(data stored in ACNUC9435 zone)

EMBL: CP000904

ID   CP000904; SV 1; circular; genomic DNA; STD; PRO; 417054 BP.
XX
AC   CP000904; AAOY01000000-AAOY01000182;
XX
PR   Project:PRJNA13623;
XX
DT   22-DEC-2007 (Rel. 94, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 4)
XX
DE   Bacillus weihenstephanensis KBAB4 plasmid pBWB401, complete genome.
XX
KW   .
XX
OS   Bacillus mycoides KBAB4
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
OG   Plasmid pBWB401
XX
RN   [1]
RP   1-417054
RX   DOI; 10.1016/j.cbi.2007.03.003.
RX   PUBMED; 17434157.
RA   Lapidus A., Goltsman E., Auger S., Galleron N., Segurens B., Dossat C.,
RA   Land M.L., Broussolle V., Brillard J., Guinebretiere M.H., Sanchis V.,
RA   Nguen-The C., Lereclus D., Richardson P., Wincker P., Weissenbach J.,
RA   Ehrlich S.D., Sorokin A.;
RT   "Extending the Bacillus cereus group genomics to putative food-borne
RT   pathogens of different toxicity";
RL   Chem. Biol. Interact. 171(2):236-249(2008).
XX
RN   [2]
RP   1-417054
RG   US DOE Joint Genome Institute
RA   Lapidus A., Goltsman E., Copeland A., Lucas S., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Bruce D.,
RA   Pitluck S., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Mikhailova N., Richardson P., Auger S., Galleron N., Sanchis V., Gohar M.,
RA   Broussole V., Brillard J., Guinebretiere M.-H., Ehrlich S.D., Lereclus D.,
RA   Aymerich S., Nguen-the C., Sorokin A.;
RT   ;
RL   Submitted (03-DEC-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 393bf442c5843d936ad0372991e113da.
DR   BioSample; SAMN00623031.
DR   EnsemblGenomes-Gn; EBG00001440324.
DR   EnsemblGenomes-Tr; EBT00001818310.
DR   EuropePMC; PMC2504315; 18587153.
DR   RFAM; RF00162; SAM.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000415
CC   Source DNA and bacteria available from Alexei Sorokin
CC   (alexei.sorokine@jouy.inra.fr)
CC   Contacts: Alexei Sorokine (alexei.sorokine@jouy.inra.fr)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Notes:
CC   Bacillus weihenstephanensis KBAB4 was originally isolated from
CC   forest soil near Versailles, France, and was originally identified
CC   as Bacillus cereus (Vilas-Boas et al, Appl Env Microbiol, 2002, 68,
CC   1414). More detailed phylogenetic analysis, using MLST, of the
CC   Versailles Collection of B. cereus and B. thuringiensis strains
CC   revealed that the strain grows at low temperature (6oC) and
CC   clusters with many other strains able to grow at low temperatures,
CC   including the independently isolated and characterized strains
CC   WSBC10204 and WSBC10206 (Sorokin et al, Appl Env Microbiol, 2006,
CC   72, 1569). The latter two strains are the type strains of a newly
CC   recognized species in the B. cereus group able to grow in cold and
CC   having the species name Bacillus weihenstephanensis (Lechner et al,
CC   Int. J. Syst. Bacteriol, 1998, 48, 1373). Since, by MLST, KBAB4 is
CC   very closely related to WSBC10204 and represents many other
CC   psychrotrophic strains, it was assigned a species name Bacillus
CC   weihenstephanensis and the strain KBAB4 should also be considered
CC   as a type representative of this species.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..417054
FT                   /organism="Bacillus mycoides KBAB4"
FT                   /plasmid="pBWB401"
FT                   /strain="KBAB4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:315730"
FT   gene            5..1597
FT                   /locus_tag="BcerKBAB4_5433"
FT   CDS_pept        5..1597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5433"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46425"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ3"
FT                   /protein_id="ABY46425.1"
FT                   /translation="MTLLLNKHTTSMMSMLPQWMKMAKDPKSVGALFLDAFGVELSEIE
FT                   RYIEQAWNDMYIGTTNLQKADYCYKIPLATRDVVDIETLDLHVRLVIDGVRRDCMPADT
FT                   LRLFFESDDNSYMIDTIEGYVYIKVMDYYMKDNIFKPFDAIEVGDTLHYEYMLHHIWNV
FT                   FDEFGMLLGISRLPGERNGDFKNRILDVFKNPGGATKQGLINGISRELGIDKSEVKLGS
FT                   LSDDKYVQTKLMNTDGTPSETYIQYVNQINSNLGFSWDHMNWGEAYWRSIEENNMGFHY
FT                   LPHIWDGFSASWKDNEVQSGIGSGDDLLVTAPKEESPVREFKTYVGLHGTEEQIEENHP
FT                   EIQFKYKIVAKGKIPNDEYELEDYKYTVMSSEIIPLHYVLVALREFLYQTHITWDNRYG
FT                   YTFSDNTSPGMEVVTGEDVLHNNEEPQIKIHVDMKTADRTVTPVLEELIVDWIDQNDAP
FT                   QSYKLTTDEDFTLNNTRTQTTLADVEVGNGSVTLGRGSFSAVIDTEGSFLRGSQGISVR
FT                   VNREGSLSLNLPN"
FT   gene            1615..2730
FT                   /locus_tag="BcerKBAB4_5434"
FT   CDS_pept        1615..2730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5434"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46426"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ4"
FT                   /protein_id="ABY46426.1"
FT                   /translation="MAETGSVQNAVGNNIYPDLVLTRFPELFDERSGSKSNPNLQRWTN
FT                   LKDYNMAEHVNSLQDATMAIQRMLGELAQMPAAPKDANGKPITDPNVLLNLKRTSTVKS
FT                   RIDALETHDWYAEFDKRYGGPVWKFDKDKPTNPTIQQHRHLGSASGIPGMPEKIVLTEE
FT                   VQGKLPKANVDLTKTATGITGSDIYVESTSNTKVSDAINDKISETTGGTIAQNAELEVL
FT                   GKTNTRWTREFDSNDASSTGNTAVADGKTLLNKAIESGATAASDLLNAPLDGMHYGRYV
FT                   AIVRLSASSLPSNGLVEISAVNSKTNQVINKTTLNGTDFDTSGQYKTFYLIFNHDGSTK
FT                   IRVRKLATTSSVKVRFDYAIVEPVHPAVFDR"
FT   gene            2748..4931
FT                   /locus_tag="BcerKBAB4_5435"
FT   CDS_pept        2748..4931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5435"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46427"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ5"
FT                   /protein_id="ABY46427.1"
FT                   /translation="MAKRPEGLSPNFNSIVSPDVPSSFIFSWTFIKENSSDYQKDAEVK
FT                   VYKTGSNTALITFSSGTDNQVDITSHQGVLDPEQNYEWEVKVTAANNSTAFSGRKRFKF
FT                   GNIFLQDGLVWPDGPDAYEYIGTRKYFNEIKENAASVLEDYVIDSREENDALEKALALF
FT                   TRETVPSRTDFENLESILWLIAKKESTYQDEIQRLIEDGLGAQDIHKIYTLFDRLVKIP
FT                   PKEPSNVYLSFGGFEKLYVKEGKAYNNGKEDLSVDINWKPSDLKSGTCTINFLNELTED
FT                   VSYYRVELEVGFTDEACTHTLLYRVEDIDSLGRKIDIPMDHISFVHLSSSKETRYVLRV
FT                   YAVDKRRKQSTNYYKPYNVNNVPLGVASYNLRVQQNDLSNQWAIQYYHDIYNGPNTAYV
FT                   HNVTGNVDGIYHYAVRVFDINGSVSDWYWFPEQIKIDPLKPPSAPKPYLNWSTQTELEF
FT                   AWSAVPTAEYYEYIPTWWQNPSTQRENGLTTKHIWLNYDTTYVQKVRAVNRAGASPWVT
FT                   VSGRTKPRPIVEAYQKGAGSRTWRTDYVIYKQNGQVRKNSSEWRYEYDDNEVFHGEWVE
FT                   LRNKIQDGMAVKKGTRWGNNKCLFFLDHNDWRQKLQGKEILDVQLYIRRRNTEHGYPED
FT                   GRFLHVWAHNYAGKWDLPSGSDGPDLNNHQKIERIDFNRGESHWISLNKSFGEGLRDGW
FT                   IKGVAFYHPGADYGPYSYMRFDAYTFQFYVKYR"
FT   gene            4977..8276
FT                   /locus_tag="BcerKBAB4_5436"
FT   CDS_pept        4977..8276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5436"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5436"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46428"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ6"
FT                   /protein_id="ABY46428.1"
FT                   /translation="MAQYQRNFYSSSLYGRLKAFYGDYLTEEFDAQEPFSYHIDAKIQA
FT                   QLPSTFYAATSREFTRIDSTKWTVSGKDIKTRTANTPVEFLATGDNLEVHVRLQNVGVQ
FT                   NIEAKLFKEELVAETYQWVEKQTKTINTLSLTNPNKVDKIAFDSYGFGDYKVVIQALDT
FT                   TADAIIVGGKLRTSDFNIEIRTSANKTTWSKWEPITLTKTFVQGQDYLCTGQSATLYKN
FT                   VRYVQGKIILLSSDNATSPIIDKVELRSEDSGLYDQDGDYTVKIDLTQVATSVGKIFKY
FT                   ANKIRFIQKQPIGTEMNIRSSSSRDNIFWGPITAPYRQNTNRLRLKRGATNHSVTLGPI
FT                   NEGNKFDFSKTTALLNWDTQAFSPKDASNTKISYIFSKTRTNQKDPRNLLQVIDNPMNV
FT                   KDRTMKFSPQPYFLTVEMTRSSVRGTPVVDLIDVYQNILYKEIVNVINKDVSAVDSLGT
FT                   GIKSLQKISDYAFKYPSTSNQIPFNQQQITSAQQRYELTDQTRRPSDVMVYLKSEESKG
FT                   SRTGKSIAASDEVIAKAIQRKLEFGEKTGVLMHYQYGAGKVQYLRPYERELDSTFTPFL
FT                   LSNLKYRYYIQNGWPNELHKVVNGQTLNDVAAMYNTTVTAIKANNKDILLNEDGTLVKD
FT                   QLITIPNISKNSKVSLFFKNGTPYTQKSSHNSLYDKDHGVNVTDFSSEPISIKVPTKPP
FT                   KGYVDWASEEKIYTGVINANDIRGEFVRTQFNLSTLSDFNREYVVVSGDTWESIATKYD
FT                   VHVQDLKMTNDSIEELKVGNTIIVPPNIILPALAPEAEFENAMPYEISIIEDSVHKKNG
FT                   VRINESFIPINWNGKHLPLEVTYRTSELLTAEMVRNADANGMDPLPLSDVAEIVSCKKK
FT                   VGSVTYHIWNDTLKTGDFKLKSNYIDWSPSQAGVLEPAAGEEYIVVYKRREVNTVKVHL
FT                   DTTFFEKMGTDIVWRSPEVKVFDGVCTPTEDFKLELPTPQSFEGYDGIYKNIGYIIEDN
FT                   DLWVETSVQDINGKKFLVGTLNGKDPSKNWHPEIQKGYYYLKEQEHYLYSEPLKTVLTD
FT                   KELPTADGIEYVNGPTGIGAMLLPASSNMVKDSVLENDSWKKAKVFNASSF"
FT   gene            8379..10856
FT                   /locus_tag="BcerKBAB4_5437"
FT   CDS_pept        8379..10856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5437"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46429"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ7"
FT                   /protein_id="ABY46429.1"
FT                   /translation="MFTNSGKIIKHATIPGAITFQSAGYVSISNELYEDSKVVFSFSKP
FT                   TEKVALIPKYLSDGNFLFASLDKENKLHIGGIVKDSEKIYGVVDVKDNILDSNTLTVSS
FT                   NGSHFTVTLNNKTVLKFESALFVNGQVRVYGEIGEVFNSCEIQEPQSTAWTSNANGGGV
FT                   EAKTIKIEDHDYVKLVGSATKKAMFSQSISLLAKDYTLSFNAQGNGEYLIKSGETILKQ
FT                   IAISKGELSYISQTFNLATPQTITLVFQTSEILIVGKHQLEDRVDPTSYIPNPSISSSA
FT                   TRKGSALKFPVKNLFDKKAGSIYLKLTTKNRMDRDQTIFCSDTREMSLSVHGTNLSYTV
FT                   GASSITLPKTLEGNTSYEFLCSWNDEGIELTVNGENAKALNTGLLLTTPQELIFANEET
FT                   PIQEEVVLEEWALFNNKLPANSNIKAQLPFAVMQSLFDGGISGQNVTWSEIPVAPIDHS
FT                   PILVQKENGDTLQKVSFFNHETAAYQTWNQEAFQYDGKSDFVEVAYNNLDEQFRDIAIR
FT                   TEDGEKIGEPYRIDGKRFYFSLHTNRKAVLKSKTLYATYQVNDTYTIDYNIKAVDGYRI
FT                   DFAKHDGGKRIVYQEGNRYGEPKKLATMIDMNPIQNQNHEGFLYITNTINKTDSFRITA
FT                   TPDRLHADGASFSTLIIEPLDYQGNFLSHSNLEIIASKGFVSRHISRDAVEAQKRSGQY
FT                   LYQYHAPYIQSKRAGEIVEDYIWITDKDNNIGVCYKMLLSPVSKPDKVQLTQVEKNLLT
FT                   AKTKIINYLLMYEGVERYEDEVLFSILDFNQDGRVTMDEILVLETNQKDNELTVILNKL
FT                   KEWEDTNHAVATS"
FT   gene            10837..15351
FT                   /locus_tag="BcerKBAB4_5438"
FT   CDS_pept        10837..15351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5438"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46430"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ8"
FT                   /protein_id="ABY46430.1"
FT                   /translation="MQLQPHKDLVRSGQRNRGYAIRIGNKVPKNSANLAYVQSKSVSPE
FT                   ENILLEDVSSQIKENGLSNFIEKDYMVYPNNKFLLETESGQAIFPTDAVFVTDEFTIRK
FT                   NRQDTPKPVFYQMELKGRFDARTSQVIPYLGGFSSETEQDAIALEDVVLDKRNDLIYVG
FT                   NSIRIEANGGPIQEEDEYKVQLIREDNFIYRIVVVTNFRNDKDVTYKVVYPNYRNDIKQ
FT                   SELKEEVLNAYPFFEQVTMDQFEDIVSQMGSDPDKYKHLKVYAIEEKGNDFSFYATSDV
FT                   MIANYQTRTPQLFKHRVEAKLKTKLSETNPGKMNIGFSFVQSVANVENLSSIGKAINEH
FT                   LSLPKYVELQNPHPTEVDLLKKDIGYWAVNLDMPDHHYEDYDLLVITGYGKADLSMFKD
FT                   KFEHYLKNGGTIWIDNAGSGINVLDFKTSKGNTFVSDIGFSSSSNEFGVKEITKDSPYT
FT                   SRLLPIKNIEALGYTDIAPTILFGQDEESKQWDAVVKHFNGGPSIIKKTLFDKGTVLVS
FT                   NCGIFRSFYHNQKESVNLVLNSILYHSEEQWVFTPWRNDFVYHRDNLFAQEYKVNNTDV
FT                   YINDRSDYNANQIVAKKILYKNCKEYVKIYCKPWFYNAIGTYEHAVNGDKSIPVNNSGF
FT                   ESGQVDSSGKPIVSWTSDTVNAIPSWNTKKLAGQTVTFTHDSDKSLFGVRQVSLNSSNG
FT                   TTGAHAYWESEDIYLSIDDYKVTVWTTIDQVRGVTTDGIKIGVYNLQGEQISSSISITG
FT                   KKDWVKLETNFHIDKPQNIKIRLGFVDGNGLGKASFDNVTLDTIGAVRGVAQNEGEKTL
FT                   YAFSIKPNATTIDIEAEGFGNANITRATPEVSFTYTIMPFILQWISYGIDSGTGLEYGR
FT                   YERMYGPPVSYSKAIRKTDGLKNLGYLHTLLPPVPSGKQWYDKNKIFYKIALGSENLEE
FT                   NNFVNLKLFDRKTGMEWFYSGDLVIGHKDIFWATDKPSFVLHAETGFETIRASKRNFGL
FT                   KLIDDRRIYSELPQTKDAKENWYLRIHNGQFIKDGLGYKEWSELHASNNPAVMNQYKER
FT                   VMKKEKYQIDEYASQIFNPSIGIMTVENEMEYLTPSTVKVPHNNLFVSQGFVEKEQLLV
FT                   EGLANSVGTLFRAKQKDWLRNDKVHIFIDVSNNGNIVEIFEEYPFEINLDEGTVFFPGR
FT                   IITGKVYATYEHRNFRLYKRIYKNTKMSNDLLENKRIDSVTKEVIMYGSKENWLIQPIP
FT                   VLKTTKGKATSANTIPATNYRIDYEKGKVIFKFEPVGPVYADYGYFENQELSANDYDIQ
FT                   NGIFFLKENISFKDDLFAKYSYFDNFYEYKGFYNETLRTFLHLDLNPSVGHYSTLPMTT
FT                   YVNGVQKVEYKNVPSSKLLNKLIHIYIVPDSENGNSIRHCFSREEWRNIQQSNPMYLLL
FT                   AKVQVREHTNVKDVVVMDARTRGGGISASLSTKAIDERVHGRQRYWDIGNWEGKAFYRN
FT                   GVLIVTLPKSILTEYGGTLSEEYAKEAIDKHVAYGTYCIIEWE"
FT   gene            15649..19167
FT                   /locus_tag="BcerKBAB4_5439"
FT   CDS_pept        15649..19167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC1879 uncharacterized, phage-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5439"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46431"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ9"
FT                   /protein_id="ABY46431.1"
FT                   /translation="MEKELIFPVPYSEFDRKKDAEYDGDPNGDYVMAEDVNELQESIEK
FT                   IERVINFTELESTVSDELNKKVDKATMSDFGSPLFVGYRGASINAYDSIEKRINAFSYI
FT                   PHVMINKEESTNFDFFVNEVKKSGTLLYGIINYSDVILNNIEANITWFQSKGFHGVLLP
FT                   GFGFENGWNRSQQNQILQYIHARGMVAVITGEIDTTLFNKPHKNNPQQADLKTSKDDIY
FT                   LAQDVFVLNGAKNNPIVIPSVVFNLNKAQKERGIQIFVEDTADASSDNNKLYLYGKMLS
FT                   TLYNLDGYSLVPKSRYALNEKVERYLHGFELGKWKTQNPIYVEEATATSRSFSKGSILF
FT                   DKVKNECYIKGVGLNPSIYTWQDKQIPGNAIDFASAIYGSEGVKTLVDAINNNDHKIHY
FT                   SKIDGMEEGGVTPDLFKDTVIRAINNSPAAVAKNPPKGYDELAGNNFIHGGVIDYIDAG
FT                   SIKSGILNIDAIKTNIIEAINAYIGTAKINTAVIGELSADHIAANVIDAINIYATNISS
FT                   SSAKINTAVIGELSSDHIKGAVIEAVNLYAGEAVIDSAKIGQLDADHIKATVIEAINAS
FT                   IETAVIDSAKIGTLTASHIKGMVVEAINLYAGQAKIDAAQIGALKADNISAGLIEALEI
FT                   SAGSADFDRLQASVIDAINASIEHAFIDGAIIGEGTVDSAQIADGSITDAKIVSLVANK
FT                   IVAGTIDTGQVTLQGTNGHLRITGNRLQVFDNQKTPIERVSIGDVNADGTLYGLRVRGA
FT                   DGVTVLYDEKGVYSEGITDGAITNPKIQEGAVDGGKHIAANTVTADKLVAEAITTRELA
FT                   AKSVNANHLQVGAIVAGSGVIGEAAIGEAEIAQASITDAHIKKLSADSVSAGSLQIQSR
FT                   NLVSNSTLRKGLLDWTTDPILDIAEVSEVVRLNTTNSMHLFTTGKQTQNLSAYSKFVPA
FT                   SPGENYSASVYVLTKNILNYDGGHPRVEIEYFNDSARISSKNTAAQLTSNDLWQRISIT
FT                   EVAPAETTRVRLRIYHPKNGDSYFCRPMLQKGNIITEWTGDGSYMTEDGFYTGDLHAKQ
FT                   IKVGKIKAEMLQIGPDTEFEPGYSPGELREEMKDRIPYRVEILSTNGIAFKGGNISTTL
FT                   KANVYLGAENVTDQMDAIRFKWMRVGRNGEDDLVWNAAHKGLKEVPITRDDVYQRATFL
FT                   CEVLDS"
FT   gene            19253..21001
FT                   /locus_tag="BcerKBAB4_5440"
FT   CDS_pept        19253..21001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lla:L21300 prophage pi3 protein 11"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5440"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46432"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV00"
FT                   /protein_id="ABY46432.1"
FT                   /translation="MAKTLATGMISIVDFNDAPSLSAFVSTTSPKTQIYDPASGTYTPN
FT                   WTSAGPTLTPSLFISTEGTTDAISSAKAVKWYDSIDTSKVIVTGGAYTVTGNTLKISQN
FT                   IMTGSTYAKTFIAEIIWTDPTTLADLVVRAEFTFSRADNGKTGASAISAVLSNDSDVIP
FT                   TDSAGNNGNFTGAISTMTIFEGATDVSASWTVAANPVDITGTLSGKTYTVTGFVAGKDT
FT                   GYVDLTASKSGYASVTRRFALSKSKQGISGTTPTLYRLLSSADAIQKNLAGVYTPTTII
FT                   FTAKSQTGSGAYGDYSGKFTIEETTDGTTFTNKYTSASNEPSKIHTPSAGIKAIRVRLH
FT                   IAGVTPNGSNHIDEQTISVVSDGATGVSGADAVLVSVWAPNGNLFKNDLSTSLTAQADL
FT                   YKGATVQSSGVTYEWFVQKSGNADEGAGTGWDKIDATNQASYGVTGAVNTATITVTAAG
FT                   ITNLAAFKIKATYSSKAYYDTIIFYDQTDPIMVSVESSNGNIFKNGSVSSQILCRLFQN
FT                   GEEIDPKLASATTGYKYTYTWTKLKMDGTQDMDFGGKAISTKTGKWIDITDADIFQKAV
FT                   FKVEIS"
FT   gene            21064..27585
FT                   /locus_tag="BcerKBAB4_5441"
FT   CDS_pept        21064..27585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5441"
FT                   /product="Carbohydrate-binding CenC domain protein"
FT                   /note="PFAM: Carbohydrate-binding CenC domain protein;
FT                   KEGG: cpf:CPF_0969 KID repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5441"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46433"
FT                   /db_xref="GOA:A9VV01"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV01"
FT                   /protein_id="ABY46433.1"
FT                   /translation="MKGREYMPYAVGQITIVDLNDAIRSGTAPKNPVDGMLWIDTSVTP
FT                   NILKSWNAVSNKWVEQTLSIGGLDPNFDKDVQNLKKFVTDASNDGIIQTSEKLNVKLLL
FT                   VEITGDILAGTTLPTLATIDTAKGGQVYLARAEARAAGIPITHADYTAFETSYNDLKTY
FT                   LESLSPRPWQTGNTTIVPATWTSKWDLYYDKLTKLAVTTSTYLANSIKPGEDYNGVTIN
FT                   TDKGIVVLRGDNLFRTILNATEGISIEKNNAGTWNKMFYTNLDGKIYANGLVISSDSTI
FT                   AGTDANTIKNNAAAGKAGIDDLTNDLKVTPSEKTTLSREWESIKAEYTQVLAQATSLGV
FT                   TTATYTTSYTNLDGVTPKIAAEVLASMTSTYTFASASTRDAFRAKINTYFTESEKIKKA
FT                   INDAINESANNANDKIDNLKIGSRNIVRKKQVIPINAASTSYDEATNTWTLTANDGAGG
FT                   AWGAGVRITDKFSVIPIGSWYTASFEVYSPVDITWNNDTNNFPIGTSSGTNDNDEVALR
FT                   KNSGRNIKANVWTKCWFSYKNKDNSTTELYDQSNIGIVNNTGAPITFKIRNVKGELGSI
FT                   PTDFTSAPEDVDEMIANISFSGRNLLLDSNTDFSTTGYLINIYKLSEDWIVGQEYTFVI
FT                   KGTVPAGQRLGVWQNGGSNNMGYATTTYVNGVTYVTFKAIAPTSGQERTLSLYNYPSNT
FT                   TLSNVDWVALYKGNKPMDWMIAPEDIESIVKLQSSGAANMFRNSGSFKNLNGWILNAGK
FT                   SLNIAEKDGFTVLEAVGSITSTNHVTRNVLKPSTEYVYSVEIMFSKDTNIDNTKPIHHW
FT                   FFDTGGNYNAVDSYTLISNDKVAKANTWTRVSIVFKTKATITDAAYFKAFVYDNVQLTD
FT                   DNKYWVKNVMFSETNRAVIWSPSLADIEEMVANVSVGGRNIFLNSGLQQGAKYWYSNQS
FT                   QTEIVNDGSEKAFKFITNSGVVNGGIYQRQGGVSTGSLPFEKDQDYTLSVLLKSSVSGQ
FT                   KMDVGAEGISLSLFTIGTEWKEYSFTFKGTGAGNGTIIFYTRSAPDNTQIFVKRMKLEK
FT                   GNKKTDYAAAPEDTDQAISEVKDSVADMTSDMKITPLEKQTLSRDWESIKSEYWQVLPQ
FT                   GQAISSVSTTAYSTAYTNLDSVSPKIASEVLANMNATYSFASTAARDLFRNQINKYSDE
FT                   AEKVKRAIAEATNDANRELAQAISTGKMMFTDPIFKNGANNIIAYNNTSGSAVTATRVS
FT                   KPSDAPTTSSSVMEIKTTGAASPGHGGYVQNFNARSGAKFLVRIIAKIPAGCTLNVASN
FT                   SMGTGYTDKILTSNKGTGKFEEYIRLITCGTTGTFSNGGHFYLTSGLTATPEAPITWQV
FT                   AFATAYDVGDADYTVIDNKDKWDSAANDVKQGQVVINSTFSDWPGSFPNGLGSWSGSTV
FT                   SKETTLTRTGNAMRFNVPADNSQIGTTILPSFFIPNLPNNKYYAVELDFMLVSGAITGA
FT                   CLLLDWNGMSPSRTSIHLSDVESAPVLGKWYTLRAVMKRPTDNVTGYTGLAGFLLANYS
FT                   GSTTNKVKNIVFDRLVFREPTQQEIDAYEITTIENGKTVIDGGKLKTNSVKAESVDARR
FT                   LRVTNNSGLVTLEITDTGEVTVNGKVSINSRTDFAEGFDPSKNDGGRNILLNSRFSTAD
FT                   MTSWTNWGAPSVRQVEDITDLPGFDKAVKFTTTANNQGLNQNVSVINGKTYTLSSYVKS
FT                   ASGQPVLQVYDGAGYPSVVMNSTDVGKNKWVKIYFVFTAKANNVRLDMGKSAGGTLGTY
FT                   WFTGVKLEEGDKSTGWNPANEDIDGLLGKVVAPNGEIKALDIASSMSITPGAIDVISSS
FT                   INLKGKVTFSSFASGWALDSKGNKISNSDQPDYDPKNPLYLDMDGNYRPLTDEKDFMSS
FT                   LFTKDDKTGVTVIDGNYIKTGTIQAKYANFRDVQVYNDQGQQTFRIDTNGNLSTSGTSQ
FT                   SIGYERQKKGWKIDADGSAEFNAATFRGDIELGYYNAPTNAFVVTGGLLSSVGGTGKDL
FT                   RFWAGANKSTAPFKVYSDGTLEATKGYFTGTFSGEVVVGNISIRDTPTKGDAKIILTDD
FT                   SKIQKVVLGESAVELNTKTTFGNFLTVDIDNQKLDFGANDFKIDYTNNTIKMKSFSLKG
FT                   TTALEFISDGSSGDDFVFKNVTGDTSVRVDGSFIARDDIEITNVLRMKKATDTGNKGID
FT                   YVFI"
FT   gene            27615..30392
FT                   /locus_tag="BcerKBAB4_5442"
FT   CDS_pept        27615..30392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6767 outer membrane
FT                   autotransporter barrel domain"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5442"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46434"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV02"
FT                   /protein_id="ABY46434.1"
FT                   /translation="MELFSALASGSGPTMLYTVYADETSRSANSVTYSVTCWARLQNQT
FT                   YDYFGAVVYPKINIGGNTVSFANLGTFPKGAGAKFSTISVTVSGISATTSSVSYTFSAT
FT                   SQLGGTSSSTTGYVGGKSGTVSCSIYATTPWLSGQIWIKDGSTTVDSYYRENLGTGSFV
FT                   LNWSGANGANGTLTYEIQRQINGGAWTIVAADNNGTFSDAPGAGANSVRYSIQAKNKVG
FT                   TDVMRSDWIYSPTVYKNELRSPSLTSSAYVSYATRTFTLSLGAASDNLGSPISYTLTGI
