLDSLFAAMAQYQLPYGLFGEVFPNPTEELVQAGFAAFTQHQCDYLIAFGGGSPIDTAK
FT                   AIKILTANPGPSTAYSGVGKVKQTGVPLIAINTTAGTAAELTSNAVIIDSQRQVKEVII
FT                   DTNLIPDIAVDDPSVMLNIPASVTAATGMDALTHAVEAYVSLGAHTLTDHSALESIRLI
FT                   SQWLPLAVADGKNLQAREMMACGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNA
FT                   ILLPVIEEYNRPQATRRFARIAQAMGVDTQDMSDEQASHQAIAAIRQLSLQVGIPAGFS
FT                   ALGIEESDIEGWLDKALADPCAPCNPRSADREQIRTLYLQAL"
FT   gene            759224..759538
FT                   /gene="rhaU"
FT                   /locus_tag="YpAngola_A0748"
FT   CDS_pept        759224..759538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaU"
FT                   /locus_tag="YpAngola_A0748"
FT                   /product="L-rhamnose 1-epimerase"
FT                   /EC_number="5.1.3.-"
FT                   /note="identified by match to protein family HMM PF05336;
FT                   match to protein family HMM TIGR02625"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0748"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87050"
FT                   /db_xref="GOA:A9QYS5"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013448"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYS5"
FT                   /protein_id="ABX87050.1"
FT                   /translation="MIRKAFVMAVNPDAHAEYQRRHTPIWPELESVLKAHGAHHYSIFL
FT                   DETRNLLFGVVEIESEERWNAVAQTAECQRWWQHMADVMPSHPDNSPVSQALREVFYLE
FT                   "
FT   gene            complement(759526..759639)
FT                   /locus_tag="YpAngola_A0747"
FT   CDS_pept        complement(759526..759639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0747"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0747"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87379"
FT                   /protein_id="ABX87379.1"
FT                   /translation="MVSLLVAVLSVAGASSLTLLFLFQARNFISGKTFHSR"
FT   gene            complement(759767..760315)
FT                   /gene="ssb"
FT                   /locus_tag="YpAngola_A0749"
FT   CDS_pept        complement(759767..760315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="YpAngola_A0749"
FT                   /product="single-strand binding protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0749"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86492"
FT                   /protein_id="ABX86492.1"
FT                   /translation="MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQ
FT                   TGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGALQTRKWQDQSGQERYTTEVVV
FT                   NVGGTMQMLGGRQGGGAPAGGGAAPQDGGAQGGWGQPQQPQGGNQFSGGQASRPAQPAP
FT                   AAPQGGNEPPMDFDDDIPF"
FT   gene            760533..760670
FT                   /locus_tag="YpAngola_A0750"
FT   CDS_pept        760533..760670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0750"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0750"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86218"
FT                   /protein_id="ABX86218.1"
FT                   /translation="MYLFIAHGTYVFKKSRQLYSKSLALQVGSQRANPDESTYFKVNGQ
FT                   "
FT   gene            760773..763616
FT                   /gene="uvrA"
FT                   /locus_tag="YpAngola_A0751"
FT   CDS_pept        760773..763616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="YpAngola_A0751"
FT                   /product="UvrABC system, A protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0751"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85640"
FT                   /protein_id="ABX85640.1"
FT                   /translation="MDNIEVRGARTHNLKNINLIIPRDKLIVVTGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   HDYLRLLFARVGEPRCPDHDVPLAAQTVSQMVDNVISQPEGRRLMLLAPVVKDRKGEHT
FT                   KILENLAAQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVVDRFKVREDLAQRLAESFE
FT                   TALALSGGTAVVADMDDPHVEELLFSANFACPICGYSMRELEPRLFSFNNPAGACPTCD
FT                   GLGVQQFFDPDRVLQNPELSLAGGAIRGWDRRNFYYFQMLRSLAEHYKFDIEAPFNSLD
FT                   SAVQQAVLYGSGKDTIEFKYINDRGDTTVRRHPFEGVLHNMERRYKETESSAVREELAK
FT                   FISNRSCASCSGTRLRREARYVFVENTTLPEISELSIGHALSFFQNMKLSGQRAQIAEK
FT                   ILKEIGDRLKFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLETLIHLRNLGNTVIVVEHDEDAIRAADHVIDIGPGAGVHGGEVVAEGT
FT                   VDDIMAAPASLTGQFLSGKRSIAIPEKRVSADPSKVLKLIGATGNNLKDVTLTLPVGLF
FT                   SCITGVSGSGKSTLINDTLYSIAQRQLNGATITEPAPYREIQGLEHFDKVIDIDQSPIG
FT                   RTPRSNPATYTGIFTPIRELFAGVPESRTRGYTPGRFSFNVKGGRCEACQGDGVIKVEM
FT                   HFLPDIYVPCDHCKGKRYNRETLEVKYKGKSIHEVLAMTIEEAREFFDAVPALARKLQT
FT                   LIDVGLSYICLGQSATTLSGGEAQRVKLSRELSKRGTGQTLYILDEPTTGLHFADIQQL
FT                   LAVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGEILVSGTPETVAECAAS
FT                   HTARFLKPMLQRKPQTV"
FT   gene            complement(763709..764068)
FT                   /locus_tag="YpAngola_A0752"
FT   CDS_pept        complement(763709..764068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0752"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04237"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0752"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88296"
FT                   /protein_id="ABX88296.1"
FT                   /translation="MNHSALLEYCLSKPGAEQCEHEQWQTNQIKVADVMFAMVGNIGGR
FT                   PSISLKSSPKLAERLREQHPEIVPSEHLNKTHWNTVFLDGKLPNSQFYTLIDHSYQLVL
FT                   QGLPEQRRQDLSSHL"
FT   gene            complement(764595..765788)
FT                   /gene="tyrB"
FT                   /locus_tag="YpAngola_A0753"
FT   CDS_pept        complement(764595..765788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrB"
FT                   /locus_tag="YpAngola_A0753"
FT                   /product="aromatic-amino-acid aminotransferase"
FT                   /EC_number="2.6.1.57"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0753"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87746"
FT                   /protein_id="ABX87746.1"
FT                   /translation="MFQNVDAYAGDPILSLMESFKADNRAHKVNLSIGLYYNEQGEIPQ
FT                   MQAVDAAEAQLSTQPHGTPVYLPMEGLQSYRTAIQQLLFGHDHPMLVQQRVATIQTVGG
FT                   SGALKVGADFLNHYFPDSQVWVSDPTWENHVAIFSGAGFKVNTYPYFDNDKLAVKFDPM
FT                   LATLQQLPARSIVLLHPCCHNPTGSDLTNAQWDRLIDVVKERELIPFLDIAYQGFGAGL
FT                   NEDAYAIRAMAAVGLPCLISNSFSKIFSLYNERVGGLSVVCESDEAAGRVLGQLKATVR
FT                   RNYSSPPNFGAQVVSKVLNDTVLRAQWQAEVEQMRLRILDMRHTLVEALKASLPERNFD
FT                   YLLQQRGMFSYTGFSEAQVESLREEFGVYLIASGRMCMAGVNHQNVEQVAVAFAAVQ"
FT   gene            complement(765974..767053)
FT                   /gene="alr2"
FT                   /locus_tag="YpAngola_A0754"
FT   CDS_pept        complement(765974..767053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr2"
FT                   /locus_tag="YpAngola_A0754"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="identified by match to protein family HMM PF00842;
FT                   match to protein family HMM PF01168; match to protein
FT                   family HMM TIGR00492"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0754"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87064"
FT                   /db_xref="GOA:A9QYT2"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QYT2"
FT                   /protein_id="ABX87064.1"