FT                   ASKFTTINGPGGVSPGNITINANNGSSGIYMTIDNLKTAALNGTAHSDTNYYIGSIDLQ
FT                   VTATNGKGSSKTDTVSIPINLGMDAPVSGTPSVTIAATSYYLINTANYIFPEYKPVSLT
FT                   IAGAIKDMLGRNCSYDIVMVEGNSQSIIKNTGIVTAATTATVNHVESGLLTAKKNVSFY
FT                   VRAQTLGNEGKPSAQTPKVDLHYYKKPSVTSSDLSRITGKSTFKVVVTPSNSLGGATNT
FT                   STMPSGYTKGTSSIASGVETYTVTSSTTLADSYTALISVVVRDSVGYILSSNGSNDVTL
FT                   KVTIPTFTPALSIRERGIGINGFAGTTEKLYVGGNVKLTGNLIVGGIIDMGNTNIENVN
FT                   HITITDPGGGEGLEWKDPTNNWKIVVAPDNLGNATGDLQFARNGVRRATVRANGEVAAV
FT                   GGFATINPSNTNASVSLNFLNNIARIRTGGTGAGADNGFQIHGTGDVIRWSVDGAGTVS
FT                   NYGHLQMFNGKEIQFMNRSGMAFDGNGNMKPRDLLTHAAGAYWWVNDVNNNYPLKVWTG
FT                   ANGGYADVRSRPFTQVTAFTNGWADYGSFGPVAYTKDAAGFVVLQGLLRGNSGTSGSAF
FT                   QLPTGFRPSTSRIFNVVNGVNGHSRLDVNADGTVVMQGGAPEFCSLNGIRFLPA"
FT   gene            30409..31095
FT                   /locus_tag="BcerKBAB4_5443"
FT   CDS_pept        30409..31095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5443"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46435"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV03"
FT                   /protein_id="ABY46435.1"
FT                   /translation="MENIENIEVVGEVGIVEHPIFIEKEEPVELPISLEVEHPCWEVDE
FT                   EGYVVEHYLMSDSKIEIALSEGRRVLKSCWKESFYKPRFDEAINDWVEGADMEEILNLF
FT                   KTNKFDELNQACNKDISGYFDAPVGSETYTFSFDGEAQANFIGSLALFNEGLMKEVEWT
FT                   AWKGEKPHRVNLSKEQFMNVAFVAYQEKDTKISKLRNTLQPRIEACTTIEEVQAIYWNE
FT                   KPTLLA"
FT   gene            31169..31381
FT                   /locus_tag="BcerKBAB4_5444"
FT   CDS_pept        31169..31381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5444"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46436"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV04"
FT                   /protein_id="ABY46436.1"
FT                   /translation="MGQQGNTTNIDVNLLIKEYEATIITLISENVKYKTLLKQRAIEEQ
FT                   QRQEEMMRHEAPPAPPAVPSEEVVA"
FT   gene            31461..31853
FT                   /locus_tag="BcerKBAB4_5445"
FT   CDS_pept        31461..31853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5445"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46437"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV05"
FT                   /protein_id="ABY46437.1"
FT                   /translation="MEVFFCMTQVRIRSITKDEKSPWVYIQEETRQETPKANVFQVKAE
FT                   PVIRRNTKTNQYGRFRYSEMQYGRIEAILASALEISKSPMRIRNQNGEWVYIQQTTIDG
FT                   ACPAIRIRNRYSEQAGPWVYIQHKEV"
FT   gene            31856..32605
FT                   /locus_tag="BcerKBAB4_5446"
FT   CDS_pept        31856..32605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5446"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46438"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV06"
FT                   /protein_id="ABY46438.1"
FT                   /translation="MEYLDNYLSVLPNYDRKEVEQLLQENMDLFDVKVITKEEFEALIQ
FT                   QLANRKEKVTTLTTTGEKVDAEHFNQIHSNVALDLKRLYNSHLIVEKVIANYDRILRGT
FT                   LDDVKREVDSLSTRVEELNLKAKGEDGLVVKTYGFEEKEKSLYMETDHDQYAHLFLDRD
FT                   GKSLQSASLNRSFHQHYLSLPIREVENTMQNSNGATTAKIEVMYQAPNSISDKNHPLEH
FT                   AIDDSLETYWAQAVKTNASAYTEIKKL"
FT   gene            32621..33568
FT                   /locus_tag="BcerKBAB4_5447"
FT   CDS_pept        32621..33568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5447"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46439"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV07"
FT                   /protein_id="ABY46439.1"
FT                   /translation="MPTPIYIEQHYSLSVSEFEGLWEMTFMHPYNRQEHFSIYLVAPNS
FT                   DYEHAELDDRPIVEAGPRLTEVLKRLLYKIEYYPYSWDFAGKKIVSYGYDFETDFTGTS
FT                   LTYIDLTEIALKEVNEFYNFFSALKTDVVDETEKVSGKGVMAKLKITLDKPKTVNHLFI
FT                   DFFTEYPIELLSLMYQVDQNEESTTYEIPLSKAVQTNGSIYLHFSPVFAKTFYLIIKQE
FT                   SYTLLDQSKKEEEVMKAELWDQASTRSQSIYESAVGEYVDQLFSSKSGIQLHQEILDSY
FT                   QNINVSHASISSDPMNLYRSDFEQAKRSLDSQQR"
FT   gene            33583..34797
FT                   /locus_tag="BcerKBAB4_5448"
FT   CDS_pept        33583..34797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5448"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46440"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV08"
FT                   /protein_id="ABY46440.1"
FT                   /translation="MVNSFESASKPKTTLLQSQSATSSTTPGPLPPIVEGIGSSNRTNS
FT                   STEYVYQYGIKNLQLNHSLYEQAGIFVTKPIEVEGNIVEVSLSIFEDHPLFNELNGMAT
FT                   DRVTSIEYYISLEENPSLNDWVSILPEGTRNVRCEKLFFRGSSAELRFHADISDEDNTR
FT                   VYRNNILMNRSDWYFTERGAAIQLTVPHDNSSIYTIDYVPNANLFDPWTVKVGDRFSKR
FT                   VRKVESFPNGTDYNNTIKLSKYPYVDYKQVNSEESYDPNTSDYRPIDVFLTSGSIVVEG
FT                   GKTQQEFFPISYSSKNEFTTKNRTDYKTNKDVFLNKYSIVPDSVYNTFEYKQEKNKLIF
FT                   TESFNRSDLYYNEATNHGNATVVVHYDYLVTNFRLKVILRKNVGDELVVTPMVDSYQLK
FT                   FKVMK"
FT   gene            34810..36591
FT                   /locus_tag="BcerKBAB4_5449"
FT   CDS_pept        34810..36591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5449"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46441"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV09"
FT                   /protein_id="ABY46441.1"
FT                   /translation="MNAPVIESKILEKQREYLLEQAKLRLSISATQEEVSQLADEIFYR
FT                   YQSCIGKPLFQARKVVFGELPFLEDYYDNNKEMEKDLGILFSELNTIATYLVDYFNYSQ
FT                   SEKDRILSIVRSINGVVSDLQMLTEETTPNTVYLKESFMNYDNVDSVLTPVENRSMIHT
FT                   QEGVLTLRRTNALNRSIGSKVRTIQGNGIAGTYYLSRKVQSDSEFENYQYVSSQIKNDD
FT                   PKALIDGNADTVFEFEMVNIPESYKKQSFYYDVEWAKGKEHGDLLRVKIVVQLPKSETI
FT                   NWINLNPYHAAGSPGTANVYSIRTSNDGIEYQGLFEKDQFVLNQEINKTPQSYRAEDLF
FT                   DGSENFAKTKFSGQGVWSFPSREAKYIEFVLEQPNSYKELLGQEAFYRRKKDSTSFTRI
FT                   RKQEVPSNIVDEKYGIHTINSDYEIKKVLEAVEGWRYVIGVRDIDIMSFEFAEMSEYIS
FT                   KPFLLEDGIKKVLLYANEKVPAIYKEKVSESNDWIQYFVSFDDIDWHRISPQHQQPVND
FT                   KFPAKVLSVNDNESDIENAFALYKQNLQLKELPKQVRLKIIMKRPEKTTEDEIPLLHTT
FT                   PLVEDFALKILTEQKGV"
FT   gene            36595..38649
FT                   /locus_tag="BcerKBAB4_5450"
FT   CDS_pept        36595..38649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5450"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46442"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV10"
FT                   /protein_id="ABY46442.1"
FT                   /translation="MSINIRQKRFTVAVNQILQEELRKGNLPTSKEFASRLNKLLRDQE
FT                   LGAPEYKFKLIRNGELAESDFFNEVVGKIQKDLMILYENTIAVHNQLKGKFHWFEVEKN
FT                   RLEYEARRLESELKEKILLYGKTGYLASIFDTFDDLSKIDSEDNVSIDIKNHQITLKKQ
FT                   ENTSFLINPASEIKFVMPKSSVSTFKKIPISGKIEQALNANTNETFQEVWLSKTEGPAD
FT                   GYIDIKFNDKQVLNRIDLSLHTIKSATVYIEFSLDELNYFHLPYYPDGKQTGNNVSFYF
FT                   PTTEMKNMRIWIRKQESDKEIVHPEGYSYQYLFGVKKIQFFQLSYPERGEVVTKFLTPK
FT                   TDETFSIGKVSLVTEEEIPDGTDIEYFVRVDDREESWKQISPVNRDTAQAPNLIDFKYV
FT                   VHASPTNLGIRKNIGGQESEIIELQANGVAFYSLGSIEKRKIVPRTERLYMGKDAWSVQ
FT                   KTVENFGETHIPSLDDWKKPSNDIVRNVIPIQEGHRGLILQDEQFTQHTQLYYGMGIFY
FT                   EGKEQVLSTIPSSTEPIAIFLNGEKLFEGIPSSQTNVNYKFKQGWNDLTVLVYVQNLNK
FT                   DCTIDLGFDPIRVSTHCYSSSQFLEKVSVFDLRYNTKNNDWSKYALYEKDGKVYIVVNH
FT                   SLPGVTYDFYYDYVDEVEHRNIQLKIAMKQFSVGQYTTPVLRRYTLQFS"
FT   gene            38828..39601
FT                   /locus_tag="BcerKBAB4_5451"
FT   CDS_pept        38828..39601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5451"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46443"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV11"
FT                   /protein_id="ABY46443.1"
FT                   /translation="MQIEKKYKPSFHKANARYRGVTELSQYTNFVLESAHDLLLLGNIT
FT                   EGNEATHKDGHKKEMYNNFISIMTGDREVGKSSLFTASTLQKIDYSRTVPIPELDSWSP
FT                   LNGCTKTAVSDAIKLSSNGLLDPVGMFSTLYVEPGDKLYIRMKVRSTGGASDFSFGSNN
FT                   MRMGPDKNGDTRKVPLAKSNEFITLDYVLRFQYAESVSININVHEKPNELKAENVEIKD
FT                   LEIYYFNETPIQASSIDMVIKPNVDELEEKINSIR"
FT   gene            39615..40862
FT                   /locus_tag="BcerKBAB4_5452"
FT   CDS_pept        39615..40862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5452"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46444"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV12"
FT                   /protein_id="ABY46444.1"
FT                   /translation="MRPITLRNPNLNKGPSSSEEFNKLRNDIQTDITNLFDIVNSHDGI
FT                   ISENMDHILRENYFLQNRLKKLEGRVYELEKDYQNNSVDGESILTRSFYHASNIISSNA
FT                   NNPINIDTLHGIVTPVVVRSHDKIAYKNDLGEYILPSNLEASVFESSDVEPIDEETKQR
FT                   KFYAVNSSGITKAFDGDKNSFWVRQSESNENKCVTEVYGLIHVKIPQNISNNIYTNTIT
FT                   IHPSPEYSMSILDIQYKNQNGEWRRIETYPIKKVNNTDIPEEIVESGKLVFSFPRRQVT
FT                   ELQIKVKQPYWFKHDNKRIFMYGFQDIVVEYREYSQDTSEFTTKFSLEGTDRRFTNVNT
FT                   PKVTVPVGCPSLNDYTVKHELYFDEGLTEKFDFSTDIFQPIQTVYVKTLLKTAGDQVPI
FT                   LREIELPYRHEELEVL"
FT   gene            42449..42820
FT                   /locus_tag="BcerKBAB4_5453"
FT   CDS_pept        42449..42820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK4221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5453"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46445"
FT                   /db_xref="GOA:A9VV13"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV13"
FT                   /protein_id="ABY46445.1"
FT                   /translation="MEESKKKGEEINDKYPHYKDVNEDALTVSLEQYDQIKVGISVDKV
FT                   IEVAGYPIFSETTKLFSIFGYLGHGGEGSMTITFDNYLYKVSLFFVLGICFFRLMAAWC
FT                   YSFKYSKGYYNEIFTSISL"
FT   gene            43103..44284
FT                   /locus_tag="BcerKBAB4_5454"
FT   CDS_pept        43103..44284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK0934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5454"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46446"
FT                   /db_xref="GOA:A9VV14"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV14"
FT                   /protein_id="ABY46446.1"
FT                   /translation="MNINKSFKGIAIAGLSVSFILVGCTLNTYGLTQSEYRKVDKYYDA
FT                   DKMVSDLKKLHYSDEHIENQLRNALSRIEYEKGSKEDGSSSKESKSNVSDTEDEKKVTV
FT                   SEKDYPYRLTELHLEFQYHLKKLEKKTDELFTEEGVYISEIDSLISHISLDINRFEKIK
FT                   PPKNYEDYQFLIQEGVEEIRKHLIKVEDAVRQYDDRKYDGEYDKDKAKEIIQNGMIGID
FT                   DGVSKWETVFNGINEKYPDVEQKVKEENQKHAKEGHREDDLNDKVSGSDVDKYKADIVG
FT                   NTNKMDEVIRLIQDIGHSDIKDYESKKSEIQLSLDVAKTHVRDMKYLEAPKGLEVEQEK
FT                   IKQSMDNYWDALQLFSEALEEQNDSKLEQADNKAEQAMKLFKKATESIKSKTN"
FT   gene            44352..45046
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5455"
FT   gene            45389..46816
FT                   /locus_tag="BcerKBAB4_5456"
FT   CDS_pept        45389..46816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5456"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bca:BCE_2758 permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5456"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46447"
FT                   /db_xref="GOA:A9VV15"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV15"
FT                   /protein_id="ABY46447.1"
FT                   /translation="MNFIKRAILSMKKRIGTSLILMAVFLIVTNLVLAGFTIQNASKKA
FT                   ADAARKKLGADVTLGLDFDKLGKQARETGEAPNPPQLNTKETDQLAKSKHVKDYNYITH
FT                   NFGIADGFKLVGVSEGEGKGNGNARVATAGGSGSGTEIDMNSSLMIEGVRKTLLQESFK
FT                   NGKNKIVDGKPITEQMQDQNVALMEKRLAEQNNLKVGDKVKVQSGDKKETLEIEIIGIY
FT                   ETNEQPMGQNPPPMINPANKLYMPYSTLKKLEVDEGMSSIQVVYLLNDPQYIDAFKKEA
FT                   KKSDIDFNYFKLDAHDSLYKQMIGPIENIASTSQMIIYMVSIAGAIILGLIIMLSIKAR
FT                   RKEMGILLSIGEKKWKLMAQFVVEVVCIAILAFGLSITTGAKVSQFVGDNLLSSEIATA
FT                   SEETDTSQNSTVMVAGPGGSLQDQKKEPIDKIDVSVTGEDVGKMGGIGLAIAILATLLP
FT                   ALSILRLNPKQILLKDE"
FT   gene            46828..47514
FT                   /locus_tag="BcerKBAB4_5457"
FT   CDS_pept        46828..47514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5457"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bca:BCE_2757 ABC transporter domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5457"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46448"
FT                   /db_xref="GOA:A9VV16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV16"
FT                   /protein_id="ABY46448.1"
FT                   /translation="METILQFKNLDYYYESNGKKVTILDNVNFSFQKGHFYTILGPSGS
FT                   GKTTTLSLGCGLDIPKNGYVLFNGKDIRKIGLDRYRNQNVSVIFQSYNLITYMTALQNV
FT                   LTAMEITGVKVQNKKARALELLEKVGLTEVEAKRNVLQLSGGQQQRVAIARALSCNVDL
FT                   LIADEPTGNLDGETAKEIIELFQELAHQENKCVIVVTHSQEVAKKSDRAVYLSKKKLVV
FT                   NEINNS"
FT   gene            complement(47790..47954)
FT                   /locus_tag="BcerKBAB4_5458"
FT   CDS_pept        complement(47790..47954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK2961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5458"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46449"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV17"
FT                   /protein_id="ABY46449.1"
FT                   /translation="MSEIIEVTEDNTYAGVEKAEVFRIGTAYSTTNRSLIKTIKYTYLC
FT                   SVAQCLKLS"
FT   gene            complement(48714..49163)
FT                   /locus_tag="BcerKBAB4_5459"
FT   CDS_pept        complement(48714..49163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5459"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: cvi:CV_0866
FT                   probable transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5459"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46450"
FT                   /db_xref="GOA:A9VV18"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV18"
FT                   /protein_id="ABY46450.1"
FT                   /translation="MTNSINKINAIDELSQAIYSLTAADGRLRGRATRTLGAVSMVHAR
FT                   TLKVLAEEGELSVKELADRAETTAAGITQLINGLQQAGYVERVRSNNDRRVVKVRLTPI
FT                   GLNCHLEREEKLKHILNANLSDFDADQIEKSSEIIRCLVHVLDQL"
FT   gene            49411..50685
FT                   /locus_tag="BcerKBAB4_5460"
FT   CDS_pept        49411..50685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5460"
FT                   /product="protein of unknown function DUF1100 hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF1100 hydrolase
FT                   family protein; KEGG: cvi:CV_0865 probable dipeptidyl
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5460"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46451"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV19"
FT                   /protein_id="ABY46451.1"
FT                   /translation="MTQRSQSQGWALDIALALGGFDALHPEAKATMEQLGHDHTDFDKV
FT                   FSQVKSGAMIPKAWATVAAQAQERAKHYEQKGFTVTARDLYQRAAVMWGRAQYSYFNDD
FT                   PRKLAFRERCNECVAAISSLGGGTVQRIVLEFEGKQIYALLHLPSGEIRNAPAVILGPG
FT                   MDMIKEDYIQIAQRYYTSRGIVALSIEGPGQGESVSGGLKVDLANYERAVSCYIDFLSK
FT                   RPEVDPNRIGFFGISMSGYWGMRAAASDNRINAIATFEGVYGEFDTIFNRAQPSFKANF
FT                   MYMSGYTDEVAFENELSSQMNLWKLAPKITCPVFMGIGEFDELTRLEEALSLYELVEAP
FT                   KELRVYENEFHPLGGVAAEIFRFGAEWVELALEGNFKNDYDERYYMHRDGGVTEGTAFP
FT                   TYWLGAQPAEIKARKKCNTLNACKS"
FT   gene            complement(50849..51721)
FT                   /locus_tag="BcerKBAB4_5461"
FT   CDS_pept        complement(50849..51721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5461"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: lwe:lwe1801 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5461"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46452"
FT                   /db_xref="GOA:A9VV20"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV20"
FT                   /protein_id="ABY46452.1"
FT                   /translation="MEIKELNTFKMIVEEGTFSLAAKKLNYAQSTVTTHIKKLENELGF
FT                   LLFERGWDARLTEEGTLFAKEVDNLLMHWDYSVSQAQRISNEEKGRVRIGLTESVAKKL
FT                   MPSILNYLDNEKPYIHCDFVVGNTALLSQLLEQNKIDFAVCGNNKNSSNMNFTPLYNEQ
FT                   IEFIVNNPHHPILHKESIEVFDIVNYPILIGENSCYYYQSVNAFLSENNLSFKRIYNCS
FT                   ALHLIPQMVFGNAIGIIPKGTILNKGNISFKVKGFDPQMPIGLLISSKNRNYLSQTKQR
FT                   LMKLIESLL"
FT   gene            51831..52250
FT                   /locus_tag="BcerKBAB4_5462"
FT   CDS_pept        51831..52250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5462"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bcy:Bcer98_1751 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5462"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46453"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV21"
FT                   /protein_id="ABY46453.1"
FT                   /translation="MPFVNVYYPDGQLNKEELKTVSNSIHHSLIEHFKIPENDYFQLFL
FT                   PYPPNQFYYDPHYLLEGEEKRTEKIMHVSITCGPGRTINQKKSLYQSISKTISNHLNIS
FT                   TTDIFITLNETSVENWSFGQGIAQMVNIREWKNSE"
FT   gene            52243..52575
FT                   /locus_tag="BcerKBAB4_5463"
FT   CDS_pept        52243..52575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5463"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bcy:Bcer98_1752 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5463"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46454"
FT                   /db_xref="GOA:A9VV22"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV22"
FT                   /protein_id="ABY46454.1"
FT                   /translation="MNDRIESNIRKKMRDMAPDFVDYSENILFEKVWRDPILTSRERSL
FT                   CTLSALISIGNTEQLPFHLQLAEKNGINETEIIALITHMAFYVGWPKAAATLNMILNKN
FT                   ENTVSK"
FT   gene            complement(52656..52790)
FT                   /locus_tag="BcerKBAB4_5464"
FT   CDS_pept        complement(52656..52790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bca:BCE_2637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5464"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46455"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV23"
FT                   /protein_id="ABY46455.1"
FT                   /translation="MNLSIQDELLPFAEELQRYVTPVFLEELAREIGFIKRKRKFSGS"
FT   gene            53323..54732
FT                   /locus_tag="BcerKBAB4_5465"
FT   CDS_pept        53323..54732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5465"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bsu:BG12750 similar to histidine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5465"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46456"
FT                   /db_xref="GOA:A9VV24"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV24"
FT                   /protein_id="ABY46456.1"
FT                   /translation="MENKNGREFQRKMQARHLVMLSLGGVIGTGLFLSSGYTIQQAGPF
FT                   GTILSYLIGALVVYLVMLCLGELSVHMPETGAFHSYAVKYIGPGTGYTVAWLYWLTWTV
FT                   ALGSEFTAAGLLMKRWFPSINVWVWSALFAILIFVLNVLTVKFFAESEFWFSSIKVIAI
FT                   VIFIVLGVAAMLGFLPMTHSKAAPFFSNFTSGGLFPHGATAIIMTMLAVNFAFSGTELI
FT                   GIAAGETANPEKMIPKAIRTTLWRLIIFFVGTIVVLSALLPISDAGVLESPFVAVLERI
FT                   GVPYSADIMNFVILTAILSAANSGLYASSRMLWSLANKNTISPIFGKMTKQGIPINAVI
FT                   FSMVGGALALLSSIVAPDTVYIVLVSISGLAVVVVWMSISASQFLFRRQFLKEGNSEKD
FT                   LIYRTPLYPLVPIASFILCLASCIGIAFDPTQRIALYCCIPFILFCYGSYYLTKNLKKR
FT                   GVDYVEQNQPN"
FT   gene            54707..55684
FT                   /locus_tag="BcerKBAB4_5466"
FT   CDS_pept        54707..55684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5466"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   bld:BLi00266 similar to proteins; RBL01519"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5466"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46457"
FT                   /db_xref="GOA:A9VV25"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV25"
FT                   /protein_id="ABY46457.1"
FT                   /translation="MSNKTNPIDAILSQHSIMLLDGALATELEAHGCNLDDPLWSARVL
FT                   LENPELIYQVHSDYFRAGADCAMTASYQATISGFSARGIQEQEALELIKKTVLLARRAR
FT                   DDFWKENTQTNRPKPLVVASVGPYGAYLADGSEYVGNYGVTDKTLADFHRSRMSALIEA