FT                   /translation="MKAATAVIDRHALRHNLQQIRRLAPQSRLVAVVKANAYGHGLLAA
FT                   AHTLQDADCYGVARISEALMLRAGGIVKPILLLEGFFDAEDLPVLVANHIETAVHSLEQ
FT                   LVALEAATLSAPINVWMKLDTGMHRLGVRPDQAEAFYQRLSACRNVIQPVNIMSHFSRA
FT                   DEPEVAATQQQLACFDAFAAGKPGKQSIAASGGILRWPQAHRDWVRPGIVLYGVSPFDA
FT                   PYGRDFGLLPAMTLKSSLIAVREHKAGESVGYGGTWVSERDTRLGVIAIGYGDGYPRSA
FT                   PSGTPVWLNGREVSIVGRVSMDMISIDLGPESTDKVGDEALMWGAELPVERVAACTGIS
FT                   AYELITNLTSRVAMEYLGE"
FT   gene            complement(767150..768556)
FT                   /gene="dnaB1"
FT                   /locus_tag="YpAngola_A0755"
FT   CDS_pept        complement(767150..768556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB1"
FT                   /locus_tag="YpAngola_A0755"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00772;
FT                   match to protein family HMM PF03796; match to protein
FT                   family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0755"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88640"
FT                   /protein_id="ABX88640.1"
FT                   /translation="MAAKKPTNKMTEPRDRQMEGLKLPPHSLEAEQSVLGGLMLDNERW
FT                   DNVSERVASKDFFSRPHRRIFTEMQRLLENSKPIDLITLSESLEQKGDLDSVGGFAYLA
FT                   ELSKNTPSAANIGAYADIVRERAVVREMISVANEIADAGYDPQGRSSEDLLDLAESKVF
FT                   QIAESRASKDEGPKSVDRILEDTVARIEQLYQRPHDGVTGVSTGFTDLDKKTAGLQKSD
FT                   LIIVAARPSMGKTTFAMNLCENAAMMQDKPVLIFSLEMPGDQIMMRMLASLSHVDQTRI
FT                   RTGQLDDEDWARISSTMGILMEKRNMYIDDSSGLTPTEVRSRARRIFREHGGLSLIMID
FT                   YLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQRADKRPVNSDL
FT                   RESGSIEQDADLIMFIYRDEVYHENSDEKGIAQIILGKQRNGPIGSVRLKFNGQWSRFD
FT                   NYAGPQYDDE"
FT   gene            768888..769661
FT                   /locus_tag="YpAngola_A0756"
FT   CDS_pept        768888..769661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0756"
FT                   /product="putative quinone oxidoreductase (NADPH:quinone
FT                   reductase) (zeta-crystallin homolog protein)"
FT                   /EC_number="1.6.5.5"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0756"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87575"
FT                   /protein_id="ABX87575.1"
FT                   /translation="MAKHIQFTTTGGPDVLQYLEFTPSDPAPHEVQVENKAIGINYIDT
FT                   YVRSGLYPPAHLPSGLGTEAAGIVSKVGAAVSSVKVGDRVVYAQSALGAYSEVHNVPAD
FT                   KIALLPEQISFEQAAASFLKGLTAYYLLRQTHEIKPGEVFLFHAAAGGVGLIACQWAKA
FT                   LGAKLIGTVGSDEKAQLAKAAGAWATINYRTENIAQRVAELTEGEKVGVVYDSVGKSTW
FT                   EASLDSLKRRGLLVSFGNASGPVTGVNCTQYSRNR"
FT   gene            complement(770172..772767)
FT                   /pseudo
FT                   /locus_tag="YpAngola_A0757"
FT                   /note="ATPase, AAA family; this gene contains a frame shift
FT                   which may be the result of sequencing error; identified by
FT                   match to protein family HMM PF07724"
FT   gene            complement(772770..773753)
FT                   /locus_tag="YpAngola_A0758"
FT   CDS_pept        complement(772770..773753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0758"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06996;
FT                   match to protein family HMM TIGR03347"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0758"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86018"
FT                   /protein_id="ABX86018.1"
FT                   /translation="MASLQTLKNTFLPGISASQDFFELLRRIERATPEQGRLGTQRDRS
FT                   HLRLRIIQPADMGFAPREVSDIRQTLNTHQHLAEITIFCRHFGLFAPYGPLPIHVTEHA