FT                   GADLLAFETIPSLQEARVLETLLREFPATYAWLSFSLKNEKEISEGMKLVECARVFEKS
FT                   EQIVAIGINCAPVTVVTGAIQELRANTKKPIIVYPNSGETYNPETKTWHGHEQCNALDI
FT                   QSEEWYQAGARLIGGCCRTTPYHIEEISNKWRSSEFFYSNEAKQ"
FT   gene            55886..56008
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5467"
FT   gene            56801..58402
FT                   /locus_tag="BcerKBAB4_5468"
FT   CDS_pept        56801..58402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5468"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: S-layer domain protein;
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SH3 type 3
FT                   domain protein; SMART: SH3 domain protein; KEGG:
FT                   btk:BT9727_3111 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5468"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46458"
FT                   /db_xref="GOA:A9VV26"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV26"
FT                   /protein_id="ABY46458.1"
FT                   /translation="MNIRFNKKVVAFTAGLTVLSSPLVSFAEEQQLVNNKQPTNVQEQS
FT                   KTTSDEQALKSIEASFEEVDGRGGGTVDNKKVDSLQRSEGIHEETGTLTVPNNSNRTKR
FT                   SLSPISPSTSSTINGVPFTEWIVPAGNDNIRPQNYMSPKYITIHETDNTSVGAGARNHA
FT                   QYLYNQAVGNTDRAASWHFTVDDKEIYQHLPLNENGWHAGDGDGPGNRESIAIEIAVNS
FT                   DGNYSKAVDNAKKLVAYLMKETGVPLNNIVKHQRWSGKICPANMINNGQWDAFVNGVGG
FT                   YYNNLYQPKDDITGGWYEEAIRELNRRGIMIGEGNGVFAPNRAITRAEFAQLISKSLNL
FT                   PAGDASFKDLNDANSTLRDGIKRAASAGIILGRGDGYFDPNTPITREESAIIVNKALQY
FT                   KGIWGPVVNLPFSDKDQISYKEDVQRLYGLGIVRGKGDNQYDPKGTTTRGETATFILNM
FT                   LQVIENGSVEKVIGTAQINGIGVNVRSGSGTNYSIVRKTSKGEKVTVYEEKNGWLRIGT
FT                   GQWIYYDSSYIDYNRL"
FT   gene            59163..60353
FT                   /locus_tag="BcerKBAB4_5469"
FT   CDS_pept        59163..60353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5469"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bcy:Bcer98_2249 2-alkenal reductase; PFAM:
FT                   peptidase S1 and S6 chymotrypsin/Hap; SMART: PDZ/DHR/GLGF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5469"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46459"
FT                   /db_xref="GOA:A9VV27"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV27"
FT                   /protein_id="ABY46459.1"
FT                   /translation="MGHYDTKQTRKNKSRDGKKTGYFFIGIIGAMIGSITIGLTTPYID
FT                   EIKGSTGQSAKNNEVNQVTPISHKPEGVNSLQNMIEDAKEVVVGVINYKQNADSFNTQD
FT                   QSEEAGSGSGVIYKKNGNKAFIVTNNHVIDGANKVEVKLNNGKKVPAKVVGTDSLLDLA
FT                   VLEIDGTDVKRVATLGDSDKNRTGETVIAIGNPLGLEGSVTKGIISSKEREIPVSTLGN
FT                   QQVDWQAQVIQTDAAINPGNSGGALFNEQGEVIGINSSKIAQQAVEGIGFAIPINIAKT
FT                   TLGFLEKDGTVKRPMMGVQLLDVEKMTDSARNQLKLPKEISNGAVLGNISNQSPAEKGG
FT                   LQQHDVVIALDEQKIENVVQFRKYLYEKKKSGDTIKVTVYRNGEKITKMVKLTEQK"
FT   gene            complement(60579..61982)
FT                   /locus_tag="BcerKBAB4_5470"
FT   CDS_pept        complement(60579..61982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5470"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bca:BCE_2750 histidine
FT                   kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5470"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46460"
FT                   /db_xref="GOA:A9VV28"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV28"
FT                   /protein_id="ABY46460.1"
FT                   /translation="MKMKRITYKLFMTTSLILLAFAVMIYLTLYFFLPTFYEQYKTEQL
FT                   ENGMEEIIDKSKNLTFQNAQPLFEEYMQKNNAILRFPDYERVSVYSTPYTFIQGSVTQA
FT                   ARIGGSNSLNKSYDIPFQDGNQTVIVYATFQPIDEASKVLVRFLPYISIIVVVIGIGSA
FT                   YLFSRFITKPLIYINRGAQKMADLDFSEKIEIRSMDELGELSNSLNDMSINLQQTMFDL
FT                   QKANQQLKSDIEKEREIETKRREFFATVSHELKTPLTIMKGYLEGMIYNIGPYQDRDQY
FT                   LKKNHQIIEKMENLVREILSMSKLEQHTFKLQLKEINLSELMDIITKDLSFFASQKDIQ
FT                   IIKQIDSNLSVYTDRALLEKACKNIIHNAIMYSPNSENVYIQLTQDSKQKCILIQIINT
FT                   GVQIKENDIQHVFEPFYRIEKSRNRNTGGSGLGLYIVKQIFEALGIEYCINNVEQGVQF
FT                   VVSIPISEQ"
FT   gene            complement(61996..62661)
FT                   /locus_tag="BcerKBAB4_5471"
FT   CDS_pept        complement(61996..62661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5471"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bca:BCE_2749 transcription
FT                   response regulator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5471"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46461"
FT                   /db_xref="GOA:A9VV29"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV29"
FT                   /protein_id="ABY46461.1"
FT                   /translation="MINHHILVIEDDQEIQELIKQFLLTQQYTVEVASDGLEGMIQFNK
FT                   QSFDLILLDVMMPNLNGFEVAKMIRSQSNVPVIMLTALEEEQDQMKGFDLGIDDYITKP
FT                   FSFHVLIRRVEAVLRRSNDKSLDNHFVFKELRVDVDAYKVYVNEVEISLTTKEFEILQL
FT                   LLQNEKRVLPRESIVEKVWGYDYIGESRIIDTHMKNIRKKLDIPYIKTIKGIGYKIDE"
FT   gene            64534..66897
FT                   /locus_tag="BcerKBAB4_5472"
FT   CDS_pept        64534..66897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5472"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; Carbohydrate-binding family V/XII; Fibronectin
FT                   type III domain protein; KEGG: btl:BALH_3389 serine
FT                   protease, subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5472"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46462"
FT                   /db_xref="GOA:A9VV30"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034073"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV30"
FT                   /protein_id="ABY46462.1"
FT                   /translation="MKFIKGIFVSTIALTAFTGLELIKFHENPNVVYADSKGPVKNISQ
FT                   SEADIKEEDQIIVKFKSEVNFPYKDGLEKQIKNEDSDLELVKIFSEFPQLTLKRLFTSV
FT                   DPKEIENIDKHTRETENNSSSNLLDYYIVEVPNKVTAETLMDKFKKSYLVEEVYMQEKP
FT                   TLLPEVQLPTVSLNPYDDPRFLNQGYLKEAPYGINASYAWSIKGGDGKGTTFVDMEYGW
FT                   LLDHEDLVNQKVELISGRNIDQHVGHGTSVLGIVSAEDNKVGNIGIASKAKVKVVSQIR
FT                   GDGSYNTADAIINAVHNLQAGDILLLEAQASYDGYGDKYLPVEVQPDIFDAIRAGTDKG
FT                   IIVIEAGANGSNDLDQFRDRNGKQVLNRNSPDFKDSGAIMIGAASSTVPHKRLWFSNYG
FT                   SRIDVYGWGENVDTTRAEPNRITKNLYTTGFSGTSSASPIIAGAATSIQGVAKEHLGRP
FT                   YKPAELRNILSNPNTGTKSQNPLTDKIGVLPDLKSILSNLGYSPDISNNVLEGNQFVWS
FT                   MKGIGDFEFAKLDFNKTKEEMQIQLKAGVPHHYFDSTYASVKVQNSSGKVVYNKDIYGN
FT                   RQQNAETQKISMKVGDYIEFTHLEGGNRATLINVDKNIQESFGKKIVYQVTVNGLKKVD
FT                   QIINPSPDTEAPTRPEGLQAANITANSVELKWNSSTDNVGVKEYQVLRDGKFIQMVQGT
FT                   TFTDSKLTANIEYKYTVKAIDAAGNQSIQSSVLSIKTKEQNTSYEKWDPRKAYTKGDRV
FT                   EYQGKIYEAVQSYQGNGDSNWIFSLSLWKTISIS"
FT   gene            67752..68225
FT                   /locus_tag="BcerKBAB4_5473"
FT   CDS_pept        67752..68225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5473"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46463"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV31"
FT                   /protein_id="ABY46463.1"
FT                   /translation="MKTFGKILLTGTLALGGLTVMNVETPKAQAEGASEFCRYICGPKE
FT                   TLNNFTIQLSDTEYRMGQNIILRATNDNAYDVTYKATVEKQYATGWGYVETDFNYQSML
FT                   PAGTNEDFNVWTFDGNSAGNLNEAGTYRMKIEVTHADGKTDTVYTAPITLLAQ"
FT   gene            complement(68554..68745)
FT                   /locus_tag="BcerKBAB4_5474"
FT   CDS_pept        complement(68554..68745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5474"
FT                   /product="group-specific protein"
FT                   /note="KEGG: bcz:BCZK3444 group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5474"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46464"
FT                   /db_xref="GOA:A9VV32"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV32"
FT                   /protein_id="ABY46464.1"
FT                   /translation="MIKSLQTFWGCLAFGVLTFAIFLIIGLTDTPFNALGWRDWLGSVV
FT                   GAAIISTGMFTLKKLNLK"
FT   gene            68792..68959
FT                   /locus_tag="BcerKBAB4_5475"
FT   CDS_pept        68792..68959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5475"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46465"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV33"
FT                   /protein_id="ABY46465.1"
FT                   /translation="MERRGNVLASANEVLSPTLLAKEKLIGYRDKEPNNALYNAAINIK
FT                   NEAIRLLALA"
FT   gene            complement(69198..69611)
FT                   /locus_tag="BcerKBAB4_5476"
FT   CDS_pept        complement(69198..69611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5476"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46466"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV34"
FT                   /protein_id="ABY46466.1"
FT                   /translation="MKKVILAGALGIAVLSGMNLPGVEATKASAASTNLEIQEITKYYS
FT                   MSSYEVSQKESFNLKKGEELTVFITNSGFPISYTVFDADNQVIGTYNANSPYGRVFTAQ
FT                   KDGNISVQFQAGANSSFMKKMNFTAKFALSKLN"
FT   gene            complement(70268..71362)
FT                   /locus_tag="BcerKBAB4_5477"
FT   CDS_pept        complement(70268..71362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5477"
FT                   /product="tetratricopeptide domain protein"
FT                   /note="KEGG: bcy:Bcer98_0992 tetratricopeptide domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5477"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46467"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV35"
FT                   /protein_id="ABY46467.1"
FT                   /translation="MNVQIKGNEQITHLLNEWYQEIRARHVDAAHLLKQEIENKIHDIE
FT                   ENQTILLYYSLLDFRHQYLIDSLSISKDSFKKSDAYETPTDDFLSYYYHFFKAIHSNVM
FT                   GNHSLARIHFDKAESLLSTIPDEIEYAEFHYELAVFYCHTHKSILCINHVMKAKDIFSK
FT                   HMGYELKVAFCNNLYGLACTHLREWELAEEHYISAMDTFQKENLEYNILIVRHNLGFMY
FT                   ATQNLSELALRYLSEVNQKLASDYKALFIEAREHYKLGENQIAQELIEKGLQLSTQLGI
FT                   ESYIHHFNILKKMNLNSCAIDVEKAILEGISYFEREELYEYINEYTEKLATQFYKENNH
FT                   VKASYYFYEASKASEKNYIKGALK"
FT   gene            71671..71964
FT                   /locus_tag="BcerKBAB4_5478"
FT   CDS_pept        71671..71964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5478"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bcy:Bcer98_1906
FT                   regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5478"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46468"
FT                   /db_xref="GOA:A9VV36"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV36"
FT                   /protein_id="ABY46468.1"
FT                   /translation="MIALKNDRNVKEISEENVDLLKVMAHPVRLQIVNELMHHKKCNVT
FT                   QLTEILRLPQSTVSQHLSKLRRTVLRTERRGLEVHYYIDNAKARQIVGILGL"
FT   gene            72577..73197
FT                   /locus_tag="BcerKBAB4_5479"
FT   CDS_pept        72577..73197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5479"
FT                   /product="thioredoxin"
FT                   /note="KEGG: bce:BC0912 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5479"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46469"
FT                   /db_xref="GOA:A9VV37"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV37"
FT                   /protein_id="ABY46469.1"
FT                   /translation="MKTKQDNLIYVWDAYCGWCYGFSESIKGFYKEHTEVPLTVLCGGL
FT                   FLDDLPIKNFSYIEEGNKRINQLTGAEFGPSYQKLVEEGTFKMNSKDAAIGFSALRSLA
FT                   PDRLLEFTSAMQKAFYYEGKSLSDPETYRKIAIEHGVDPEQVIERLNAQETIVDVQNDF
FT                   NKVRQLGVNSYPSLLLQKDNQIIPIGGGVMTPDKIEARFKNLY"
FT   gene            73493..74314
FT                   /locus_tag="BcerKBAB4_5480"
FT   CDS_pept        73493..74314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5480"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bcz:pE33L466_0280 possible Zn-dependent hydrolase,
FT                   including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5480"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46470"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV38"
FT                   /protein_id="ABY46470.1"
FT                   /translation="MFKTIDTNLNDVKLTVFSSDEKSFMVTATLVEKAGHAFLINSKFT
FT                   QSDSKEIVDYLKNNNLSLDKIFIIHGDPDYYFGLESIKAAYPGAIAYATESTVEHIVHS
FT                   VLGKLKVWKDVLGENAPNNVVLPQVIKEKTIDFQGLTFELVGLDDYRTSLFNKELKLLI
FT                   GGIDVFNEIHVFLADTSSKAAMEAWIENLKVLQALNADIIVPSHGSIEKSLDNQAIIAT
FT                   MDYLRTAIQASEESKTSKDFVAKLETAYPGYANKGVLELSAKVVTKEMPWG"
FT   gene            74319..74711
FT                   /locus_tag="BcerKBAB4_5481"
FT   CDS_pept        74319..74711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5481"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46471"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV39"
FT                   /protein_id="ABY46471.1"
FT                   /translation="MNKYQKLLHETYVLTGEGKMDAFKAYLNENVSWTEAAGFPYAGTY
FT                   IGPDEVVKNVHERLGTEWDNYSAKDEIYAFNNNTVIVYGKYSGTYKVTGKSFIADFCHL
FT                   YEFDENDKVKKFIQIVDSATVNEVLS"
FT   gene            74866..75393
FT                   /locus_tag="BcerKBAB4_5482"
FT   CDS_pept        74866..75393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5482"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   bcz:pE33L466_0282 possible pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5482"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46472"
FT                   /db_xref="GOA:A9VV40"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV40"
FT                   /protein_id="ABY46472.1"
FT                   /translation="MKLEKNLIIIIISVFILGIVSTLTFQSFIGNAKGNSIKSENVAPV
FT                   SKDDVAEKEKNKKMVVDFYNEVFNKHNIDIIPKYVSEDYKQHNPFVADGRKAFMDFFKE
FT                   DFVKNPNSSAEIKRVVAEGDTVALHVHSRANSQDKGVAIVDIFRIKDGKIVEHWDVIQE
FT                   ISNETANNNTMF"
FT   gene            complement(75695..76003)
FT                   /locus_tag="BcerKBAB4_5483"
FT   CDS_pept        complement(75695..76003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5483"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46473"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV41"
FT                   /protein_id="ABY46473.1"
FT                   /translation="MDNSKWISLSNVNDEEEIWAGARVRLYNVGMNREDKENDFYEYII
FT                   SYIYDNDNYLQLTNLTTGKAGYIICVIEKELPNNYALGKTLKQRMGLENTYFRFEYE"
FT   gene            complement(76032..77060)
FT                   /locus_tag="BcerKBAB4_5484"
FT   CDS_pept        complement(76032..77060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5484"
FT                   /product="Insertion element protein"
FT                   /note="PFAM: Insertion element protein; KEGG: gtn:GTNG_0770
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5484"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46474"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV42"
FT                   /protein_id="ABY46474.1"
FT                   /translation="MSKAFSNLLKHIGNLSHTEKEQVFQWVKRYVEPSSSVGGRLINEM
FT                   RETRFKEGFECPHCASEHVVRFGKHNNRQRYRCKCCSKTFTDTTNTVLYRTRKGNEWIT
FT                   FVDCMFKGYSLRKSAEIVGVTWVTLFYWRHKLLSALKQLDFEKFEGIVEVDETYFLYSQ
FT                   KGQRGISERKPRRRGGKSKHRGISHEQVCVLVARDRTKATVSKIACMGRVVKTKVDSMI
FT                   GSKLTSDNVLVTDAWRAYKTYAKEKGIEHYRIKSNDGKHVIKGLYHIQNVNGLHSRMKQ
FT                   WIDRFKGVATKYLDNYLAWFLFIDRKSNESTKHNIKEFLLTSFVFEMTDTYDSLRLSKF
FT                   SV"
FT   gene            78259..78669
FT                   /locus_tag="BcerKBAB4_5485"
FT   CDS_pept        78259..78669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5485"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46475"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV43"
FT                   /protein_id="ABY46475.1"
FT                   /translation="MNMKTFEMREKRLAELLGAKVLWEFISAVTEEIEKQELESTPGLL
FT                   EDLFIHVKETIQIQNMNQGITKAPVKTEADGIDKDTLFMEAYVELINHKFVISELVVEL
FT                   SSVLKELNCFVQSSLPLLQNKLDSQESQSASL"
FT   gene            complement(79494..80138)
FT                   /locus_tag="BcerKBAB4_5486"
FT   CDS_pept        complement(79494..80138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5486"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46476"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV44"
FT                   /protein_id="ABY46476.1"
FT                   /translation="MNIELLDTHHVKDAAHLLAHSFVNNEPLVSSLQIPFASFHKMCEE
FT                   MMKQAVSQAMSFVAIENFQIVGVLLTKKVTQPLIDTDKATELCPQMEPIFQLLDTLETE
FT                   SIEFSHLDKEKLVYLDMGACHPDWMGSGIVTSLISHAIQEISKKDFDFIAACTNKISQK
FT                   ILKKLFTTLEMNEIVYSNFPYKEAYPFANTTTSLAAQLLYIPQSQFVIKAI"
FT   gene            complement(80242..81894)
FT                   /locus_tag="BcerKBAB4_5487"
FT   CDS_pept        complement(80242..81894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5487"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   bha:BH0566 2,4-diaminobutyrate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5487"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46477"
FT                   /db_xref="GOA:A9VV45"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV45"
FT                   /protein_id="ABY46477.1"
FT                   /translation="MQDILKLFPSVDGNEEKQQLLLESMQKIIKNLDQLKNEERATLGK
FT                   CEEKSEGYYNGLIHQSHIPLAGITMSEVIEELKQFMNGHPYPNKYYLSNAVPLPSIPSL
FT                   LGVITMALLNGNGVWDVYGPGAAEAEVKVVSMLSKLIGYNPHNSGGYTTWGGQGCVFSS
FT                   LRLAISKQFPSAKEHGAPQNVYCFASENAHYSLLKSAEATGIGTNHLIKVKTDPYTNSM
FT                   DIEDLENKMIQVIKNDGIPLYILATMGSTDTFTIDDIKKIKESAETIQKKYKLKPIYIH
FT                   ADSAMGGFYSFFNNYSFEENPLSFEPSLKNALQYVQDKMQYMALADSVCFDFHKLGQTP
FT                   YASSILIVKNHTDLQLMDIEQDDTPYLGNRSYGSYHTGYTLECSRAGSAIPMYINLLAF
FT                   GVEGYQKLLANYIRVNLLFRERLRKALPQVAITNDFTYGPITTFRFYMNGDGQENWEKE
FT                   RIGLATKEEIEGTNRLNIELFNYLGKNRDQVFFGDTTRSCVVDVINNYDRNPISTLKFF
FT                   SISPYTTVECIDEIVEFLYEHISIATKQIYSYV"
FT   gene            complement(82378..83304)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5488"
FT   gene            83671..90990
FT                   /locus_tag="BcerKBAB4_5489"
FT   CDS_pept        83671..90990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5489"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; condensation domain
FT                   protein; NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   phosphopantetheine-binding; Male sterility domain; KEGG:
FT                   rso:RS05859 probable peptide synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5489"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46478"
FT                   /db_xref="GOA:A9VV46"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV46"
FT                   /protein_id="ABY46478.1"
FT                   /translation="MKEIQKQYEIVEELDATVGQEALWIAHQMELENGMNNEATIIKLK
FT                   GNLQIDTFKKALTLIVQSHPALRTLFIKRDEKIKQFIQKSIDFDIPIKDLTAFKNTEQK
FT                   FILKKFLDSIVNEKFNLEEGPLFKFHIIKLCEDEFILHMIFHHIIYDGCSLGIFIQQLS
FT                   HTYCELLQENTGLVLESPYKSLIEFEEGFIDSAIYREGSSYWKDYLQGELPPTEFPATI
FT                   NKMNEPIYTNENISKNIDADLFYQIQCFAKRNNISVYRVMLSTYCALLHQMTNAEEIIV
FT                   GIPINTRPHTEEGNAFGYFVNTLPIRITIEKGDTFKGILNKVNKSVHLAIKYKHNPYSH
FT                   IVKDSNLNNNTHHNMIYSTAFNTVRIPQLKILDIESTVLTDCKRVNPFNMTWRIMRYEG
FT                   ETENKIEVDYNSALYKAESISDLVERYIYLLQELMKNVNELIHSLDLLLKKDHRLYKDI
FT                   NSNTLAYPNSKTLDQLIDLQALKSPNQIAISMGDKSITYYDLQQRSNQIANYLRENDIK
FT                   KGQRVSITMVREIDTIVWILGILKSGGVYVPIDPKFPEKRIEYILKDSESQMIITKKEF
FT                   RGLIESFAIHTIYLEDFHYANSIENIVPTHTIEDTAYIIYTSGSTGLPKGVGVPHKGVI
FT                   NLSYSLMNQFNLDKNDVFLQFATMIFDASIMEIFPILLCGGRMHLISEMEKRSAEEFIN
FT                   VINKNGITYVLLPTAFFKLIADMPKEMLLTLNSLKCVFVGGETIPAESVRKWQSKLGLK
FT                   IPVLNAYGPTEATVCTTIYEVNHEIKEENSNIPIGKPIANSKVFVVSPFNTICPSGVVG
FT                   ELFIGGDGVAKGYINQKEKTEEAFISFGESYNRDKKMYRTGDLVRLLPSGKIDRKKLEL
FT                   QIPSLLENMKNQYVPPISETEKRLVKTWSEILNLGKYRISRDDDFFKLGGHSLIAVQVL