FT                   RNEALAKRNQAFEHFAGILSQRMAILHYRSWAQMHVAVGHDRASANPFMNHVRQIAGLT
FT                   PQQALNSHVDRVRRCFPGVYLPGRGSLRKLQEILSLYFSVPIRVEARKGLWIDDSRNIE
FT                   SQRMGRLGNTRIGSRFFDVQHSLVLSIGPVSDPQYLDFQRNSKRINTLVQICHDFVRHR
FT                   MVLDVQLIIQTSPNMACRLGGGTLSRHSWLKPGSALSIQPIYRTVT"
FT   gene            complement(773746..775590)
FT                   /locus_tag="YpAngola_A0759"
FT   CDS_pept        complement(773746..775590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0759"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05947;
FT                   match to protein family HMM TIGR03359"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0759"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87852"
FT                   /protein_id="ABX87852.1"
FT                   /translation="MPNESFLALYNEELRYLREDGQRFAHMHPQVAQHLGLHADGVLDP
FT                   FVERLLEGTAFLSSRIQQRLNNEHPEFALQMLGRLAPLWYTPLPSIATIAMVPDLTSPQ
FT                   WHSRVVLPKGSRVTLSDSSLNNRLANFSTGRTLKIQPLVIENAECASTPPAYLPLSVAS
FT                   QLQAGQAHLRLRLTTQGVASLSELDFAPMNLTLAGGIIQSNQLITTLLNNTLHIVLWAN
FT                   TDGKPLVKVLTKEHLRQGGLDEQEALLPVAISEMPGNRLLREYFAAPSRFFDLELHGLN
FT                   DFLQQGDGIHTFEVLFVLDQRPLHLIDRVTGNDFRLFATPIINLFKRRCSPVLINGEHT
FT                   EYPVIVDPLNPRLYEVHHVLGVNGLLSEGGSVQFSSLHGHARFDDDDKMAGYSIRRRRD
FT                   FTDKNHQKNSPLPHDSLFIALSPGTSGIDIDHVKSLSIEAMVCERHLIPSQLQHPEFKL
FT                   EIALPVGQIEMLRHPAKPQGVPNIDQAWRALQLIANNPLRYALPDVTDCSPLLKDWLSI
FT                   FCQHEEASQHKRITSLTHASVAHNFERHTAPGPIAWSRGVEATLDFNSSHHSDKGAFLF
FT                   ARILHHALSEYCELGQTLRLHMQVDGETFAKWGPVNYG"
FT   gene            complement(775623..776066)
FT                   /locus_tag="YpAngola_A0760"
FT   CDS_pept        complement(775623..776066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0760"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04965;
FT                   match to protein family HMM TIGR03357"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0760"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88071"
FT                   /protein_id="ABX88071.1"
FT                   /translation="MDISAPILFDKLSLRHEHVRLPHWREVIVRDIESLLNDSAHSARL
FT                   KLKKYPHCEASVLNYGLPSLSQQVPVITDLLELARHIQRIIATFESRLDPRSIKVVPLI
FT                   NKGETWVLAILFDIHARCNLPGEEHLVNLRIALDYSYGMVRVL"
FT   gene            complement(776140..776658)
FT                   /locus_tag="YpAngola_A0761"
FT   CDS_pept        complement(776140..776658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0761"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05638"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0761"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87710"
FT                   /protein_id="ABX87710.1"
FT                   /translation="MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGLG
FT                   GGGGSGKVEMKDFEFRMVSNKASPKLFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVTFS
FT                   NCLVSSFKTVGNMPLGKGDAVFTDTVLPTDAISLNFARIEVEYKEQQPDGSMGAVIKAG
FT                   YDLKLNSRI"
FT   gene            complement(776821..778323)
FT                   /locus_tag="YpAngola_A0762"
FT   CDS_pept        complement(776821..778323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0762"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05943;
FT                   match to protein family HMM TIGR03355"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0762"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87206"
FT                   /protein_id="ABX87206.1"
FT                   /translation="MQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAIG
FT                   TLAAYANKGQVKVNRDVVLTIESLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLV
FT                   DNTDANETLKIRVLNISQDELGKTLRRYRGSAWDQSPIFKQVYEHEYGQFGGEPFGCMI
FT                   GDYEFDHSPQSVALLTELAKVAAAAHCPFITSSSPSIMQMNNWRELGNPRDIGKIFTTP
FT                   EYAPWRRLRESNDSRYLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFTWANA
FT                   AYAMGVNINRAFNEYGWCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAISDRR
FT                   ENELSNAGFLPLVYRKNSDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRF
FT                   AHYLKCIVRDKIGSFRSRDDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVED
FT                   VEDDPGFYRAHFYLRPHYQLEGMTVSLRLVSKLPSNKESEKK"
FT   gene            complement(778332..778892)
FT                   /locus_tag="YpAngola_A0763"
FT   CDS_pept        complement(778332..778892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0763"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05591;
FT                   match to protein family HMM TIGR03358"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0763"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87786"
FT                   /protein_id="ABX87786.1"
FT                   /translation="MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMAD
FT                   LSGHRAKPLPAVEDRKFLTFDQDNFDARMRAIKPRLKFYVDNTLSEDNELLDIELDFES
FT                   MDDFSPGSLARRIPQMEKLLEARTHLAELITYMDGKTSAEEVVKQLLEQPDFLQNLATD
FT                   AQGTISKLSQDDDVLVEDDDGEK"
FT   gene            complement(778903..779916)
FT                   /locus_tag="YpAngola_A0764"
FT   CDS_pept        complement(778903..779916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0764"
FT                   /product="ImpA domain protein"
FT                   /note="identified by match to protein family HMM PF06812"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0764"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88330"
FT                   /protein_id="ABX88330.1"
FT                   /translation="MILKRMDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLS
FT                   RPHEPPQINWHHISEQANKLLEQCFDLRVMLWFIRANIHIKGISALYDGFMRINAQTQN
FT                   TDVVIYPQSEEPPLNSGHAAALGWLSTAQCIAELKTARLTEEHPYILQDLITTEALPNG
FT                   QERYFVTSSTLFLTVNNYFQQNGLPDLKDQLTKVDMLLEQIESYANQSTESYQLHCEQL
FT                   RIFLKNNISQLAQLNAPEHDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLDR
FT                   ILEYFQHYEPSHPAPIFIRRTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR"
FT   gene            780246..780989
FT                   /locus_tag="YpAngola_A0765"
FT   CDS_pept        780246..780989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0765"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0765"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85132"
FT                   /protein_id="ABX85132.1"
FT                   /translation="MRKKLYNDFAWECLRRNPQYISDWELFMKNTLTNGGGIPDDSELI
FT                   QSELDLNAEKKWGVMKYIDPYNSDPTNVFWSLKLSNRSVRVKLSNTGNVKGGYTWGDMS
FT                   NLPGVKHQRLLMHDNTLCVKIFSQNGYFQLFIESADALKDDSNLYIYIPLNLESDVFAK
FT                   NIELLQSIVNHKIEVECKEEQYLGLLKTIDDRKQGFSHRDIASEIFGKELVKNEWSADS
FT                   WVRAKIRYRIKKANALINYGYLNFL"
FT   gene            781313..781429
FT                   /locus_tag="YpAngola_A0766"
FT   CDS_pept        781313..781429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0766"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0766"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85651"
FT                   /protein_id="ABX85651.1"
FT                   /translation="MNAFFFSIKKVKNSLFNSINHPRILATFLFELIKFKLV"
FT   gene            782213..782833