FT                   NQIQKEFHLKIEIRDIFEHTTIASLSAYIDKLMEVNTDREEHDMQVLKVADKECYKLSS
FT                   AQKRIWFLNKYNAINRVYDTQLHINIEPSLKKNILQDAIRFLVERHEMLRTVFIEKNGE
FT                   PRQVILKSISIDLIHDDIEHITKKEQQEYIRRTINQTDHTPFDLENGPLFRIRIFNLDK
FT                   KRSYIYINLHHIITDEWSVRNLLDELMKVYNAFANRRNPYLPTISNRYVDYVEWEHKQL
FT                   KLGRWDTEKSYWMTELAAPLPILNLPLDFSRDRQSTNKGKVFEMKLDNKMKESLKQVCE
FT                   QENVSMYMLFLAVYIQLLHYLTDQKDIIVGTPVAGRNYQEFEQIQGFFVNTLAIRTQLN
FT                   DVKNLKQLVQVVKEKCLNSFQNQSYPFDKVIEQINPDRSFGNNPIFSTMFSYQKDILQQ
FT                   HDEHKLQLLTNKQDVSKFDISLSVEEGLDYVGISFEYDINLFKEESINRFTQNLLNILD
FT                   AFIHQRTVAYETLSFLSQEEVSLYRKVNHTERPYPYFQNIQEQFYKQVDRQSNRIAIAT
FT                   ETESLTYRQLNMDSNQVAQHLLEKGIKTGDKVAIFLDRSINSIVSMIGILKAGAAYIPI
FT                   DVKYPEDRINYIVSDSEACRIITNNKYKSHLNSSNYNVSIIEDIYRTTINDDVKILNKP
FT                   DDLAYVIYTSGSTGKPKGTLLTHKGVLNLAEWRNEVFHISPNDKVTQFYSHSFDSSVSE
FT                   IFSTLLNGAELYLLSDEQRYSTVAYAQAIQEIQATLSDVPTVFFNELSTSLTKLDSEKI
FT                   RSLRFMIMGGEAASTNAIRSWQNTFKNQVQLVNEYGPTEATVSAMYYFIPILEDENSLL
FT                   GNIPIGIPISNTKVHILNSYMQHCPVGGMGELYIESLGLAQGYWKQEEKTNQAFISSPF
FT                   SEDNSKRVYRTGDLAKWLPNGNIEFMGRKDKQVKIRGHRIELGEIEDALLQFEGISQAV
FT                   ITQTKDGMLLQAYYKTVDGIEIEKNKLAIHLSNVLPEYMIPKYYSHVLEIPITANGKID
FT                   FEKLPEIDFDNEQKDDCILKPQTKVQKNIAKVWSEVLNIKSIGLKDDFFNLGGHSLKVM
FT                   PALVKLKPLYPNLKIQDFFKYRTIENLAYHIEEMEDMSLKNEKNINVACIENETKTNPV
FT                   YKRTKLEECELDMVNYPKAVFLTGATGYLGAHILEQLLQLPSTTIYCLVRKNENQVIDE
FT                   KLKERMRFYFGKEILQKLEERVELIEGDLSLINLGLDPKKVDHLKSNVESIIHCGGEVR
FT                   HYGEREHFQKVNVQSTKYLLELAKNTNARFHYISTLSVVGQAESDPKEFKFFESNFDRG
FT                   QNLDNVYLESKFQGEKMVREAMEKGVRATIYRVGNLVGNSKTGKFQFNINENAFYRLLK
FT                   GICLSNIAPEINTYVDLTPVDYGSLAITELSYKANTVNKTMHICNPTQLKWDQFINSLQ
FT                   VFGYDLMLMRQEKYIEKFFNTNLTTDEQKALELIMPLLESVEELSVAIPSCLYTQGYLK
FT                   NVHCLEPNQEYINLLLNYAMSIEFLPTIKEPILL"
FT   gene            91624..92529
FT                   /locus_tag="BcerKBAB4_5490"
FT   CDS_pept        91624..92529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5490"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ssv:SSU98_0954 cdd4"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5490"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46479"
FT                   /db_xref="GOA:A9VV47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV47"
FT                   /protein_id="ABY46479.1"
FT                   /translation="MKLAIQTKNLTKSFANQSIVRDINLSVPEGSLYAFIGPNGAGKTT
FT                   TMRMLLGLIPSDEGTILFDNKDIKEWKEELFENVGCFIDSPTYYPNLTAYENLAYVQKM
FT                   INKSLDEIDRVLKTTGIYKAKDKKVKDFSLGMKQRLGISFAILNNPKILILDEPTNGLD
FT                   PEGVHEIRRLLLHLVKNEGKTIFISSHNLAEIEMIADHIALLHKGSLLYEGKLDSIITS
FT                   GEYIIHVNTTTSTERILSNEGIPYSIEKEGVFRITIDQDSVPSLTRILIRNDIDIFEVS
FT                   PKKPTLEEVFLSFTKQKELL"
FT   gene            92532..93257
FT                   /locus_tag="BcerKBAB4_5491"
FT   CDS_pept        92532..93257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5491"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46480"
FT                   /db_xref="GOA:A9VV48"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV48"
FT                   /protein_id="ABY46480.1"
FT                   /translation="MQFIFKSVNSEMRKIGGRKLLLISLFFSLLSSFLCISYFIFNKNH
FT                   PDMFQSTNLIAITVNFNTLTLSIFSACMWYFIISSENKYGTWAIIYTQPISKLKLLVTK
FT                   NLMFILFYLVFNILNFLVMGIYTFINGYEISILYFLKMLILCTILSLAIPYSQLLFHLI
FT                   IKKGILAASLSVVWLFFFITYGLFPLIFTKTFPIFYSLNIVSDVAFKETIILLYLAISS
FT                   IYILGIMLLSVSFKYYTYE"
FT   gene            93273..93986
FT                   /locus_tag="BcerKBAB4_5492"
FT   CDS_pept        93273..93986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_3049 predicted ABC transporter,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5492"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46481"
FT                   /db_xref="GOA:A9VV49"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV49"
FT                   /protein_id="ABY46481.1"
FT                   /translation="MGILGEYKKSLHNGLYILLLVFLLIPISFQVLLTVSSQLKDGVFM
FT                   HIAILSLFCRLFLPIAIGLLVSFSFVNEFRRKGYMSAIYHGITLKTILSNKFLFCLIIT
FT                   FGYLLCALIITSIPIVLTVDNLGTVYQSLSFSILFMVISSLIIVNLHFLINIIFYKIPL
FT                   LSLLVGVIGGLGSFFISHTNYWILFPWSYPIMSLYIDSIETKQLYIILFVYLLSLLSCI
FT                   LMLSTLYNKKSMRWN"
FT   gene            complement(94239..94913)
FT                   /locus_tag="BcerKBAB4_5493"
FT   CDS_pept        complement(94239..94913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5493"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46482"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT7"
FT                   /protein_id="ABY46482.1"
FT                   /translation="MKQVLRKSKRKMIYLVGSLLIALSMFATTSFAATEGAVKSVTNSN
FT                   YTGIAADINLPKSVVVKDGYVNWYLGIGASKVEGGISKTSSGYKVFLNSGYNESGQNSK
FT                   YWNTQYDTSIKDGDRVNLKLVNNGNGTVTMYVNGSPKYVNQPVYGTFSQYEPVKMVQGV
FT                   EDTGSNSFSQASFSNVLLRADTSGSTYKSWNSSISSSFSQHGTYGSNFKVYSQVPLSAS
FT                   LR"
FT   gene            complement(95615..95773)
FT                   /locus_tag="BcerKBAB4_5494"
FT   CDS_pept        complement(95615..95773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5494"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: bat:BAS2345 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5494"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46483"
FT                   /db_xref="InterPro:IPR030968"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT8"
FT                   /protein_id="ABY46483.1"
FT                   /translation="MKKIKKIVLSMVVVSALACSMISLHVSQPSSFNGGDTPSPTIPSV
FT                   SVEVSID"
FT   gene            complement(95773..96873)
FT                   /locus_tag="BcerKBAB4_5495"
FT   CDS_pept        complement(95773..96873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5495"
FT                   /product="response regulator aspartate phosphatase"
FT                   /note="KEGG: btk:BT9727_2305 response regulator aspartate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5495"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46484"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV52"
FT                   /protein_id="ABY46484.1"
FT                   /translation="MTVQEKSNEQLMKILNEWYEEIRSYHVKEAKQTYLKVQENLKGIE
FT                   TDQYLSFYYSLLNFRYKVLVDGMSITKDSFNKIEELPNIKDEFSFLAYYYHFFKAIHST
FT                   IIANYTEARTHFEKAEELLIDIPDEVEKAEFKYRISTYFYQSYQPFEAIQHVVKAKEIY
FT                   LNHVGYEINIALCDNVYGLACIDLREFERAEECLNTVIDVFKKHDKEHLLLRVRYNLGW
FT                   LYNIQDLYPLAIRQSSEIINKIPNHFKALFVLARAYYKLEGVETAKSYIEQGMKYTNES
FT                   GNEEYKHRFAVLNELITELPRIKLEKVVTNAISYFEKEGMWDCVKEHAEILALQFYQAD
FT                   NHVKASRYFYISNNANKNHLRKGALK"
FT   gene            98101..98661
FT                   /locus_tag="BcerKBAB4_5496"
FT   CDS_pept        98101..98661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5496"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gka:GK2884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5496"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46485"
FT                   /db_xref="GOA:A9VV53"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV53"
FT                   /protein_id="ABY46485.1"
FT                   /translation="MFNILSTNVFTYKSKDGKTVTIREAKEQDAERMLNCASRALINAP
FT                   YMLSTVEDVKQMSVDAIQKTLKAYYENPNFVQFIAEVDSKLVGAIDFKNGNKEKISHQG
FT                   FFAMTILPEYRNYGIGRALLETLINWAKNNCKIEKVCLEVMEDNLGAIKLYKNQGFFEE
FT                   GRKAKGVKLDGGYQDLILMALFV"
FT   gene            complement(98785..100167)
FT                   /locus_tag="BcerKBAB4_5497"
FT   CDS_pept        complement(98785..100167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5497"
FT                   /product="putative hydrolase"
FT                   /note="KEGG: bce:BC0968 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5497"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46486"
FT                   /db_xref="GOA:A9VV54"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV54"
FT                   /protein_id="ABY46486.1"
FT                   /translation="MKKKKLQKSALSFTLLFSLGVSSFPLTTAIHGDTQGTQTAEKKQV
FT                   SLTERTSLFFAYLQQGKYAEALQLTSVAFQSKFTANILQSWWIQSGGSRITSMGTPVIK
FT                   ERNLVHQTVEIPGAIEGTTIPLLLKFTPGGKVDEVDVRTAPEKSYTIPHPSYDQPDSYQ
FT                   EREIVIGNATYPLPATLTVPKHKPGEKVPVVVLVHGSGPQDRDSTFMGAKIFRDLAAGL
FT                   SSSGIAVLRYEKRSLEHGFKMSAEPVTLDRDTTDDAIYAAKSAAQQEGIDPDNIFILGH
FT                   SQGAGTMPRILSKAPSSLVRGSILMAPPARPFTDMLLDQYQYLGAPKEYIDEIKKQFAY
FT                   IEDPTFDPDHPPAGYNYLSPHFMYDVTRWRPVEEAKSRKEPLLILQGSRDYQVTVKDEF
FT                   TKWQEGLSSRSNVHFKEYPKLNHFFTEGDGELSHPSEYEVPSNVPAYVIKDIATWVNET
FT                   KK"
FT   gene            100656..101048
FT                   /locus_tag="BcerKBAB4_5498"
FT   CDS_pept        100656..101048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB0471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5498"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46487"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV55"
FT                   /protein_id="ABY46487.1"
FT                   /translation="MYNDSIYFPYINYDQCFDRQFPGPQIPGIPGMPGFPGVPSFPGQQ
FT                   SSQAPTSPPPSFIPQQSTASPFAVDPGAISLCLFRNTYIWLSNGEQFWYFPIFVGPRSV
FT                   AGFRWNGRFWVIFGIDTRRIISFTCF"
FT   gene            101102..101596
FT                   /locus_tag="BcerKBAB4_5499"
FT   CDS_pept        101102..101596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cac:CAC1508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5499"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46488"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV56"
FT                   /protein_id="ABY46488.1"
FT                   /translation="MKKFQSFDGTITMINDFVTGSNEDIGCNKLMSVDNGYGNLINFVV
FT                   KPNTYFIDYATVVVGDKVTGFYDANAPAPLIFPPQFQAIVMAKYTPHQNVKVDYFNEQL
FT                   ESSDGKLKLNISPSTQILLTNGQFFTGNLVNRNLIAIYSFTTMSIPAQTTPYKIIVLCQ
FT                   K"
FT   gene            101605..101844
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5500"
FT   gene            102500..102934
FT                   /locus_tag="BcerKBAB4_5501"
FT   CDS_pept        102500..102934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_2264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5501"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46489"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV57"
FT                   /protein_id="ABY46489.1"
FT                   /translation="MRLIETVHIKWYGLYSLNDFYNREEAFKKGIFAISRVYAKNETLI
FT                   YIGKTKRSFIQKIRELNKDWIFDESELKITLGIIESPSGESYSEKKVKEIKSLLILRHT
FT                   PVENNTSLLYHRGQFNLKIINKGRRGLIVKKISTGDLMWT"
FT   gene            103173..103874
FT                   /locus_tag="BcerKBAB4_5502"
FT   CDS_pept        103173..103874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bce:BC3186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5502"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46490"
FT                   /db_xref="GOA:A9VV58"
FT                   /db_xref="InterPro:IPR009988"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV58"
FT                   /protein_id="ABY46490.1"
FT                   /translation="MGQGSRFQEKQQNRRKKVIFNIAFTLVLVTVGIVTYQLFSPSDTS
FT                   KKAIAQEKKATKIEEKKHKEKEAAQLEEKKREVKEAAQLEEKEREEREAALLEEKKREE
FT                   REAALLEEKQKAEKSVKTSENENKEGEKTASQEKGSQTNPSWKPIGTEQGAKPAMQFKE
FT                   GTADWSEMKKAISYAVDVPESQLIFDFIGNNGNNKAYGNVRDKQSNKKYKVDIDWVENQ
FT                   GWKPASVQVVK"
FT   gene            complement(104060..104278)
FT                   /locus_tag="BcerKBAB4_5503"
FT   CDS_pept        complement(104060..104278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5503"
FT                   /product="protein of unknown function DUF909"
FT                   /note="PFAM: protein of unknown function DUF909; KEGG:
FT                   btl:BALH_0906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5503"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46491"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV59"
FT                   /protein_id="ABY46491.1"
FT                   /translation="MIQIKVTPEMLEEAANRASNTRITLESIHNNLCNEIDHLCFQWIG
FT                   ASNQQFIQMFNDAKPKAFTSINSLVQV"
FT   gene            complement(104753..105393)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5504"
FT   gene            105468..106124
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5505"
FT   gene            106631..107071
FT                   /locus_tag="BcerKBAB4_5506"
FT   CDS_pept        106631..107071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5506"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46492"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV60"
FT                   /protein_id="ABY46492.1"
FT                   /translation="MNLNKLIVSCGVISALTFGVLGNNAYAEEVQKSNDAINVIEHVPT
FT                   DLLLTQTLDYTGEAVTSFVYKGSTDLSFFIKNNGQNKMGYSVKGPNKEPIVGGYIKPGE
FT                   QKINVTNVRNALSPLPVGTYKIYVSNDDGSTGQFQVAVNSLD"
FT   gene            107386..108219
FT                   /locus_tag="BcerKBAB4_5507"
FT   CDS_pept        107386..108219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5507"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; KEGG: bce:BC2985
FT                   vancomycin B-type resistance protein VanW"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5507"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46493"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV61"
FT                   /protein_id="ABY46493.1"
FT                   /translation="MNIVNLRPKQRSKYRIMLGTWYYSTKRYIQWLADGKTYAKTLQQE
FT                   KLPCTAIQHRTILLRKLKDVDMWYQQNKVVNLKIAIKQLDGIVIRPGETFSYWRLIGKP
FT                   TRRKGYVEGMILHYGSFQAGIGGGLCQLSNLIYWMTLHTPLTVTERYRHSFDVFPDSKR
FT                   TQPFGSGATCSYNYLDLQIKNETDQSYQLHLYITEKHLVGEWRTAYPQLYQYEVYEKEH
FT                   SIQSAYWGGYIRHNVIQRRVYSQQKQFVEDQYVTENHAIMMYEPLLACNNEESGD"
FT   gene            complement(108739..109089)
FT                   /locus_tag="BcerKBAB4_5508"
FT   CDS_pept        complement(108739..109089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5508"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cps:CPS_1684 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5508"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46494"
FT                   /db_xref="GOA:A9VV62"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV62"
FT                   /protein_id="ABY46494.1"
FT                   /translation="MKLGHIMIFVNDMTKARWFYSELLGLKTLLEQENKLVFALDGCQL
FT                   IAFKCEKTKEIGDYSNEARTVLVFEVVSVEQTYKELKEKGIQFLHDKPTQGRYAAFVDP
FT                   FGNVHEIAESFG"
FT   gene            109525..110193
FT                   /locus_tag="BcerKBAB4_5509"
FT   CDS_pept        109525..110193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5509"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bca:BCE_3336
FT                   IS240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5509"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46495"
FT                   /db_xref="GOA:A9VV63"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV63"
FT                   /protein_id="ABY46495.1"
FT                   /translation="MNRQNSFKWKHYQPDIILLTVRWYLRYNLSFRDLVEMMEERGLSI
FT                   AHTTIMRWVHQYSPELDKRVRRYLKKTKDSWRGDETYVKVKGKWMYLYRAVDSEGNTID
FT                   FYLSKNRNAKSAKRFLKKALASCHSVTPRVITVDKNLAYPVAIKALHEEKSMPIGVKLR
FT                   QIRYLNNIVEQDHRFIKKRIRTMLSLKSFRTAKWILAGIEAMHMMKKDKPLKRSLSKIK
FT                   "
FT   gene            110443..112608
FT                   /locus_tag="BcerKBAB4_5510"
FT   CDS_pept        110443..112608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: baa:BXA0164 protective antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5510"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46496"
FT                   /db_xref="GOA:A9VV64"
FT                   /db_xref="InterPro:IPR035088"
FT                   /db_xref="InterPro:IPR037149"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV64"
FT                   /protein_id="ABY46496.1"
FT                   /translation="MKKLKPALSVLGSVSMALTLAYPALADIKQPNAGSTIEMFKEDAN
FT                   AKEGKDLIYGTDGKKGKMSTEKIEIQNNDWDQDGISNDLEIRGYKIEFNRQTGKNEAQA
FT                   WDPERDKDKLKFITNPMSANSDGDPFTDAYEVQYYGSNSDTEFNPMVANIPNLQVGIKR
FT                   IGVTPLAAITDSNGGSIDKGWEKSVSTQHSFGVGAGVEGGVEGSAAGPVPSGKASLNVS
FT                   YGYSKTSTDTERYSSNIDWSTAKTVDSAKAAKVSLQLEYKNTGTASAQNVSPHFNIRLG
FT                   DKIISTVKATQDRYKANQLSTEKGGRNTTEVLIDSVDNQADVNIYLSLDELKAVEQGAI
FT                   LSVEVLPTSTMELYIEKDGEFMNLGDSGKFESRVNASTTILETDIGNKPKFRMYAPEGV
FT                   GSDTNLTFNEVLKHVKVDSTKINEFIDNSRGDQVIVAKENLENAKKSYVSKGAKVGVFT
FT                   KIQQPELSYSAYDPFTKKFYAAVVPGLFGASNEVSVSFENKKSKQTQQVTLLRKGNVYE
FT                   SKEAVSLNDFNPSQKVTFEINDAQKKLPIQKISTVVTYNKEYENYLTHRFSDELIVEGT
FT                   PYTMKASGNPVLSYKGNDKWQYLAYAGNYTQPVNVIIERKGQPKPGQPIKKGEDIHIKV
FT                   QNSAYSGYEYLKLQNGYIHFDQKQNASTFKFNHIHSPGSLDYQREWNLQSDGNNIGLDK
FT                   GGSGYVTYGNDVHTGSSLNRWSFDKAK"
FT   gene            113459..114169
FT                   /locus_tag="BcerKBAB4_5511"
FT   CDS_pept        113459..114169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5511"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: pth:PTH_0245 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5511"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46497"
FT                   /db_xref="GOA:A9VV65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV65"
FT                   /protein_id="ABY46497.1"
FT                   /translation="MKKILIVEDEENIREVCKRYLEREEYEVYTAVNGTEGWDVFLTHQ
FT                   PDLIILDLMMPKKDGWELCGEIRQQSNVPIIMLTAKGEERDRILGLTMGADDYLTKPFS
FT                   PRELVLRVQIILRRGNQVAIQAKESLSEVIEFPDLKIYPKTRCVLVCENEVELTVKEFE
FT                   VLYVMAKHPKQVFSRSQLLELIWDFGHEGASNTVTVLVSRLREKLEKHTIKNHWIHTVW
FT                   GIGYRFEPNGRNES"
FT   gene            114166..115245
FT                   /locus_tag="BcerKBAB4_5512"
FT   CDS_pept        114166..115245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5512"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ssa:SSA_1114 histidine
FT                   kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5512"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46498"
FT                   /db_xref="GOA:A9VV66"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV66"
FT                   /protein_id="ABY46498.1"
FT                   /translation="MRLRIQLLLMNLLSTSILVIAIWYSETKMLLEPEQTRLLTVIAVV
FT                   GLIISTFIYWLMTRPIMRSIKNLMTLTKQFSDRQFETMYIIGKEPREFKELATSFQQMA
FT                   KKLEEGFTQLEEGEKARKELITNISHDLRTPMASIQLMIEALQDNLIEDPEMRKQYLAT
FT                   ILKEIERLSGLINDLFELSKLEFEQVDFYPSFTHIDKVLLDVLESHSVLLEDKQIDLQL
FT                   QVPDRLPRLLIMPCKIARVIGNLLDNAIRYSPVSGTIELIVEENKQNQQVQFILRDEGE
FT                   GISPNDQLRVFERFFRTDQSRSSQSGGSGLGLAIAKSLIEMHKGEIGVRDRADGKQGSE
FT                   FWFTLPITSEKNKTAERLL"
FT   gene            115323..115826
FT                   /locus_tag="BcerKBAB4_5513"
FT   CDS_pept        115323..115826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5513"
FT                   /product="secreted protein"
FT                   /note="KEGG: sco:SCO0153 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5513"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46499"
FT                   /db_xref="GOA:A9VV67"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV67"
FT                   /protein_id="ABY46499.1"
FT                   /translation="MKRKYVWLIGGSIILVLILWSLFRPEKLFIDKKVNETLPQTEMQS
FT                   MKTKQVQDQVQVISAGQFQNGVHETTGTATIHQLADGKRILRLSNFSTSNGPDVRVVLV
FT                   PTDRLKNNEDVKNHQYIELGKLKGNKGNQNYEIPEGIDVSTYGSVSVWCKRFNENFGAA
FT                   YFKK"
FT   gene            116018..116342
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5514"
FT   gene            116476..117219
FT                   /locus_tag="BcerKBAB4_5515"
FT   CDS_pept        116476..117219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5515"
FT                   /product="Collagen triple helix repeat"
FT                   /note="PFAM: NHL repeat containing protein; Collagen triple
FT                   helix repeat; KEGG: btl:BALH_p0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5515"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46500"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR021201"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV68"
FT                   /protein_id="ABY46500.1"
FT                   /translation="MFLGGGYMERKNKWYGLNSNVNLSASSFDPNLVGPTLPPISPISV
FT                   PTGPTGETGITGPTGPTGPTGPTGVTGITGPTGPTGATGITGPTGPTGETGITGPTGPG
FT                   PTVSLKFLYVANFNENTVEIYDIFNPIFPVRIGEFNGGNLANPAGLAITGTTLYVTNNG
FT                   DNTVEIYDILNPIAPVHVGEFNGGNLSEPDGLAITGTTLYVANFNDNTVEIYDILNPIA
FT                   PVRVGEFNAGNLSSPAGLIIFSLFG"
FT   gene            117417..117788
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5516"
FT   gene            117798..118301
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5517"
FT   gene            118528..120342
FT                   /locus_tag="BcerKBAB4_5518"
FT   CDS_pept        118528..120342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5518"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: dsy:DSY1105
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5518"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46501"
FT                   /db_xref="GOA:A9VV69"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV69"
FT                   /protein_id="ABY46501.1"
FT                   /translation="MPEPLKKNSRYMVGLDSLRGLAILGVILYHINFNWMPGGFLGVTV
FT                   FFVLSGYLITDILAIEWKNNKRIDLKKFWLSRARRLLPGMLIMLIVTLAWITIFHSSLL
FT                   VKMRGDSLAALLYFSNWWYIYHKLSYFDSFSQLSPLNHFWSLAVEEQFYVVWPFVISLG
FT                   FYYIKKQSRMILFICLGAIASALAMAILYEPGTDPSRIYYGTDTRAFSLLIGAALALIW
FT                   PSSRLASKIIPQARLILDIIGGVALIIILTMFWKTNQYEPFLYRGGMVLLSIATALLVA
FT                   NLAHPASRIAQFLRFRPLRWMGVRSYGIYLLHYPIITLTTPKVNTGEFSFTRAILQFLL
FT                   IIIVAQISWKFIENPIRKGALKNIRIKNLKIRNLTLSGKLVLICAVFISSIATFGLTTA
FT                   SKAKENTQKDKVEAVQEEQAKHPVAVWEKPADEPPQNKEEQKEENPAQPKDPLTVTAVG
FT                   DSIMIDIAPYLKNTFPNIRIDAKIGRQMSQAIPAVEQLKNEGNLGSNVIIGLGTNGAFT
FT                   KEQLASLIEVIGNERKIILINTRVPRPWESLVNEKLKEAASSYKNVVLVDWYSASAGNK
FT                   AYFEPDGVHLTKIGAEAYAALVAKEVNQ"
FT   gene            complement(120529..121224)
FT                   /locus_tag="BcerKBAB4_5519"
FT   CDS_pept        complement(120529..121224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_2236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5519"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46502"
FT                   /db_xref="GOA:A9VV70"
FT                   /db_xref="InterPro:IPR039286"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV70"
FT                   /protein_id="ABY46502.1"
FT                   /translation="MSEQCPINVPCQVDGQTQTPLSDAAATPILTPGAPIVKIPVVLAE
FT                   RTIQIVVESDISLDPPAVEIKRILKNVFLTQCKLVPVAFTPIPGTNYRQVTRAKLFVQG
FT                   YIRKNIEYASDDCNGVLYDRIANVPFSGFADLTAADFLSLAIVASSSDTTSHFINPKNG
FT                   DLPRLDKYFFENTVFYNEQPYCELVSAQFFELDFSPCPTDLNEPFDTLREKIVLDLTLK
FT                   VLQVQQVQV"
FT   gene            122870..123352
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5520"
FT   gene            123514..123708
FT                   /locus_tag="BcerKBAB4_5521"
FT   CDS_pept        123514..123708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5521"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46503"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV71"
FT                   /protein_id="ABY46503.1"
FT                   /translation="MEGIKVPYLQTPTGYFVKVSVTIKGQTERGTRIAQGVIAPVKTAS
FT                   FVEVGGQRGENGFGSIGVK"
FT   gene            complement(123766..123978)
FT                   /locus_tag="BcerKBAB4_5522"
FT   CDS_pept        complement(123766..123978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bar:GBAA2025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5522"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46504"
FT                   /db_xref="GOA:A9VV72"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV72"
FT                   /protein_id="ABY46504.1"
FT                   /translation="MSETIIICLYIVFGISAVLGLIKELKKPKKNQFLILFESLILIGA
FT                   IFLVVSDHFCRIPCVVSYMINSILV"
FT   gene            complement(124383..124781)
FT                   /locus_tag="BcerKBAB4_5523"
FT   CDS_pept        complement(124383..124781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5523"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: btl:BALH_2073
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5523"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46505"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV73"
FT                   /protein_id="ABY46505.1"
FT                   /translation="MRNGIITRKNPTNMPEPVGNYTHITKIPRNAELFVSSGQIGINQD
FT                   GQFPESMNEQISNTFKNISKVLESEELTAANIIKVNVWATEKIDWEHMDFEWEQLFNTE
FT                   YPAMTIGYISELGLPEIKIEIEIWAARP"
FT   gene            complement(125270..125434)
FT                   /locus_tag="BcerKBAB4_5524"
FT   CDS_pept        complement(125270..125434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: baa:BA_1549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5524"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46506"
FT                   /db_xref="GOA:A9VV74"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV74"
FT                   /protein_id="ABY46506.1"
FT                   /translation="MPVTLELILFILIAISAIGYLIKEFQKTRKKTLGISIEFLALFWS
FT                   IWRISTIII"
FT   gene            complement(125825..125989)
FT                   /locus_tag="BcerKBAB4_5525"
FT   CDS_pept        complement(125825..125989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: baa:BA_4279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5525"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46507"
FT                   /db_xref="GOA:A9VV75"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV75"
FT                   /protein_id="ABY46507.1"
FT                   /translation="MTDTIRIVLFTLVGISAVFSVIKEFQKPEKRKFWITFETLILIGA
FT                   AWMLIGLLM"
FT   gene            126091..126720
FT                   /locus_tag="BcerKBAB4_5526"
FT   CDS_pept        126091..126720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5526"
FT                   /product="Recombination protein U"
FT                   /note="PFAM: Recombination protein U; KEGG: btl:BALH_p0007
FT                   recombination protein U (penicillin-binding protein-related
FT                   factor A)"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5526"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46508"
FT                   /db_xref="GOA:A9VV76"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV76"
FT                   /protein_id="ABY46508.1"
FT                   /translation="MGQGNRGMAFEKLINLVNEMYQRGGVALINKRPTPVKVLKSKGGR
FT                   VLNGFYEAKSTVDYDGVYKGRAIAFEAKSTENPTRFDLKNIAQHQLDYLEKAEKMGAIC
FT                   FFLIEFSKGKSVFVIPLAVIQSYVRMSQQPKGKKSIPRADFDIYGYLVEQTERAPVDYL
FT                   QYVDEAVSPVMFDGMIQFDQDHKKVANNIEAAKEKMNNKKHKLLKA"
FT   gene            126858..127226
FT                   /locus_tag="BcerKBAB4_5527"
FT   CDS_pept        126858..127226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5527"
FT                   /product="phage transcriptional regulator, ArpU family"
FT                   /note="TIGRFAM: phage transcriptional regulator, ArpU
FT                   family; KEGG: bcz:pE33L466_0182 possible prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5527"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46509"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="InterPro:IPR010861"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV77"
FT                   /protein_id="ABY46509.1"
FT                   /translation="MEQLTLLPAIDDKKVQKEVVSILKEYRALKMRFNNEVEQEGISLF
FT                   PELRNSKTMSQFKVRQIEKVLDDILDDDERSIISMKFLTNKSVKDSFVQNELMISNSYF
FT                   YAKKKSAIKLVATALGII"
FT   gene            128085..128357
FT                   /locus_tag="BcerKBAB4_5528"
FT   CDS_pept        128085..128357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_3118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5528"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46510"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV78"
FT                   /protein_id="ABY46510.1"
FT                   /translation="MKIKFDVVKNENFDFTLLETRLLKTFKEVDSEAIIEKVEDKIFEK
FT                   NDMQTHLVEITINVTGKNIGYRSVSASIFIVLESLSIKLFNISIH"
FT   gene            129069..129431
FT                   /locus_tag="BcerKBAB4_5529"
FT   CDS_pept        129069..129431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5529"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bca:BCE_2526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5529"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46511"
FT                   /db_xref="InterPro:IPR006542"
FT                   /db_xref="InterPro:IPR036166"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV79"
FT                   /protein_id="ABY46511.1"
FT                   /translation="MKKIFALFAILTVFAVFSFGCDIRSLKLYGKDKYYVQIKGEGEIK
FT                   DKTRVYTLPAYDEEGAEKKISFTSHKAENDKKLKEDAFLRLYVSEDNDKSVDVKSYEEV
FT                   KKEDLPEKVKKKLNVK"
FT   gene            130743..131816
FT                   /locus_tag="BcerKBAB4_5530"
FT   CDS_pept        130743..131816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5530"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: bcz:pE33L466_0018
FT                   tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5530"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46512"
FT                   /db_xref="GOA:A9VV80"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV80"
FT                   /protein_id="ABY46512.1"
FT                   /translation="MDYSKQRQKSVHRKKLYENLNEMPFYIEEFVEYKELHDASPSTLL
FT                   NYVYDFRVFFNWLLSEQIIEFKPIKDISFSDLENLKKKDVENFMRFLKLQQNMQNSSVN
FT                   RKISALKSLFKYLTSLSENDDGECYFYRNVMAKIEIHKDKETLNARAKRMRSKIFHNDD
FT                   DQEFLNYIKYEHEKSLTKHQLFYFLRDKDRDVAILSLFLGSGIRVSELADLRMEDINLK
FT                   ERLIDVIRKGNKEDSVWITPIALNDLEKYMEIRDKKYAPGKELKNVFLSKYKHTAQPLS
FT                   VRAIQDIVEKYTKAFGKRMSPHKLRHTLANKLYMEEKDSLQVMQQLGHTSQDTALLYTQ
FT                   LGETTIKDSLGRIGKNK"
FT   gene            complement(132101..133078)
FT                   /locus_tag="BcerKBAB4_5531"
FT   CDS_pept        complement(132101..133078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5531"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46513"
FT                   /db_xref="InterPro:IPR041229"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV81"
FT                   /protein_id="ABY46513.1"
FT                   /translation="MDYKMIAKIYNINVTATLNKGKLIDDQNMRLSNSLATFNRFFNNE
FT                   AFTHAIGFLEFESLQNSIYMYQSGGLKQLQETFKSHSIKGEANYYYINSFLRKIDIFMV
FT                   ALWLVKDHSVNIETGFIVTGTNKNVYSVTSSNTAFLSSKSNGLINDTMFTIEEINEAIQ
FT                   YYKLLHPEINPNIGNQIADGLYKVKSLRVPRAFYFLQAARHETDVPVKIMKYCTILECL
FT                   FTTGRDEITHKISERFAKLMSEQLEQREYYFSLVKKSYAIRSTVIHGQSMSEKRYADAL
FT                   ELAIELDNAIRELLLKIILNSDFEKNFEQNEEDLERWFRKLILS"
FT   gene            133250..134356
FT                   /locus_tag="BcerKBAB4_5532"
FT   CDS_pept        133250..134356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5532"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: baa:BXA0200
FT                   integrase/recombinase, phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5532"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46514"
FT                   /db_xref="GOA:A9VV82"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV82"
FT                   /protein_id="ABY46514.1"
FT                   /translation="MSNREKQVYQARVERHKEKMPWYIIEYIEEKTNLSPATLYGYLIE
FT                   YEMFLQWLISSRLAVADGEVVTKIHEVPIDTLEHLPLKQVKRFKSYLERQGNKTKAVIR
FT                   TFSALKSLFYYLTSNTEDDNGECYFYRNVMAKMEIHKEKIDAAARAKEISEVIFHNNDD
FT                   IKFMRFLSNEYEQMLQENAPGKLRFFKRDRERDIAILSLILGTGLRVSEAASLTISSVN
FT                   FRTRYIKVVRKGDKKSAILATQTALDDVQEYLKVRAVRYKCPEDEDILFVTNYKGSYAQ
FT                   ISVNAIQKFTEKYTRAFDEKKSPHKLRHTYATNHYNENKDLVLLANQMGHNSMETTSLY
FT                   TNIDDTKRRAAIERLEQRQLEENDEIDT"
FT   gene            complement(135175..135591)
FT                   /locus_tag="BcerKBAB4_5533"
FT   CDS_pept        complement(135175..135591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5533"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: lwe:lwe1922 secreted
FT                   thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5533"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46515"
FT                   /db_xref="GOA:A9VV83"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV83"
FT                   /protein_id="ABY46515.1"
FT                   /translation="MIILCFVIIMLIFYMGSTKSSANSSSSFNPISTQKFEELIKEKEN
FT                   VWVYIGRPTCDDCDRFSPVLKEVIKENNKQVYYYNTDEARKENEEKLINHLNKLGVKSV
FT                   PTLIYFKKGEVVKTVVGYQDKASVEKLLKDYESR"
FT   gene            complement(135777..136523)
FT                   /locus_tag="BcerKBAB4_5534"
FT   CDS_pept        complement(135777..136523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5534"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46516"
FT                   /db_xref="GOA:A9VV84"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV84"
FT                   /protein_id="ABY46516.1"
FT                   /translation="MLVIKILANKYEIKGEIYVSLMKKFAAVAMASTLFFGWSGSSTFA
FT                   SPNTESVSKNVSVNQNKDMKSTFKKMNDLANTTKVIQDSQRIQDIKITAENSISSGKVV
FT                   LNHSDAQLDFDNAKYLDISQDNKSYKSITIPIVGDQYNLISNLTVIFDSQDKISNYSET
FT                   LITKSENNKFVITSYSDGELVQNQVTDVDYKSNSEVKKSLDRINAQAINVDAPQYSMGA
FT                   VAACIAAVATMGAGSIAGVIACFNKL"
FT   gene            complement(136527..136769)
FT                   /locus_tag="BcerKBAB4_5535"
FT   CDS_pept        complement(136527..136769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5535"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46517"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV85"
FT                   /protein_id="ABY46517.1"
FT                   /translation="MLAGHLDANGEPQAFKKSSATFEEARSIRCESSKPNWEEGDSGYL
FT                   KTKEGIQPVVVGKTTTQKTVLHIIGANKFVELTPI"
FT   gene            complement(136775..137020)
FT                   /locus_tag="BcerKBAB4_5536"
FT   CDS_pept        complement(136775..137020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5536"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46518"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV86"
FT                   /protein_id="ABY46518.1"
FT                   /translation="MKSVTLSLAPTTFVVTGDKKEELLANAKKTFIEQVSKNLFPHIKY
FT                   SINDADALTMETSFPGLIVETEEGLKGIVTAIKGRP"
FT   gene            137305..137493
FT                   /locus_tag="BcerKBAB4_5537"
FT   CDS_pept        137305..137493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5537"
FT                   /product="RNA chaperone Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein core; KEGG: bcz:pE33L466_0115 host
FT                   factor-I protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5537"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46519"
FT                   /db_xref="GOA:A9VV87"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV87"
FT                   /protein_id="ABY46519.1"
FT                   /translation="MHTLQEDMYEQLKEKKGEVTVFLKNGVPVRGQILATDKFTVLMMV
FT                   HGKQQLVYKQAISTIAM"
FT   gene            complement(137680..139626)
FT                   /locus_tag="BcerKBAB4_5538"
FT   CDS_pept        complement(137680..139626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5538"
FT                   /product="Delta endotoxin central region subgroup 1"
FT                   /note="PFAM: delta endotoxin domain protein; Delta
FT                   endotoxin central region subgroup 1; KEGG: reu:Reut_A0376
FT                   twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5538"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46520"
FT                   /db_xref="GOA:A9VV88"
FT                   /db_xref="InterPro:IPR001178"
FT                   /db_xref="InterPro:IPR005638"
FT                   /db_xref="InterPro:IPR005639"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR036399"
FT                   /db_xref="InterPro:IPR036716"
FT                   /db_xref="InterPro:IPR038979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV88"
FT                   /protein_id="ABY46520.1"
FT                   /translation="MNSNNKTNPNVIGTSSDQSLLTNSVKKTLANDQSNPLQHRDSNDC
FT                   LSVSEGNRDSLNHDVFISAPGLVDTTANITSAILSALGVPMLGTVVKLYSKLFGFLWGS
FT                   TPGQDPWKELMDRVEVLIDQKLTEYARSKALAELEGLQNVMKSYVDALESWQNNSRNSQ
FT                   TRLLVQQRLVVADSQFKQAMPSFAIKDYEVSLLPVYTQAANLHLLLLRDSQIFGKDWGM
FT                   PQHEIDLFYKEHLECIEKYSDHCVEWYHTGLNKLKSSTAKDWIDYNRFRREMTVAVLDI
FT                   VALLPKYDVHMYPMPIHAELTREIYTDPVGSYLPYKGNFKDVMSWYEMTKAYRQPTFQD
FT                   LENLILKPSRFTWLKDLKMYTRKRQNGKYEYYNYWVGHQLEKALIGEKYVRETTISGEI
FT                   TSEEDTFTFEDYDIHRVLCNYIGRYDNSLVGVNQVEFHYLDNNTPRKKEYKKDIRVTNQ
FT                   SQKIIDSEEELLSHRLSYVESFDLYWNHKNEKGGTIPVFGWTHHSVAPKNIIYEDKITV
FT                   ISATKASGYFTSEVIQGPGYSGGGLIKGSKSMGNIPLTPPRDAHNKNYRLRIRYAADSD
FT                   DLLKMTFTSGIGPAKYQTPYQATMKKGDSFKYNSFQYVEKVVTISSSINGINFSAGSGF
FT                   YLDKVEFIPVNEN"
FT   gene            complement(139780..141753)
FT                   /locus_tag="BcerKBAB4_5539"
FT   CDS_pept        complement(139780..141753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5539"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rme:Rmet_5415 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5539"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46521"
FT                   /db_xref="GOA:A9VV89"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV89"
FT                   /protein_id="ABY46521.1"
FT                   /translation="MKITQDPKDATNCTTLFNKQVAEDLNINSETEYALAIKNLVEPCE
FT                   ELVIMEDNKIIWSQKAYQFLEKDEWSSTVNPSLWCNGKNNHVSGLFKVTEEIYQVRGFD
FT                   MANMTMVLTPQKTWVMLDTLMSTECTIAALNFADTYFTKNNLPKLIGNIRAIIMSHSHV
FT                   DHFGGVNGIFTYEEQNPDIPIYAPKGFTEHAVSENIYAGNAMARRAAYQYGSFLDAGKK
FT                   GSISIGIGQTQSKGTISFRLPTHEITENQSIVIDDLKLTFQLTPGAEAPAEMNTHFPKY
FT                   RALWLAENCSGTLHNLYTLRGAQVRDGNAWGKYLLESISLFADETDVTFQAHNWPHWNT
FT                   DDSPNMVREHITVTAAAYKFINDQTLLYINQGYTSTEIADKIQLPTDLAKYWYIRPYYG
FT                   TPKHNAKAVYQKYMGWYDANPANLDPLPNVKRAEKLIDYMGGSDAVIEKSLIDFENGNY
FT                   QFVADIMSTLVFADPNNQKARFLAADALEQLGYQSESGIWRNAYLSGAYELRNGTVTDP
FT                   TKYVSGAEITEYMTGEMILDYLGILIDGDRCSHFSLEFNLIISDDIDLTEGSSEYHMRE
FT                   YILKLYQGTVLYFKDTSSSELPTVTMTRQQLLSLTAGSTPEKAKEIAESISDDPKVIDA
FT                   LVNFMSYITQLSEYRHFNIIEP"
FT   gene            141904..142812
FT                   /locus_tag="BcerKBAB4_5540"
FT   CDS_pept        141904..142812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5540"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: ssp:SSP2166
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5540"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46522"
FT                   /db_xref="GOA:A9VV90"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV90"
FT                   /protein_id="ABY46522.1"
FT                   /translation="MNIEQLKLIVTLSEERKLSRVAQKLNLTPSAVCQGIKNLEKELHT
FT                   TLFNRSKNGTYPTTEGLHVIKKAYEALKTIDEIVEYTTEKKDYPKLNMKIAIVPGVIPP
FT                   LVEAINELKMEFPFVEMEIIQGKTQHVLTSLQMGQVDFGLIMHSDNIQSKSIPYNIKKV
FT                   CNGEFHIAMSRNSKLALYNQIDYETLIKEPLALYQDEHILDYVRHIEKETGEYSNTLFV
FT                   TNNSNSIIYAVKNNFAITISPQFTFNNEYRNFYNDIKQVPIKVDENRQPFALWFVSSKR