FT                   /gene="rluA"
FT                   /locus_tag="YpAngola_A0767"
FT   CDS_pept        782213..782833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="YpAngola_A0767"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF00849"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0767"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86220"
FT                   /protein_id="ABX86220.1"
FT                   /translation="MIVLYQDKHIMVVNKPSGLLSVPGRAPENKDSVMTRVQNDFPTAE
FT                   SVHRLDMATSGVIVVALTKAAERELKRQFREREPKKTYIARVWGHLAQDEGLIDLPLIC
FT                   DWPNRPKQKVCYETGKSAQTEYQVISRDDDGSTRVKLSPITGRSHQLRVHMLAMGHPIL
FT                   GDGFYAHPEAKAMASRLQLHAQQLCITHPEFGTPMHFKCEAEF"
FT   gene            complement(783131..783964)
FT                   /gene="djlA"
FT                   /locus_tag="YpAngola_A0768"
FT   CDS_pept        complement(783131..783964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="YpAngola_A0768"
FT                   /product="dnaJ-like protein DjlA"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0768"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86746"
FT                   /protein_id="ABX86746.1"
FT                   /translation="MRYWGKLLGLVLGVMYAPGVVGALLGLLVGHMVDRALGAKRRGFF
FT                   ADQQTRQSLFFRTTFQVMGHLTKAKGRVTEVDIQLASQLMDRMQLHGAARTAAQQAFRE
FT                   GKESHFPLRKALQEFRRVCFGRFDLIRIFLEIQLQAAFADGSLHPNERQVLYVIAEELG
FT                   ISRGQFDQFLRMFDGGRQFGGHGGWQGQQGGYSQSGYQRASQGPTLEDACKVLGVNSSD
FT                   DSVAIKRAYRKLMGEHHPDKLVAKGLPPEMMEMAKQKAQEIQAAYDLIKREKGFK"
FT   gene            784239..786491
FT                   /gene="imp"
FT                   /locus_tag="YpAngola_A0769"
FT   CDS_pept        784239..786491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="YpAngola_A0769"
FT                   /product="organic solvent tolerance protein"
FT                   /note="identified by match to protein family HMM PF03968;
FT                   match to protein family HMM PF04453"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0769"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88587"
FT                   /protein_id="ABX88587.1"
FT                   /translation="MLGVPTYDQPLVTGDPNQLPVRINADKTEANYPDNALFTGNVIVQ
FT                   QGNSTLTANQVELTQVQKPGEVIPLRTVTATGDVNYDDPQIKLKGPKGWSNLNTKDTDM
FT                   DKGKYQMVGRQGRGDADLMKLRDQSRYTILKNGTFTSCLPGDNSWSVVGSEVIHDREEQ
FT                   VVEVWNARFKIGKVPVFYSPYMQLPVGDKRRSGFLIPNAKFTSNNGFEFLLPYYWNIAP
FT                   NFDATITPHYMERRGLQWQNEFRYLLAPGSGTMALDWLPNDRIYTGPDGTDKNATRWLY
FT                   YWGHSGVMDQVWRFNINYTRVSDPAYFTDLTSQYGSTTDGYATQIFTAGYANENWNATL
FT                   SSKQFQVFTAAGNSNAYRAQPQLDMNYYKNDVGPFDMHVYGQAAKFTSVNPTNPEASRF
FT                   HIEPTVNLPLSNSWGSINTEAKLLATHYQQDIPASFADNASNPKLKDSVNRVLPQFKVD
FT                   GKVVFDRSMDWATGFTQTLEPRAQYLYVPYRNQDDIYIYDTTLMQSDYSGLFRDRTYSG
FT                   LDRIASANQVSTGLTSRIYDDARVERFNVSVGQIYYFSRSRTGNTEAIDNSNATGSLVW
FT                   AGDTFWRINDQLGLKGGAQYDTRLGSLTLGNAIMEYRKDADRMIQLNYRYASPKYIQAA
FT                   VPKVYNPDYQQGISQVGTTASWPIADRWAIVGAYYYDTKAKQPASQLVGLQYNTCCWAV
FT                   NLGYERKITGWNAQGQTSKYDNKIGFNIELRGLSGGHSLGTAQMLNSGILPYQSAF"
FT   gene            786559..787863
FT                   /gene="surA"
FT                   /locus_tag="YpAngola_A0770"
FT   CDS_pept        786559..787863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="YpAngola_A0770"
FT                   /product="chaperone SurA"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00639;
FT                   match to protein family HMM PF09312"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0770"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86854"