FT                   TDSTEITDTFFQLIHHYVNAL"
FT   gene            complement(144065..145450)
FT                   /locus_tag="BcerKBAB4_5541"
FT   CDS_pept        complement(144065..145450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bca:BCE_2868 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5541"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46523"
FT                   /db_xref="GOA:A9VV91"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV91"
FT                   /protein_id="ABY46523.1"
FT                   /translation="MYFIKKYHHFLITEYKVIIITGVLIFTKLIIVGRELNSMDILITI
FT                   LMFASISLLVYSLIQKIRKKPAIIWLKIAGISFGLALIISGFSVGVRGGFAAITFIIGA
FT                   CATVKLILQFVKKQSGKLKTFIVVLIAFTTYTILDNVIPYSTSVESSDGNVTSQKKPAV
FT                   DAGKVDAKEESREPTHKQYSTEEIKSLFTIGMSIKEFEEKKEDSKLKVRNYNNYDPAGL
FT                   YTFDTKDGQIVVVVLNAKEVIKVETLTDEASLGNFIKDEENRMNEEKRVAKEEADRKLK
FT                   ESYENNKQKLEGSGDSVTNKVNLKSGLAFFDFNNAGSRNFIIHLKDSSGKDVGLLVNTI
FT                   GSYKGKVSATIPASGEYYLEVKSSGDWNVAITQETPLVSESVPGTINGHGDDVVFINIP
FT                   SGNHIVKLKHTGSRNFIIKVNDQNLLVNKIGSYEGSSSHVFKDSGMYSFGVKADGDWSI
FT                   TIE"
FT   gene            complement(145655..146524)
FT                   /locus_tag="BcerKBAB4_5542"
FT   CDS_pept        complement(145655..146524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_1765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5542"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46524"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV92"
FT                   /protein_id="ABY46524.1"
FT                   /translation="MNQLSLTNKERTSNGKDVGSLRIAFTIENTTNSTFSFSFNKMRAT
FT                   TDQGELFEPSTFIKQNFINPTKKIDDTQDNKIVFNDYGTKDLESIQWVDFTFEINKKSP
FT                   EITIAKTQKYKIRFNIDQHYGGTTTKQEQPQTSSNTDDVTYKNEIKPKIDSMIKEFNNI
FT                   WNQEVKSVFNKEGETLATINQNTLQEQMELVSTKYRELSKENINFNSSDKINDPTLKEK
FT                   INKFREEFGAAANYRENAANAILQGIRDLAPMEDRMKEARKSIKISEQKFNNASTHLTE
FT                   FETKLNSK"
FT   gene            complement(146799..147992)
FT                   /locus_tag="BcerKBAB4_5543"
FT   CDS_pept        complement(146799..147992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_0962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5543"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46525"
FT                   /db_xref="GOA:A9VV93"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV93"
FT                   /protein_id="ABY46525.1"
FT                   /translation="MKKILFAILSVIVVTVLVYYFFFSNSNVDLISEEDVQKKDFLKDK
FT                   QSVIYLSSTADQDMDGKGISYAVFINKNGEASGYKMNGLELGGIGVSENKKELLLESKD
FT                   KLKFVGENFKEFKMKYQHTGDYRAYLKNSDLFVNIYNSGSNPDTGGYDSNVVYGNKKGI
FT                   HKGNIPHYLISAGVDEETIPIMTHDIDKKEYTLKRLTFNDLKMKLEDVTEISVDKNMTY
FT                   SSYSSILSDSNSYYTVLVENDNTIKGKVYLLRVNKTTLKQELVLLSSEEDSTASIPFTK
FT                   NNSAYLHNNELYFINGLGNVITFNTQTNTVNTKFKIDYSVTDGVRYNEQTFFQGDQLYV
FT                   LRYDKNRKNNYYIEIYSLKDGKKIKETEISGMEEIIKSVRGGKSIHAYDFKVLDQSN"
FT   gene            complement(148055..148792)
FT                   /locus_tag="BcerKBAB4_5544"
FT   CDS_pept        complement(148055..148792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_0963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5544"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46526"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV94"
FT                   /protein_id="ABY46526.1"
FT                   /translation="MKKIHALTLTIGLITSAMAVPTATFAGSEELPHLSEIKKMQPDLS
FT                   TSELLSSIDEMAKNTGNTKDAIAEQIYKELKADEALGTKEANEKVKTLGAGGGTVSVGN
FT                   SNMGDFFYTGSYTAYLNHGHVGMYYSSNTIVESVPDNGVRTLSTTARKVDKGDAVVKSI
FT                   NTSWQNKNDAAWWAKDRVGKDGYSYNFATNRSTTHYGAKNCSKLIWSAYKLNGGLDLDK
FT                   DGGAGVYPRDVRDAKQTSTIRNI"
FT   gene            149492..150070
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5545"
FT   gene            complement(150137..150811)
FT                   /locus_tag="BcerKBAB4_5546"
FT   CDS_pept        complement(150137..150811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5546"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: btk:BT9727_1601 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5546"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46527"
FT                   /db_xref="GOA:A9VV95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV95"
FT                   /protein_id="ABY46527.1"
FT                   /translation="MIKLINLEKTYKLGKKTQYVIQGIDLIVEQGEMLAIMGRSGAGKS
FT                   TLLHILAGLEKPNGGSYYFQDKDITQLSYKELALFRKNNIGFILQNHALIEDKNIFDNV
FT                   ALPLLYGKASKKEIHSKVLKILQEMGLEDKVDQYPSELSGGEAQRIAIARALINDPDLI
FT                   LADEPTGSLDEETEQTILNLFTQLNRIGKTFILVTHDETVANVCNRVIRLKDGYIHDGS
FT                   VK"
FT   gene            complement(150816..152099)
FT                   /locus_tag="BcerKBAB4_5547"
FT   CDS_pept        complement(150816..152099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_1600 conserved hypothetical
FT                   protein, possible permease"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5547"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46528"
FT                   /db_xref="GOA:A9VV96"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV96"
FT                   /protein_id="ABY46528.1"
FT                   /translation="MRTLLIELKESLLKKKMLSILILLQTCLLFALISALYLSFYKIDT
FT                   KTKSFYAQYEGKNIYKLSDQLFDEKEVEFFSNPNELLKVKNFYHTLLNSKDFLYLNTTL
FT                   QHIGVQNFKGQSIFLQGYEKGDPRPPYQKKEGLPSFDRVKSIQINDNVLSTFDVKVQKG
FT                   RVFNKEDFLFKKGTKIPIILGAEYQSTYNVGDTIYFDYLNQELEGMIVGILQKNTSFPV
FT                   NGDSEFYADRYVILPEFIMEEVPQNAEVLSFQQKHYLHAINGQIFTNKDMISVQKVVNA
FT                   ISQKVSFDDYIIIGANTIGISLMFTMMKQNIQLMSLFTAVIFIFCIISISLSLIMKWDT
FT                   NIKKYAIHLISGATVPQILLYAFAEILCVICLSLTLIFSFMQLVGEMPISYYFTLLGVS
FT                   LIIIVLGMLPFSFKLNQSNIVKILKKKE"
FT   gene            complement(152103..153143)
FT                   /locus_tag="BcerKBAB4_5548"
FT   CDS_pept        complement(152103..153143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_1599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5548"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46529"
FT                   /db_xref="GOA:A9VV97"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV97"
FT                   /protein_id="ABY46529.1"
FT                   /translation="MYIKRIKKFTIEDGVLSAYVIIFTLMISLTTTYLIKINGIDKITN
FT                   NFYSKNSVAFHIKDDNRPLNMQNLLDHIDERDFMLFKENVLELPYIKGIYKSGDIATPP
FT                   LVSGRFFQADDFFRNKNIAVVGKDNNDIVLKNDKKYIQLNNTSFEIIGVMGEDFSTKLD
FT                   KMIYLNLDAALKLENESYGSYVLDGNKVMTSTFDRLEQDMRSSISIVKADKETVGSSRV
FT                   FERNRGDYGIFVLFILVILSMSIIICSYWFYKKRISISIQHVIGHRMFNIYMNLFKKHV
FT                   LLLISSYFFSIFMFIIFNLNNIDAHLEKYMYSCGLGILFLCVYHFILCILAMFIYSSKI
FT                   RLKVLK"
FT   gene            complement(153345..153782)
FT                   /locus_tag="BcerKBAB4_5549"
FT   CDS_pept        complement(153345..153782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_1598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5549"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46530"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV98"
FT                   /protein_id="ABY46530.1"
FT                   /translation="MLRRKTIALGLAGAMILPTGSVFADENTGSKINSQSIEQTEPQNF
FT                   TEYLGWSELESDKEQIQFSNLNYATQGVSHAGWAEYKNDKRRAVGETTWNGVYHYTRAQ
FT                   LKLYWSVKADSGRQWDWHETRAESPWKNEFFSAHTFYGNEK"
FT   gene            complement(154580..155275)
FT                   /locus_tag="BcerKBAB4_5550"
FT   CDS_pept        complement(154580..155275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5550"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gfo:GFO_0338 gliding motility protein GldA"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5550"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46531"
FT                   /db_xref="GOA:A9VUG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG0"
FT                   /protein_id="ABY46531.1"
FT                   /translation="MTVLNIKEVCKRYKKKIALSPISFQSKQGECIVLCGGNGAGKSTL
FT                   LDIIAGITTPTTGTVQLGNIELQKDRKQYVSEIGYMPDDFHAQQDMTVQEFLFFYAAFR
FT                   NIGKEKVQAVIKSIGLNEKKNERLHRLSKGMRQRLLFGQAYLGNPKILILDEPTNGLDP
FT                   YWVDEFLTILKTLKRDGTMIIFSTHMMDVAAEIGDRILFMKEGKVIQEIKNDGDLENLT
FT                   ITLLQMHRR"
FT   gene            complement(155272..156084)
FT                   /locus_tag="BcerKBAB4_5551"
FT   CDS_pept        complement(155272..156084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5551"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46532"
FT                   /db_xref="GOA:A9VUG1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG1"
FT                   /protein_id="ABY46532.1"
FT                   /translation="MWNILYSEWRSAVRGKLAYMFLFLWITIFSLIFVMERNTPSLVGY
FT                   TNVAGTMVNLILYIVPLLMLIIGAFSIAGEVENGKWRLLCTYPLKSTSYVIGKIIGQFI
FT                   AQTAIFSMSFGVSIIIGLVSGSNFDIFWMVATYIFSVLLIFLFLLLGITIGSFSITRWQ
FT                   ALAISIVVWFFLIMMWPTALISVLNFVPYSMIAPLIKMFLFCNPAEFLRIIFVIQLGGG
FT                   AIFGQVYDQLVMIFQSKAVIWILLIYCIIYTIVFLFVAGWQMERRRKK"
FT   gene            complement(156166..156672)
FT                   /locus_tag="BcerKBAB4_5552"
FT   CDS_pept        complement(156166..156672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5552"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /note="KEGG: bce:BC0564 hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5552"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46533"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG2"
FT                   /protein_id="ABY46533.1"
FT                   /translation="MRVKYMLFAICLCMVFAIVGCGNKETKPVAINEKNDKCDICNMAV
FT                   MDNQFATEVILENGKALKFDDIGCMYKWMDEHKNEKIQEKFVRDYNTKDWVAVDKATYI
FT                   YDKSIKTPMAYNVISFKEKKDADSFVEKHTGEILSSKELAEHKWEMNKEMMGKEKKDHG
FT                   SGHSH"
FT   gene            complement(156672..157949)
FT                   /locus_tag="BcerKBAB4_5553"
FT   CDS_pept        complement(156672..157949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5553"
FT                   /product="Carbohydrate-binding and sugar hydrolysis"
FT                   /note="SMART: Parallel beta-helix repeat;
FT                   Carbohydrate-binding and sugar hydrolysis; KEGG:
FT                   gtn:GTNG_1732 copper binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5553"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46534"
FT                   /db_xref="GOA:A9VUG3"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG3"
FT                   /protein_id="ABY46534.1"
FT                   /translation="MKKICSPLLLLLVFCFPGVSIHAESTLQSKIDAASPYETITLENR
FT                   AYNETIKISKPLTIQGDKNTKIISCGKDPVITINKENIILKDLKIEQCNDNTDQPAIFV
FT                   EGDKHYISGLEVHTSYIGIKLENARDIKIENSMIVGQRRANGIDLWQSNRNLIENIKIQ
FT                   NARDGIYLEQSDNNTIKENTIWQSRYGIHLMYSDRTVVEKNISKENTTGAMIMGTKETS
FT                   VVGNRFIYNKSNVHAQGLLLYDATKTKVLQNEIANNRVGVYVEKADHNTIMDNSISNNF
FT                   IGLQFKDASANEFTQNVMMGNVNESQATQSRENNIYNNYWDASLKVDADGSGTSNIPYK
FT                   ADAYFLLLTQDIPEYQLFFQSPGMRILQSFIKIPDQSLLLDKEPSMRPKGVPQKGEGMA
FT                   FQSNILIVSVSMLLMGSILFILGRKN"
FT   gene            complement(158176..158484)
FT                   /locus_tag="BcerKBAB4_5554"
FT   CDS_pept        complement(158176..158484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_3670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5554"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46535"
FT                   /db_xref="InterPro:IPR018690"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG4"
FT                   /protein_id="ABY46535.1"
FT                   /translation="MEHNKKAAIGDYVQFSYRKNPNLQLTGFVVSVLQNTIVVDVSQIM
FT                   KIEVDDVRQVVKHGYYKKVVHAQIKNNIHNSYTAALTNFSFVRNSITTCSNFLTGFM"
FT   gene            159556..160149
FT                   /locus_tag="BcerKBAB4_5555"
FT   CDS_pept        159556..160149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5555"
FT                   /product="camelysin"
FT                   /note="KEGG: btl:BALH_1143 camelysin"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5555"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46536"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG5"
FT                   /protein_id="ABY46536.1"
FT                   /translation="MSLKKKLGVGVVSAALGLSLIGGGTYAYFSDQVVTNNSFAAGTLD
FT                   LAMQPTTSLNLENLKPGDKILKKFNLKNSGTLDIKDIMMKIDYTVNDLKQNNTTEDFGK
FT                   HIKVQFLWDWDPAKSPAYETTLAELKSQSPEIASKKVFHSKWNETGGLKPGKMDWFWIK
FT                   FIFEDNGTDQNVFQGDSIALKMEFQANQTDGQER"
FT   gene            complement(160521..160775)
FT                   /locus_tag="BcerKBAB4_5556"
FT   CDS_pept        complement(160521..160775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:BCZK2265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5556"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46537"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG6"
FT                   /protein_id="ABY46537.1"
FT                   /translation="MSIISITKSQDSIMIAWQSAEITIPLKDIITISTNDVPHNKLDHV
FT                   VYIGTPSSSKNRILVHTTNLNFIIFVVNPSIILEEINIE"
FT   gene            complement(161740..162399)
FT                   /locus_tag="BcerKBAB4_5557"
FT   CDS_pept        complement(161740..162399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5557"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: bce:BC2447 chloramphenicol
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5557"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46538"
FT                   /db_xref="GOA:A9VUG7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG7"
FT                   /protein_id="ABY46538.1"
FT                   /translation="MKHPLFNHWSETKYLKDIVTNPLIEVGEYSYYSGYYGHQNFEDSC
FT                   VRYLWGDVKSRALFNPIEQMGWHLDKLIIGNYVCIATGVVILMGGNHNHHSEWVTVYPF
FT                   VEQIKQSFEPKGDTVIKSDAWIGMNAIIMPGVTIGEGAIIAAGSVVSKDVPPYTIVGGN
FT                   PAKEIKKRFTDTEISMLMEMRWFDWNRELVERAIPLLSSPSIEQLYNFYKSEVKNK"
FT   gene            complement(162693..162992)
FT                   /locus_tag="BcerKBAB4_5558"
FT   CDS_pept        complement(162693..162992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5558"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bat:BAS3065
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5558"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46539"
FT                   /db_xref="GOA:A9VUG8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG8"
FT                   /protein_id="ABY46539.1"
FT                   /translation="MTRFANHHVDNTILEEDVELLKVMAHPMRLKLISELSKHKTLNVT
FT                   QMTEILNIPQSTVSQHLSKMRGKVLKGNRQGLEIYYSIQNPKAEEIMGLLGPVQ"
FT   gene            163257..163571
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5559"
FT   gene            163597..164052
FT                   /locus_tag="BcerKBAB4_5560"
FT   CDS_pept        163597..164052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_2285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5560"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46540"
FT                   /db_xref="InterPro:IPR031998"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG9"
FT                   /protein_id="ABY46540.1"
FT                   /translation="MDIIGALTIGGSVFSYTAGGITPASAESQFIQKVSPVFDDWQWQN
FT                   YFSLHHNADFLQELALGDLKQGDTFDIRIYTGGKDTGIVKIYRLSEDENEVVNMQRYKT
FT                   IYDTGTKHNYGRFVTPITSVYKPGSYVAVMKLGENYYYYGGSFKIKK"
FT   gene            complement(164233..164703)
FT                   /locus_tag="BcerKBAB4_5561"
FT   CDS_pept        complement(164233..164703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3298 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5561"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46541"
FT                   /db_xref="GOA:A9VUH0"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH0"
FT                   /protein_id="ABY46541.1"
FT                   /translation="MPAAKNIFLQCFHYLHYNVVFLSVLIALTTFNGTSNPIENEGMTN
FT                   MFLKTPGIAIQLFGENIMFVSILFIWHKIIRSFIISPIPSITTSLILSGSSFGLLHLST
FT                   YNYNWVQCLAIIGIPAIAQMIFFLIFKNIHMGYMVHFNYNLIIILFNYIVSI"
FT   gene            165303..165893
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5562"
FT   gene            complement(166054..166989)
FT                   /locus_tag="BcerKBAB4_5563"
FT   CDS_pept        complement(166054..166989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5563"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bce:BC1063 transporter,
FT                   drug/metabolite exporter family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5563"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46542"
FT                   /db_xref="GOA:A9VUH1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH1"
FT                   /protein_id="ABY46542.1"
FT                   /translation="MIQQNSIERKSLPALKMIISMVIFGSVGFFSVQTNLPSFELVFVR
FT                   CIFATIFLGLCWLITGQYKHDKWERKEVIQVLICGFFLVFNWVFLFKAFENMSVTVAIS
FT                   VYHLAPIIVLIIGSIVFKEKLTVLSVISIIICFVGALLIAGINKNFSFDSLMSSGMVWG
FT                   LLAALFYAFTTLFGKGIKNMSAYAMTFLQTFLGIFLLIPFIDFDAFHGLTQSNWTYIIA
FT                   TGLIHTGLVYYLFFDSLRDLSTKLISILVFLDPAVAILLDTVLTGFRPTLMQVSGITLI
FT                   FVGMALTFKKSKNKTQKFKKQTIEDDARVL"
FT   gene            complement(167086..167832)
FT                   /locus_tag="BcerKBAB4_5564"
FT   CDS_pept        complement(167086..167832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5564"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bce:BC1062 3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5564"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46543"
FT                   /db_xref="GOA:A9VUH2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH2"
FT                   /protein_id="ABY46543.1"
FT                   /translation="MIKNKTIMISGANSGIGNACIEYFLEKSFNVIALDINTNKLVDYT
FT                   KTHTSFKLVQIDLSNSNEINNLFIQLDTDTLCPDILINAAGIREITPVLELSDDLFKKV
FT                   IDVNLVAPFILSREAAKRWYKSKTKGCIVNIASVSGLMAEPERAAYVASKHALIGLTKQ
FT                   MAMEFGKQNIRVNSISPGVIRTELTEEYFSDERLVSLIKSNQSLDTWGLPQDIVSCIEY
FT                   LISDQARFVTGSNFVIDGGWTAGKNL"
FT   gene            complement(167829..168569)
FT                   /locus_tag="BcerKBAB4_5565"
FT   CDS_pept        complement(167829..168569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bce:BC1061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5565"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46544"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH3"
FT                   /protein_id="ABY46544.1"
FT                   /translation="MLTTVSNKTSSFDVEQKVHEFESNGYIQIFNDIFLQDQEDQALLT
FT                   KAQLDYYSLQNDAYGECRARAYSRYIKYAGSSDYVLDTDNGYFQSEEYNYDDGGKIRNF
FT                   NSITDEFLHNSLIEKIVRFDSEFASNTNILDTSKDLVIGLHQVRYKATRENPSFSSPIW
FT                   LHKDDEPIVFLHLMNLSNTALGGDNLIANSPREINKLISLKDPLETLVFGQKVFHAVTP
FT                   LGTECNTEALRDILLVTFSYKEPK"
FT   gene            complement(169249..169497)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5566"
FT   gene            169599..170204
FT                   /locus_tag="BcerKBAB4_5567"
FT   CDS_pept        169599..170204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5567"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bld:BLi01487 YrkC"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5567"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46545"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH4"
FT                   /protein_id="ABY46545.1"
FT                   /translation="MYYAPFMYRYQYPYYVNVPMYNYGRQSVYWTSPNEIEYVKRFDSF
FT                   SFSNGDESILLKDYGSEPFVVNINEATKQNNTYRKALWTGTHLQVTLMSLNVGKDIGLE
FT                   IHPGVDQFLRIEQGQGIVQMGKSKDNLNLKRNVYADFAIMIPAGTWHNLTNTGNVPLKL
FT                   YSIYAPPNHPFGTVHVTKTDALTVEEGYSHGNRNTVSY"
FT   gene            170553..170681
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5568"
FT   gene            complement(170766..172085)
FT                   /locus_tag="BcerKBAB4_5569"
FT   CDS_pept        complement(170766..172085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5569"
FT                   /product="aromatic amino acid permease"
FT                   /note="PFAM: aromatic amino acid permease; Amino acid
FT                   transporter transmembrane; KEGG: bat:BAS3066
FT                   serine/threonine transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5569"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46546"
FT                   /db_xref="GOA:A9VUH5"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH5"
FT                   /protein_id="ABY46546.1"
FT                   /translation="MNGNTAKKIEFQAENTAVKNEKYPDPTKWHKQDTTWALSLFGTAI
FT                   GAGVLFLPINAGSGGLLSLLLITLLAYPVMYYSHRALAKMIYASNSAEEGITGTIREYF
FT                   GNKASIIFNIVYFVSIYTIVLMYSVALTNTASSFIVHQLHMQEPPRAILSLVLVLGLIA
FT                   ILNFGQDITVKIMSMLVYPFIASLLFISISLIPQWNTSMLSFSSVSTASTGTGYLGTIW
FT                   MILPIIVFSFNHSPMISSFVMKQRATYGIEATDAKCAQIQKVCYIMTFAVVMFFVWSST
FT                   LSLTPNDLMMAKEQNLSILSYLANELNSPVITIAAPIIAFVAITKSFLGHYIGAYEVMR
FT                   DMIIKSGKTRGKDIGEKTVKTMILTFVVLTCWYVAYANPSILGIIDALSGPLVAAILCL
FT                   LPMYAIRKVPVLAKYRGKMSNVFVIIIGILTVLASIKSLF"
FT   gene            complement(172383..173270)
FT                   /locus_tag="BcerKBAB4_5570"
FT   CDS_pept        complement(172383..173270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5570"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: bat:BAS3067 L-serine dehydratase,
FT                   iron-sulfur-dependent, alpha subunit; TIGRFAM: L-serine
FT                   dehydratase, iron-sulfur-dependent, alpha subunit; PFAM:
FT                   serine dehydratase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5570"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46547"
FT                   /db_xref="GOA:A9VUH6"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH6"
FT                   /protein_id="ABY46547.1"
FT                   /translation="MYMTIREIVDAANKSQKPIYELAIEQEIEQTKTSYEEAWSKMERN
FT                   LATMENAINKSIEGDGVFSPTGLTGGDAVKIKYYRENRKTLSGDLMVLGIQSAIGVNEV
FT                   NAALGAICATPTAGASGTIPGVLYSIKDTMQLTHEDMIHFLFTSALLGTIVANNACISG
FT                   AYGGCQAEVGSASAMAAAAAVEVAGGTPQQSSEAFSTALQNLLGLVCDPVAGLVEIPCV
FT                   KRNAIGTANALAAADIALAGVNNIINADEVIEAMYRVGRQMPRELRETGLGGIAATPTG
FT                   IAIKNKIFGEKQSN"
FT   gene            complement(173293..173991)
FT                   /locus_tag="BcerKBAB4_5571"
FT   CDS_pept        complement(173293..173991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5571"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /note="TIGRFAM: L-serine dehydratase,
FT                   iron-sulfur-dependent, beta subunit; PFAM: serine
FT                   dehydratase beta chain; KEGG: bat:BAS3068 L-serine
FT                   dehydratase, iron-sulfur-dependent, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5571"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46548"
FT                   /db_xref="GOA:A9VUH7"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH7"
FT                   /protein_id="ABY46548.1"
FT                   /translation="MNMNVASIKEKKVVKYKSCFDVIGPVMIGPSSSHTAGALAIGTVA
FT                   NKLFQGLPKKVVVRYYESFAETHKGHGTDFAIIAGILGFAADDSKVPDAIKIAESKGID
FT                   ITFIEKAGDSPAGHPNTADVYLEDESRSIRTMGISVGGGLIEVKHVEIDGFSLDLQGPL
FT                   PVIIAISERADFEFVLRRVFKQYDVEINNFHSLEENRKYLYAFALDSLLPGYVQKELGN
FT                   LSNIANVIIL"
FT   gene            complement(174910..175134)
FT                   /locus_tag="BcerKBAB4_5572"
FT   CDS_pept        complement(174910..175134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_3670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5572"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46549"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH8"
FT                   /protein_id="ABY46549.1"
FT                   /translation="MEYKIKVTIGNYVQFSYRKNSNLQLMGYVVSVLQNTIVVDISEIM
FT                   GIEVDDVRQVVKHGCYNKVVHKQIKNTVS"
FT   gene            175365..176912
FT                   /locus_tag="BcerKBAB4_5573"
FT   CDS_pept        175365..176912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5573"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   bat:BAS3369 spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5573"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46550"
FT                   /db_xref="GOA:A9VUH9"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH9"
FT                   /protein_id="ABY46550.1"
FT                   /translation="MAKFLKRLKYRDNPKSFSIRDNTHFQKKNIEDSLLGADLSKNIAD
FT                   IQNIFRQAPDLVIRRFQIKADGLEAGLVYLSGLTDKELIQNHVLSPLMNSDFDTNTELP
FT                   IPLGQIKIINTWSQIENAIFGGDSVLLIHTRTTAHQLDTKGWPQRNVEDAHNEIALKGA
FT                   HQGFTEIRSQNIAMIRRYIPHRELTVKEIVIGVRSKTRISILYLKDVASEDVLKELETR
FT                   IHNITVDAVASNGELIEFIEDNPYSPFPQFILTERPDLAVSHILQGRFVTVMDHSPNVL
FT                   IAPTNFISFFQGVDDYGTRWLVASSIRMLRFISFIIALFLPASYVAFISFNFEVIPVEL
FT                   YLSIAESRTRVPFSPVMEALLMEITLETMREGALRIPTPIGQTVGVVGGIVIGQAAVQA
FT                   GIVSNIMIIVVAITAISSFVIPNYDMGAAVRLLRFPMMLAAALFGIVGLVIGWMTLIGH
FT                   LISLESLGTPYGTPLAPFRFADMKDAFLRFPLWAIRRRPKGNGTIQSIRQGKNPNKR"
FT   gene            176917..178020
FT                   /locus_tag="BcerKBAB4_5574"
FT   CDS_pept        176917..178020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5574"
FT                   /product="spore germination protein"
FT                   /note="TIGRFAM: spore germination protein; PFAM: Spore
FT                   germination protein; KEGG: btk:BT9727_3333 spore
FT                   germination protein; amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5574"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46551"
FT                   /db_xref="GOA:A9VUI0"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI0"
FT                   /protein_id="ABY46551.1"
FT                   /translation="MKKYAYNDITLMQYIVLINGMQVATGVLSLPRVLAENAGTDGWIA
FT                   ILIGWIFSTISGVFIVKTAARYPEDTIYDILIRLFGKIVGKAFVVIYMMYFAFYTCIVL
FT                   VNAMLFLKGWLLPKTPDYIVIFLFSIPTFFVARNGPRIIGRYSELFLYMALWIPLFFLI
FT                   PLKENGSWMPFFPLLKEGWKPVLTAVPTTIFAYLGFDIAFFLYPFLQKKQYAVHGMVIA
FT                   NTLTMLFYLFTTIVCFAYFSPDSITQYNQPVLNLVKVIEFRFLERFDMILLAVYLTIVS
FT                   TSWIPALYCSVFCSSQLLGKQDHSSHVVVLLLLIIGIIFWTHPSWNEAEIWQQVFSNAG
FT                   LGLTYILPIILWLYCCLYEKFRQGRIH"
FT   gene            178062..179120
FT                   /locus_tag="BcerKBAB4_5575"
FT   CDS_pept        178062..179120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5575"
FT                   /product="spore germination B3 GerAC family protein"
FT                   /note="PFAM: spore germination B3 GerAC family protein;
FT                   KEGG: btl:BALH_3215 spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5575"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46552"
FT                   /db_xref="GOA:A9VUI1"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI1"
FT                   /protein_id="ABY46552.1"
FT                   /translation="MTGCFDQTNVEDVSLTLVLGIDLDRNDNLLVYISSPVFNKEAKIK
FT                   EETTGVKSATVRKSRDQFDATVMALTAGSKTQVILVGKRLLKRKNWENHLDPFYRDPKN
FT                   TVTARVVAVDGPVSDVIFYSPKDKPRLPIYLTKLVDTASLRNITVKTTLQELYEQRADK
FT                   GVTANITEVKKKNKIWVTGTALLDEKGKYKLTLKSDETKLLRILQQRTTGEFPFTIPIK
FT                   LKSDSQDKDWISFTANGIKVKTKARYDNHFIFNVDVKMRIGITERLFSFNTKKDAAKLQ
FT                   KAIETKLEADFKQLIQKMQTSKIDPIGLGGYARTYTYPEWKKVQNKWNNELAKGDVNVK
FT                   VKIKIGGMGTIK"
FT   gene            complement(179454..180269)
FT                   /locus_tag="BcerKBAB4_5576"
FT   CDS_pept        complement(179454..180269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btl:BALH_2453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5576"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46553"
FT                   /db_xref="GOA:A9VUI2"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI2"
FT                   /protein_id="ABY46553.1"
FT                   /translation="MSFSNELKKAMKQEVPKEVKERAYQSFTQIHKRENKNKLKKKLLI
FT                   TGVAAAIIIPTSTMALNNSYFTQPQLKLNDMITDQVRKYAAAGKSIPLDQKITDQGITL
FT                   HLKEMLLQEDKILVYYRFEQQDGSLIPYEFNTNGLHIVSSGKEKGKQVARPTYKNEKFN
FT                   TVSELGFLSNNNLDSYQKDRIGNPNAPDIGMFYLTNATGKAFETALAFHDKPEGTVVFE
FT                   VLQGERFPNSLTINININRVGKTEGNWITKILIDVEHKSVQKTDMDKNQ"
FT   gene            complement(180253..180837)
FT                   /locus_tag="BcerKBAB4_5577"
FT   CDS_pept        complement(180253..180837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5577"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: bat:BAS2758 RNA polymerase
FT                   sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5577"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46554"
FT                   /db_xref="GOA:A9VUI3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI3"
FT                   /protein_id="ABY46554.1"
FT                   /translation="MATNDNISTWIDRLLSGDEEAFEYIFDLTNQRIYDTVFAIVKNGH
FT                   DTNEIVNEVYFQLWKSISKYDQSRPFLFWLNGIVYKQISQWRKQVWKRMRLFEKQHSMQ
FT                   ESVVEIPEKLLLEKETQKELLTLIQELPFKFRVVIVYRFYHDYTYEEIAELLQIPIGTV
FT                   RSRIHRALEKIRNQSNIEIDEEEYNSNVIFK"
FT   gene            complement(181083..181406)
FT                   /locus_tag="BcerKBAB4_5578"
FT   CDS_pept        complement(181083..181406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5578"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46555"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI4"
FT                   /protein_id="ABY46555.1"
FT                   /translation="MDIKYDEYELLELFESEPEDFLIEGAGVYLYRKMDHLGFKLITIM
FT                   SVYENTIKLSLSYNEGCVFDVNMEFVERVYTRNDILHIQCSEEKKAIEVRFKPHFAINI
FT                   REF"
FT   gene            complement(181446..181727)
FT                   /locus_tag="BcerKBAB4_5579"
FT   CDS_pept        complement(181446..181727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5579"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46556"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI5"
FT                   /protein_id="ABY46556.1"
FT                   /translation="MAPDTLGIRAELNSRAKEMAAKKGYKLGSAEYNELFSKIDPRGMT
FT                   PNVVEDIIKTGSRAPADTPGTWKYSRADGYVILNDNGDVITAVPAKKK"
FT   gene            181744..182142
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5580"
FT   gene            complement(182265..182501)
FT                   /locus_tag="BcerKBAB4_5581"
FT   CDS_pept        complement(182265..182501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5581"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bja:bsl4953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5581"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46557"
FT                   /db_xref="GOA:A9VUI6"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI6"
FT                   /protein_id="ABY46557.1"
FT                   /translation="MPIATIKTFKGALSKEQKVELHKRFADLMVEIEGKGNEEFRKFVI
FT                   LAIEEEEPINMGIGGVGGTDDIVKRITGIKEQS"
FT   gene            complement(182568..183164)
FT                   /locus_tag="BcerKBAB4_5582"
FT   CDS_pept        complement(182568..183164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5582"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dps:DP2317
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5582"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46558"
FT                   /db_xref="GOA:A9VUI7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI7"
FT                   /protein_id="ABY46558.1"
FT                   /translation="MNTNKVEKTKAYIIKKTLPIFNKKGYYGTSLSDITNATKLTKGSI
FT                   YGNFKDKDDVAVNCFLFNVNNITDEIYNNMQGAKNSLEKLLVFPKIYRKIFKDIIANGG
FT                   CPIANTLIESDDTHPILLKLALDTLYRLENFLVSIIEEGLLYGEFIETTESHKTVQTII
FT                   TLCEGGMILTKSTKKESYLINAIETIEEIIYSLKK"
FT   gene            complement(183515..183826)
FT                   /locus_tag="BcerKBAB4_5583"
FT   CDS_pept        complement(183515..183826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5583"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   btl:BALH_4674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5583"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46559"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI8"
FT                   /protein_id="ABY46559.1"
FT                   /translation="MIVTTTNTIQGKEIIEYVDIVNGEAIMGANIVRDIFASVRDVVGG
FT                   RSGAYESKLKEARDIAMEEMKQLATQKGANAIVGIDVDYEVVRDGMLMVAVSGTAVRV"
FT   gene            complement(184041..186254)
FT                   /locus_tag="BcerKBAB4_5584"
FT   CDS_pept        complement(184041..186254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5584"
FT                   /product="putative cell wall binding repeat-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat-containing
FT                   protein; KEGG: cpf:CPF_0490 cell wall binding repeat domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5584"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46560"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI9"
FT                   /protein_id="ABY46560.1"
FT                   /translation="MKKKFKTIGIGKKVIPTAAALGILFSVAPIAENKASAGIGTVIDI
FT                   SITVLGAVANTYEALGINPENPDPGTHIDVYAENETYQAPSFTSGEFNISMYHTQGDVN
FT                   FLKPVKVRYPNGRIEIHQLKSGQQLKITEAGAIIDLNPNGANVSEHDLLYITQAQLDEG
FT                   KTGVVINQGQHAFVEKASGKNPRFLGPLYKKYSGDSFGDWTVIARNSDYLFDQIANKLS
FT                   DKQKQLITLTSKPVSKDVLDTYVNNEPKARADFYDRLSDILAERTNVLETSIALPFTTL
FT                   NDGKSYQIIPYKKGTNKVIVKTGSKYLSGKEGNRLQYSDSLGDDEVFELVQIGNSYDDK
FT                   FQFRLNNKNGVSLAGNQNIHGFATDWSFKSEIRFPDKSNNEIHNWLIEWYPGKENERQK
FT                   YDKIEMIKNEKDPTKYSAKDSSGNVIKNSWVNRENQYFFADAEGVILTGWQEIKGKTYY
FT                   FSSPYGQMVTGGGSDSLIDGKFYNFNDSGVLQRSVWRGNNYSDASGEFVKEGLKDIDGK
FT                   VYYFKDYHPTTNELPIKDQDVTLHFSDKGVIERVSKLNGEAINSSVNVKLDNKTLAFNQ
FT                   DGSILKTGINKNANTIAYYSLEDGPSYTGWKMIDGKRYYFTNGFNDTFNDYKNIDGKKY
FT                   YFHEDGSVNRAGFEKTDGKLYHFDNNGVAQTGWQTIDNKYYYFDENGAAKTGWFQVGGG
FT                   YRPWPLAYGYLWYCAREDGSLYSDGWFKIDGKDYHFDQWGHKM"
FT   gene            186850..188049
FT                   /locus_tag="BcerKBAB4_5585"
FT   CDS_pept        186850..188049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5585"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46561"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ0"
FT                   /protein_id="ABY46561.1"
FT                   /translation="MKGKIKRCIKKIPPVGIAMGIVFSLNPFTKHKAKADVDTFATIVT
FT                   TFGDTYDSFLKEPFVISLSEQSAKNDYLANNENRAYKAPTFNKGEFGISAYDYYKNQNF
FT                   SKRIKLFYKDGKVEYKTIKHGQQLLIKQAGIIVDLNPDASDLYEHDILYITQKQLDEGN
FT                   TGIALTNWQTYYLKSDNSGQMNGPLALKYIRQEFPNIKPGSASFDLEKLFHALPEEKRK
FT                   LATITSNPVKPSEIFSYTSDELAEIKRHKLAVVTQYKNEECSSISMKIRNRDNVLRTWE
FT                   DSMNISASSNWIPEDRSIFTIIPIKKGSNKVYIEANSTYLTSANGEVGVTGFRAYGQVW
FT                   TLVNYGFESFSLKNNHGQYLSVNDTSVCLTDKPDKNTIFPITIQKEKWNEWLAKWYSSK
FT                   "
FT   gene            complement(188363..189040)
FT                   /locus_tag="BcerKBAB4_5586"
FT   CDS_pept        complement(188363..189040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5586"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: btl:BALH_1747 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5586"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46562"
FT                   /db_xref="GOA:A9VUJ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ1"
FT                   /protein_id="ABY46562.1"
FT                   /translation="MTTILVVEEGITIRNFIVLIMNRAGFNALAADTGETALELLGKHN
FT                   VDIILIDVMLPGIDGFQVCKSIRENNKNIGIIMLSARVQDRDKVQGLTIGADDYIEKPF
FT                   SSIELTARVQALLRRVKGNKENMESIHSEPFRLNLQQERLYKEGVVIDLTPTEYIILRC
FT                   LMENQGKPISRDELLNEIWGVNYVVKTKVIGVNIRRLRQKIEPNPSGPQFLRTVWGKGY
FT                   VWR"
FT   gene            complement(189060..189484)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5587"
FT   gene            complement(189554..189694)
FT                   /locus_tag="BcerKBAB4_5588"
FT   CDS_pept        complement(189554..189694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5588"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bce:BC0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5588"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46563"
FT                   /db_xref="InterPro:IPR025417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ2"
FT                   /protein_id="ABY46563.1"
FT                   /translation="MLESLLFFFAIGIACELAAINRNGRKKIKQQAEMIQLLKELHERK
FT                   I"
FT   gene            complement(190019..190501)
FT                   /locus_tag="BcerKBAB4_5589"
FT   CDS_pept        complement(190019..190501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5589"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46564"
FT                   /db_xref="GOA:A9VUJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ3"
FT                   /protein_id="ABY46564.1"
FT                   /translation="MNTLIYNNDDGVNKMKQAKLNITLSLIQLFALVINLCMCSSTMRF
FT                   LPWFVKGAVRCYEIFLTAPLLLITGTVMTYHNTRKRHSILPIRQCISFITIIFFVSTFL
FT                   LPSTDEIVITSLIFNFGMVVITIVFLLKDIAQLNKNRKYRIKKKRIRRHSFGERMK"
FT   gene            complement(190506..191032)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5590"
FT   gene            complement(191146..191811)
FT                   /locus_tag="BcerKBAB4_5591"
FT   CDS_pept        complement(191146..191811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5591"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: bcy:Bcer98_1501 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5591"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46565"
FT                   /db_xref="InterPro:IPR019454"
FT                   /db_xref="InterPro:IPR036785"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ4"
FT                   /protein_id="ABY46565.1"
FT                   /translation="MTYRKVALIGILSIGFLGGCLGSQPEEELYVAFENAANQEKTLFE
FT                   NVNKLEQLETKGQELYDQIVQEGKEHNEAVIPKIEQAVTNVDEREKVLKSEKDVLEKAQ
FT                   KETTSVHSYIDKIEDEKLQKQAKKVGEVYKNRYEVFQKMDKICKESLITEKELYEKLKD
FT                   KEINLKEISEKVKAVNTLNKETLKEKAKFNQYTKDYNEGKLRFYKDAKIKIKEQKQEY"
FT   gene            complement(191829..192647)
FT                   /locus_tag="BcerKBAB4_5592"
FT   CDS_pept        complement(191829..192647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5592"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   bcy:Bcer98_1500 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5592"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46566"
FT                   /db_xref="GOA:A9VUJ5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ5"
FT                   /protein_id="ABY46566.1"
FT                   /translation="MRNITNIKRIVITIVAIAIAIGYFMFQTITSSATAVAKQENPVQL
FT                   VSAQPETEIKKAVPVRLNGQERKVAYLTFDDGPGKYTAQLLDILKENDAKATFFLIGQN
FT                   VKSYPELVKREEVEGHYVGMHSMTHDYKKLYTQAGYVDEMKEDQSLIASILGHAPKLTR
FT                   PPYGSMPGLHEELRNKAVEDGLRVWDWTIDSLDWEYNSVPIDTAKAKIVQNVLAGATDP
FT                   KEVILMHDIHPQSVAAVPAIIKGLKEKGYEFEAYHEDDHFPLNFMHDKRM"
FT   gene            complement(193378..194511)
FT                   /locus_tag="BcerKBAB4_5593"
FT   CDS_pept        complement(193378..194511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5593"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="KEGG: gtn:GTNG_3381 alanine dehydrogenase; TIGRFAM:
FT                   alanine dehydrogenase; PFAM: tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase; alanine dehydrogenase/PNT
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5593"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46567"
FT                   /db_xref="GOA:A9VUJ6"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ6"
FT                   /protein_id="ABY46567.1"
FT                   /translation="MIIGVPKEIKNNENRVALTPAGVIPFVTAGHKVLVETNAGVGSGF
FT                   RNVDYVYAGAEIVESAAEVWNQSEMIMKVKEPLESEYIHFRPNLILFTYLHLAAESNLA