FT                   /protein_id="ABX86854.1"
FT                   /translation="MKNWRTLILGLVICANTAFAAPQEVDKVAAVVDNGVVLQSDIDGL
FT                   LQSVKMNAQQSGQQVPDDSTLRHQILERLIMDNIQLQMAKKMGITITDQALDKAIADIA
FT                   AQNRMTLAQMRSRLAADGLSYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQ
FT                   MGNQVSGDTELNLSHILIPLPENPTQQQVDQAEDLANKLVADIKGGADFGKLAIANSAD
FT                   SQALKGGQMGWGKLQELPSLFAERLQSAHKGEIVGPIRSGVGFHILKVNDMRGADQTIS
FT                   VTEVNARHILLKPSPMMTDEQARAKLEAAAAEIKSGKTNFATIAKEISQDPGSAMQGGE
FT                   LGWASPDIYDPAFRDALMKLKKGEISAPVHSSFGWHLIQLVDTRQVDKTDAAQKERAYR
FT                   MLFNRKFAEEAQTWMQEQRAAAYVKILDGSNAQPQ"
FT   gene            787847..788842
FT                   /gene="pdxA"
FT                   /locus_tag="YpAngola_A0771"
FT   CDS_pept        787847..788842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="YpAngola_A0771"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0771"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85335"
FT                   /db_xref="GOA:A9QZY9"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QZY9"
FT                   /protein_id="ABX85335.1"
FT                   /translation="MHNHNNRLVITPGEPAGVGPDLAITLAQQDWPVELVVCADPALLL
FT                   ARASQLNLPLQLREYQADQPAIAQQAGSLTILPVKTAVNVVPGKLDVGNSHYVVETLAK
FT                   ACDGAISGEFAALVTGPVQKSIINDAGIPFIGHTEFFADRSHCQRVVMMLATEELRVAL
FT                   ATTHLPLLAVPGAITQASLHEVITILDNDLKTKFGITQPQIYVCGLNPHAGEGGHMGHE
FT                   EIDTIIPALNTLRQQGINLIGPLPADTLFQPKYLQHADAVLAMYHDQGLPVLKYQGFGR
FT                   AVNITLGLPFIRTSVDHGTALELAATGTADVGSFITALNLAIKMINNSNE"
FT   gene            788835..789653
FT                   /gene="ksgA"
FT                   /locus_tag="YpAngola_A0772"
FT   CDS_pept        788835..789653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="YpAngola_A0772"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0772"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87946"
FT                   /db_xref="GOA:A9QZZ0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QZZ0"
FT                   /protein_id="ABX87946.1"
FT                   /translation="MNNRVHQGHFARKRFGQNFLNDQFVIDSIVSAIHPVPGEAVVEIG
FT                   PGLGALTEPVAARMDHMTVIELDRDLAARLASHPQLKDKLTIHQQDAMKVNFSELSEQA
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIRDMHFMLQKEVVNRLVAGPNSKTYGRLTVM
FT                   AQYYCNVIPVLEVPPTAFTPAPKVDSAVVRLIPHVQMPHPVGDVRMLSRITTQAFNQRR
FT                   KTVRNSLGDLFTSEQLIELGIDPILRAENISVAQYCKLANWLSAQSTPQK"
FT   gene            789667..790044
FT                   /gene="apaG"
FT                   /locus_tag="YpAngola_A0773"
FT   CDS_pept        789667..790044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="YpAngola_A0773"
FT                   /product="apaG protein"
FT                   /note="identified by match to protein family HMM PF04379"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0773"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87325"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QZZ1"
FT                   /protein_id="ABX87325.1"
FT                   /translation="MIEQPRICVQVHSIYVETQSIPEEERFVFAYTVTVRNLGRSNVQL
FT                   LGRYWLITNSNGRQTEVQGEGVIGEQPLILPGNEFQYTSGAVLETPLGTMEGHYEMIDH
FT                   LGQAFRTVIPVFRLAIPALIH"
FT   gene            790061..790930
FT                   /locus_tag="YpAngola_A0774"
FT   CDS_pept        790061..790930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0774"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase (symmetrical)"
FT                   /EC_number="3.6.1.41"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00668"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0774"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86859"
FT                   /db_xref="GOA:A9QZZ2"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9QZZ2"
FT                   /protein_id="ABX86859.1"
FT                   /translation="MSTYLIGDIHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPAS
FT                   LDVLRYVRSLGPAVRMVLGNHDLHLLAVYAGISRNKPKDRITPLLDAPDADELINWLRR
FT                   QPVLQVDDQLKLIMAHAGITPQWDIETAKMCAREVEAVLSSDSYPLFLDAMYGDMPNNW
FT                   SPELTGLARLRFSTNALTRMRFCFPNGQLDMICKDTPENAPAPLKPWFDLPRLVDPEYS
FT                   IIFGHWASLEGKGVPEGIYGLDTGCCWGGDLTLLRWDDKRYFTQRAFKAEAEINNNNGF
FT                   AAGEAVQH"
FT   gene            complement(791020..791484)
FT                   /locus_tag="YpAngola_A0775"
FT   CDS_pept        complement(791020..791484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0775"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0775"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87287"
FT                   /protein_id="ABX87287.1"
FT                   /translation="MKKSMLFLSLMLSAPYIMANELSSCPNKSEINYQQGGYTTPDGKW
FT                   FGASVGVENSGDVRHFLYVKYIPYNAFNMDIGRLNNCTYALASGSVDMYFYDERALALE
FT                   GVFVSLIGHMFWEKTTTSGKESYICTASSVNDCTFTRLDDDVVDDYKNRQ"
FT   gene            complement(791974..792093)
FT                   /locus_tag="YpAngola_A0776"
FT   CDS_pept        complement(791974..792093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0776"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0776"
FT                   /db_xref="EnsemblGenomes-Tr:ABX86939"
FT                   /protein_id="ABX86939.1"
FT                   /translation="MLSSLFLLSPFSSAIEITRCPEANEINHVLSDYKLVNLR"
FT   gene            792099..792299
FT                   /locus_tag="YpAngola_A0777"
FT   CDS_pept        792099..792299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0777"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0777"
FT                   /db_xref="EnsemblGenomes-Tr:ABX88599"
FT                   /protein_id="ABX88599.1"
FT                   /translation="MLIFFHFTPHGNKIKNIIKTLCKPAIRIYHAERKLKILNNNDVYP
FT                   LSNKFIFLNETGPLLPNGPVC"
FT   gene            complement(792326..792808)
FT                   /gene="folA"
FT                   /locus_tag="YpAngola_A0778"
FT   CDS_pept        complement(792326..792808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="YpAngola_A0778"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by match to protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0778"
FT                   /db_xref="EnsemblGenomes-Tr:ABX87808"
FT                   /protein_id="ABX87808.1"
FT                   /translation="MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGR
FT                   KTFESIGRPLPGRLNIVISSQPGTDERVTWAASIEEALAFAGNAEEVMVMGGGRVYKQF
FT                   LDRANRMYLTHIDAEVGGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERR"
FT   gene            complement(792945..793412)
FT                   /locus_tag="YpAngola_A0779"
FT   CDS_pept        complement(792945..793412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpAngola_A0779"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpAngola_A0779"
FT                   /db_xref="EnsemblGenomes-Tr:ABX85565"
FT                   /protein_id="ABX85565.1"
FT                   /translation="MSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGS
FT                   RMLMIHFGMNIELASLVASIMIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVV
FT                   EISHLGYSEALMSTMVTNFLKASFIVGALSIGLSLPGLWLYRKRLVYKAFF"
FT   gene            complement(793409..794209)
FT                   /locus_tag="YpAngol