FT                   QALKDKRVTAIAYETVEVNHTRPLLTPMSEVAGRMSVQIGAQFLQKSNGGQGILLAGVP
FT                   GVNRGKIAIIGGGIVGTNAAKMAIGLGADVTIIDLNADRLRQLDDIFGTQIKTLMSNPF
FT                   NIAEAVKQADLLISAVLIPGAKAPKLVTEEMVQRMKPGSVIVDVAIDQGGAVETCDHVT
FT                   THDNPTFEKYEVLHYSVANMPGAVPRTSTIALTNVTIPYALQIANKGVQTAIFENDALK
FT                   LGVNTLNGEITCEVVAKELGYKYVSIEEAFAKRIVSN"
FT   gene            complement(194641..195873)
FT                   /locus_tag="BcerKBAB4_5594"
FT   CDS_pept        complement(194641..195873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5594"
FT                   /product="putative transcriptional regulator, PucR family"
FT                   /note="KEGG: gtn:GTNG_3380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5594"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46568"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ7"
FT                   /protein_id="ABY46568.1"
FT                   /translation="MTYMKNDSFRVTFDSLDEFADIVSEILQCPITIEDVNHRLLAYST
FT                   HDERTDPARIGTIMGRRVPEKVINNLWKEGIIPDLLKNREPIRVKKRDDIGLGDRVAIS
FT                   IWNKEDVLGFIWALEIEKSLTEQDCLLLKKYAEVVKSKLLQLQARKNQKEERSQEFFWK
FT                   LLTNHMQVNTEIMENFYLLQITPASLFTVSVFRFEQGITNEKEKQISYLLKTSQHLKVL
FT                   LYTIDRNQLILLTSLDNVKRPFHEINNFIEMFVHNMEKRYGIKSIKPAFSSVYSDYQKI
FT                   SKAYKETLTVLSIKEKFPSDTTNIHSYQNLGIYQLIDLLLEQRKDEEYENQALQKLDEY
FT                   DHKHNCNLIETLEVYLNKDSNVGEVAKALNIHANTLSYRLKRIYEISEIDLKDPNQKMI
FT                   LYLDLKLKKFM"
FT   gene            complement(196180..196428)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5595"
FT   gene            complement(197191..198333)
FT                   /locus_tag="BcerKBAB4_5596"
FT   CDS_pept        complement(197191..198333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5596"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mms:mma_0094 transporter of the MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5596"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46569"
FT                   /db_xref="GOA:A9VUJ8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ8"
FT                   /protein_id="ABY46569.1"
FT                   /translation="MPSIIYLLALAIFCMTTSEFMVAGMMNELALAFQVSVSSIGYLIT
FT                   AYAGAMVVGGPILTAILLRMRSKQALLFLMFVFLIGQSLGAIAWNYDIMMISRIITGIA
FT                   SASAFGVAISFSATLVHSDSRGKAASIVLAGLMFATVLGLPITTVISQYFGWRISFGAV
FT                   SVLVLVSGIMIQWLLPSSSNKEQLNWKDELLRFKNIHLWAAYVTSMFIIGGTFAAFSYF
FT                   TPIFTNVTGFSSASIPYLLALYGSATVIGNIIIGKFADKFTMKILMGGLIILIVALSSF
FT                   ALGAENKYIAVISTIFIGLTGVALNPAMVARVMKTASNGTMINTVHSSFITLGIVIGSS
FT                   LGGLGISKGYGFVSPLWIGACLAILGGISLLPYLHKRKTD"
FT   gene            complement(198396..198992)
FT                   /locus_tag="BcerKBAB4_5597"
FT   CDS_pept        complement(198396..198992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5597"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_5935
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5597"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46570"
FT                   /db_xref="GOA:A9VUJ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ9"
FT                   /protein_id="ABY46570.1"
FT                   /translation="MNKRGRPREFDYSSIVDVAMKTFWIRGYEGCSTQDLCSDTGLGKG
FT                   SLYNTFGSKHELYKQVLERYHEIGIREQKKLLDTPIPVKERLSNFFEWALKEDLENIDQ
FT                   KGCLLINASVERAKNDLMVQEIFSKHVELLKQAIETVMEEGLQTGEISKKQSAEELASL
FT                   LLSSYYGFRVLNVSMQNRMLAEQVIKGTMESIFGA"
FT   gene            199420..199557
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5598"
FT   gene            complement(199702..200859)
FT                   /locus_tag="BcerKBAB4_5599"
FT   CDS_pept        complement(199702..200859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5599"
FT                   /product="haemolytic enterotoxin"
FT                   /note="PFAM: haemolytic enterotoxin; KEGG: bcz:BCZK1700
FT                   enterotoxin C"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5599"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46571"
FT                   /db_xref="GOA:A9VUK0"
FT                   /db_xref="InterPro:IPR008414"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK0"
FT                   /protein_id="ABY46571.1"
FT                   /translation="MNKKLYKKVILSTIITGIAASNVIPLHTFAAEQTVQNSVSQQQED
FT                   SKSYSLGPDKYKEVMEKMGASILTIDSYALTIINQQLTDLSKISSINGDLQANMIQHQN
FT                   DAQTNAIYWFDDLKPHMMKTNQNIVSYNDTFQASYNQLLAALDQKDTVTFKNELEKLYN
FT                   NILKDSQEVDGLLEKLKTFRNKMAEDTRSFKADSNQLISILESTNAGIPLLQQQINNYN
FT                   NTIKENYDKRGGYIALSVFMPPVGIPLIVTADKNIASAQQEIEQLKSRISGAEAELVIL
FT                   TDAKNKTEHMTATIDTAIDALQNISNQWHTIGSKYNSLLKNVDKINPDRIALLKIDLKI
FT                   AKDSWQDLKSYADKLYEGAKVIQNGPIVQIGQPIEGTVQKGQDCS"
FT   gene            complement(201133..202287)
FT                   /locus_tag="BcerKBAB4_5600"
FT   CDS_pept        complement(201133..202287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5600"
FT                   /product="haemolytic enterotoxin"
FT                   /note="PFAM: haemolytic enterotoxin; KEGG: btl:BALH_1664
FT                   enterotoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5600"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46572"
FT                   /db_xref="GOA:A9VUK1"
FT                   /db_xref="InterPro:IPR008414"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK1"
FT                   /protein_id="ABY46572.1"
FT                   /translation="MKKPYKVMALSTLIATIAAGSITPSYASAAENTTKPAPIYADAEN
FT                   NYPEYSLGPEGLKDALEKTGSNMLVMDLYALTIVKQANVNFDGLTVINNDLQKSIKDNH
FT                   DASKTNAKQWLDGLKPQIIQTNQNIINYNTQFQNYYDVLVEAANNNDKETLKAVLTSLD
FT                   ESISENKGAVDRLVQDLKVFRGKLELDTQNLKTDTNKITDILSGQDAGIPLMQKQIEAN
FT                   QTLIDENNKVYIASSVATALGAYLTATIIFAPIGAGALGGGIYGVTTSQQQIKTAQDEI
FT                   INLSKNISTAQQQVGKLTLLKNNTNNLTATIDAAITALENVKNQWQTMGAKYKSLNDNV
FT                   DRINPDKLTLLKADLNIAKRSWEQVNKYAENIQNNEIKFVEEKK"
FT   gene            complement(202339..203508)
FT                   /locus_tag="BcerKBAB4_5601"
FT   CDS_pept        complement(202339..203508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5601"
FT                   /product="haemolytic enterotoxin"
FT                   /note="PFAM: haemolytic enterotoxin; KEGG: bcz:BCZK1698
FT                   enterotoxin; possible non-hemolytic enterotoxin lytic
FT                   component L2"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5601"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46573"
FT                   /db_xref="GOA:A9VUK2"
FT                   /db_xref="InterPro:IPR008414"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK2"
FT                   /protein_id="ABY46573.1"
FT                   /translation="MKKTLVAGLLVTAVSTSCFLPVNTFAESKTTYSQLTSSQNQVAMN
FT                   RLSDSIKTLGSQTPLIQGYGLIILKQPNLEVTAIPGITTDQGTARNHVQDWLDTYNPKL
FT                   FNVNQDMQDFGTRFTNYYDILVELAEKMNDDSQAKEEFVSTFNALQDQMQAIQYDMKGD
FT                   SVDLNNFKNELVEDSKSFSSKVSRAIEGYKSSGGEIEKSRTEIRQLEENIQDDYTKLLA
FT                   LPKENVKGSINIGKSVIDIWIDAGKDHTLDTSNLEVIYNQVGQVQNDEVTKLNNDARQK
FT                   QQQKILLLQKLSKIEVQATQMTLIDLQLNNFTRVVKKQIESFDKLVSSWDIFNDTMIQM
FT                   KRSLSTDAKIDSNALQAQLKELKTFTDELNKQTTEYENSVTNIKVTEAK"
FT   gene            complement(204281..204711)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5602"
FT   gene            complement(204806..206035)
FT                   /locus_tag="BcerKBAB4_5603"
FT   CDS_pept        complement(204806..206035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5603"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: btk:BT9727_2894 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5603"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46574"
FT                   /db_xref="GOA:A9VUK3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK3"
FT                   /protein_id="ABY46574.1"
FT                   /translation="MNNSIDIQHLCDLAHKAFNVPVHILSTDKKILYHSTSDDVCSPFY
FT                   SSKDEHLSDIYQENDPNNLPLFRCNSYLENFVLIHIANHDYIKGTIIIGPTIHPKGSDD
FT                   ITFKLRKEFNLNNNIQERLAYYQCLPEIKKTTLIDMGVLLHYMIFNEKLDVDIVLEKNK
FT                   VLEEVPYKIVKPDLYILKRQQNKPKTHNMALVHNYFSAIKEGDKKKLLQYMYAVSQEDV
FT                   ELILTADPLRNQKNHGIIAITLATRYAIEGNLPPDIAFALSILYIQTMEQLDNVDSVRR
FT                   LSGDALRTFADRVKEFNAQKFSNAVTTCMNHINKNVYDGISLNELANHLDITPTYLSKL
FT                   FKKEVGIPLSDYIQRVRVEEAKKLLTLTTYPLSDICAWLNFNDQSYFTRVFKKSTNMTP
FT                   RQYREKYTVI"
FT   gene            206406..206905
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5604"
FT   gene            complement(207602..207787)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5605"
FT   gene            complement(207859..209031)
FT                   /locus_tag="BcerKBAB4_5606"
FT   CDS_pept        complement(207859..209031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5606"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bcz:pE33L466_0056 integrase-recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5606"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46575"
FT                   /db_xref="GOA:A9VUK4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK4"
FT                   /protein_id="ABY46575.1"
FT                   /translation="MDKQNEKENLLIINNQSENIDTYVENIRDMVPFLHNNRYVDKVEE
FT                   KMEVAEKEGKSKYTYLSDLEVIYHFIHLQKDMDENKNRKEDTKKSYVSEILSFCQCMVQ
FT                   HAEEFELNGEEVQQNTSLLKTLQPWHIRKYNSWLKQVENGRNGDTYAVATLAKKTVLIR
FT                   SFLKHLHVFAYIEKPLHEELQRANVNEQDRPNRDLSYDEVMKILGFYKERGHLVNYTIL
FT                   LALASTGARIQELCTTRVKDLHYDGKYWLKVTGKGDKVRELFISEHLYQCICEMRRRRG
FT                   FQTVLDRGDESPLFVNQRGNFYNSKTLSNQVTDMIKKTNLEFLQYRENPVTAHTFRHAF
FT                   AIMAVEQGNADLYHLMQTLGHENIQTTKIYLEKHMKRKNNVGTSFADLLV"
FT   gene            209435..210436
FT                   /locus_tag="BcerKBAB4_5607"
FT   CDS_pept        209435..210436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5607"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG:
FT                   bcz:pE33L466_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5607"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46576"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK5"
FT                   /protein_id="ABY46576.1"
FT                   /translation="MTQDLLFITKPTVTTKEAAGLLGVTVQTILQKEKDGLIECVYKDN
FT                   WKQFGSKIFYLEDIERIKNIEEVEGYSTKEAAEILNVATSTVFTYIKSGKLPASKIEKR
FT                   GKEVYIIDKDDLETFQLTYEKTTSKERKTFITKIQEEDIYLYQLLTHQHTGKTARVIEI
FT                   NGADGKILTEDEEIFPLSTYKEHDYSFEPFHKQAVITKRGYLSFSLKKPQLFNSIIYNL
FT                   INLFYKELGVTNMRLSISSDTIKLEIKPFVLQVDPLQFQEEIKYLHSHMKSGTILPHVE
FT                   GIYFKSNVEPLTFHADHEFKQKVVQMAADAGMGQEEFLLQAVKFYITNLEKA"
FT   gene            complement(211684..211911)
FT                   /locus_tag="BcerKBAB4_5608"
FT   CDS_pept        complement(211684..211911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5608"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bat:BAS3052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5608"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46577"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK6"
FT                   /protein_id="ABY46577.1"
FT                   /translation="MEEIIKEIVSPSKRYKVQVIKRNDGFFSTEVFAWFEDYGYEYWAP
FT                   IKQGLSLIDTEKHAIAIAMEDLKVYSGEND"
FT   gene            complement(212314..213072)
FT                   /locus_tag="BcerKBAB4_5609"
FT   CDS_pept        complement(212314..213072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5609"
FT                   /product="protein of unknown function DUF975"
FT                   /note="PFAM: protein of unknown function DUF975; KEGG:
FT                   bat:BAS2476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5609"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46578"
FT                   /db_xref="GOA:A9VUK7"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK7"
FT                   /protein_id="ABY46578.1"
FT                   /translation="MTRNLKKAALNSLDGKWGGGIGGSALNYFVPTLSASAIATFMYLI
FT                   VGLFIGLIGLDVIFVYSISGQPQVDPTALVLLILSYIFLGLICFLIYSSIQGIFNYGYS
FT                   AFTLHLGKNEDAKVDDVFLGFKKSNLFRSIKLGLLQAIFLFLWSLLLIVPGIIKYFSYS
FT                   MSYYILVENPDYTASEALRESKRIMKGQKLKLFVLWLSFIGWFLLAVFIGMFTFNLSFI
FT                   FISPYYNTTVSHFYLDLIKKQDAGEAKVSI"
FT   gene            complement(213432..213557)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5610"
FT   gene            213825..214136
FT                   /locus_tag="BcerKBAB4_5611"
FT   CDS_pept        213825..214136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5611"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: btk:BT9727_4158
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5611"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46579"
FT                   /db_xref="GOA:A9VUK8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK8"
FT                   /protein_id="ABY46579.1"
FT                   /translation="MNCNDKVMHILENLRPCFQGLGDPTRQQIVSLLIDKDSLNVTQIA
FT                   EHIPMSRPTVSHHLKILKQSGLLQVQKKGTEMYYCLEFNETINLLKELVSLVEDECKN"
FT   gene            214257..215345
FT                   /locus_tag="BcerKBAB4_5612"
FT   CDS_pept        214257..215345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5612"
FT                   /product="saccharopine dehydrogenase"
FT                   /note="KEGG: mxa:MXAN_0831 saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5612"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46580"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK9"
FT                   /protein_id="ABY46580.1"
FT                   /translation="MNKKTVLIVGGYGVVGSQIARILHDRHPDLEIRLGGRTLGKALPF
FT                   ESERVKIVKVDNTTDDPLRNLDDNFTLVVNAVNDPQDRLLLSAVRKKIPLVDITRWTER
FT                   FKSSIERLKNIEVQSPVVLASGWMGGTAALFSKIYSKDLQEVTVDINALYSLQDKAGPN
FT                   STAYMDRLTIPFEVKAREGMQQAYPMTNPIKIRFPNGYITKCYRLDTPDHVTLPESIHA
FT                   VSANFRIAFDSKISTYGLVSLVNTGIWKMISGEKFTNFRKNILYKPGRGSAHNIVIHLK
FT                   GYDATGVLHRRCVNISDPLGQTHLTALGAAVQAENILQPSDIVVPDSKIYFPENLLDLG
FT                   VNASAILDFYREYGVNITKENI"
FT   gene            215957..217294
FT                   /locus_tag="BcerKBAB4_5613"
FT   CDS_pept        215957..217294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5613"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein;
FT                   Berberine/berberine domain protein; KEGG: bay:RBAM_005580
FT                   YvdP"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5613"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46581"
FT                   /db_xref="GOA:A9VUL0"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL0"
FT                   /protein_id="ABY46581.1"
FT                   /translation="MGSTKLTGRVIFKGDPGYKEAIKNWNPYVNVFPLVFVFAQNACDV
FT                   SNAIKWARKNCVPLRVRSGRHALDKEFSVVKGGLVIDTSDMNKVHLDKKKGIATVQPGI
FT                   RVGPLVKKLAQEGFMAVFGDSPTVGIGGITTGGGFGVLSRSIGLISDNLLELEMVDAKG
FT                   KIHRANSSHNEDLFWASRGGGGGTFGYNTEYTFKVHPAPKTATVFNIVWPWEQLETVFK
FT                   AWQNLMPFVDERLGCILEILSKVNGLCHATGLFLGSTSELKQILAPLLCAGTPTEIVIK
FT                   TLSYPECIDFLDPPEPPFADQNFKFSSSWSNNLWTEKPIAVMKQFLEKAPGTESEFYFQ
FT                   NWGGAIRNVPKDETAFYWRTPLFYTEWNATWVDPSEEASSLASVEKVRKLLKPYTVGSY
FT                   VNVPDESIKHFGNAYWRSNFKRLQKVKTKYDPENVFHHPQSIPPFC"
FT   gene            217530..218237
FT                   /locus_tag="BcerKBAB4_5614"
FT   CDS_pept        217530..218237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5614"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bca:BCE_3336
FT                   IS240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5614"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46582"
FT                   /db_xref="GOA:A9VUL1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL1"
FT                   /protein_id="ABY46582.1"
FT                   /translation="MEKENLFKWKHYQPDIILLTVRWYLRYNLSFRDLVEMMEERGLSI
FT                   SHTTIMRWVHQYGPELDKRIRSHLKQTNDSWRVDETYIKVKGQWMYLYRAVDSKGNTID
FT                   FYLSKTRDQKAAKHYFKKALQSFHVSKPRVITVDKNPDYPIAIEQLKKEKSIPGGMRLR
FT                   QQKYLNNIVEQDHRFIKKRIRSMLGFKCFDTATSILSGVEVMHMIKKEQVDLRDQSVQN
FT                   QKEFIHQLFGLAA"
FT   gene            complement(218356..219078)
FT                   /locus_tag="BcerKBAB4_5615"
FT   CDS_pept        complement(218356..219078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5615"
FT                   /product="Oleoyl-(acyl-carrier-protein) hydrolase"
FT                   /EC_number="3.1.2.14"
FT                   /note="PFAM: Thioesterase; KEGG: bce:BC2458 thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5615"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46583"
FT                   /db_xref="GOA:A9VUL2"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL2"
FT                   /protein_id="ABY46583.1"
FT                   /translation="MQKTKLFCFPHAGGSAFSYAKWKNYFNPYIEVVPIELAGRGYRIE
FT                   ESLYQSMEEAVNDVYTSIVKQIEHSPYILYGHSMGSLIAYEVARKIQDSKNVLPEFLVL
FT                   SGRNHPNSKMKNIRHNLSNEQFKREVIAMGGTPSGVLQSEELMGIFLPILRADFKIVET
FT                   YIHDNNMQACDIDFLIFNGENDEFTTYNQVIKWEQYTSKTCTFHSFKGNHFFLNENIEE
FT                   IANRIIRKLDSKRFSTSF"
FT   gene            complement(219095..219691)
FT                   /locus_tag="BcerKBAB4_5616"
FT   CDS_pept        complement(219095..219691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5616"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   bce:BC2457 4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5616"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46584"
FT                   /db_xref="GOA:A9VUL3"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL3"
FT                   /protein_id="ABY46584.1"
FT                   /translation="MKRLLNLCDINRTLIGDLLIRSLVCQKYKMNNEEIKFIYNEYGKP
FT                   FVQKFSDFHFNISHSGEWVVCATANSNVGIDIERVSDIEALKLANEFFSEEEFYDLSNM
FT                   NSDEQINYFFDLWTLKESYIKTIGKGLYIPLNSFSIKKESRTLISYKNIPKDFYFRQYS
FT                   IEPNYKISACATREEFPQDIIIKDIYTICQNINKF"
FT   gene            complement(220192..235098)
FT                   /locus_tag="BcerKBAB4_5617"
FT   CDS_pept        complement(220192..235098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5617"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: non-ribosomal peptide synthase; amino acid
FT                   adenylation domain; PFAM: AMP-dependent synthetase and
FT                   ligase; Thioesterase; condensation domain protein;
FT                   phosphopantetheine-binding; KEGG: bce:BC2456 peptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5617"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46585"
FT                   /db_xref="GOA:A9VUL4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL4"
FT                   /protein_id="ABY46585.1"
FT                   /translation="MRSDLHAKLSSLSPEKRAWLQKRMQKKENKEALPLSYAQQRLWFM
FT                   DRFNPNSSLYNIPTVWHLKGNWIPEALEKGFNRLIERHESLRTVFKEVGEQPVQQIVEF
FT                   LPRALPVRDYSQLPLEVKEKEVDSLIAREAQEPFDLMNGPLIRNQLVQLGKDEWLLLCT
FT                   MHHIISDAWSIGILMNELLTFYEEETGGNPAKLSSLSIQYADFAKWQKEWLQGDVLNRQ
FT                   LTYWEEELSGELPILQLPVDRPRPVTQTYAGDTHHVIFPYRLLNQLKDISRQEGSTLFM
FT                   TLMAAYQSFLARYTGQKDILVGSPIANRNHKGVEGLIGFFVNTLVYRSDLSGTPTFREI
FT                   LNQTKKKALKAYEYQDIPFEKVVEAVQPERSMSHSPIFQTMFTLQNIKQERLDLSGRSI
FT                   EMVESNMSIVKFDLSLTAYEVEEGLFVSFEYNTDLFDSSTVARMAGHFENWLNEIAYHP
FT                   DESYTKLSMLSDTEQKQLLEEWNDTDVVYGHEYMIHELFEQQVARTPDAVAVVYEGGKL
FT                   TYQELNEKSNQLAHYLQKRGIGPESLVGICVERSPEMIIGLFGILKAGGAYVPLDPSYP
FT                   ENRLRYILENSQIQVLLTKEALQDWLPKDIQAICLDRDQVMISKESNLAPVSGVTANNL
FT                   AYIIYTSGSTGNPKGVMIEHHSVINRLQWMQKKYPLSEEDTILQKTPFSFDVSVWELFW
FT                   WSFVGARVCLLQPGGEKDPAVIEEYIERYRVTTMHFVPSMLSTFLDYMEQYNSKRDESS
FT                   LNQVFTSGEALNTEQVRRFKGVFYDVQQTKLINLYGPTEATVDVTYYDCDLEKEPMLIP
FT                   IGRPIDNTELYVLDQYQQVVPIGVAGELYLGGVGLARGYFNRPELTTERFIPHPFKEGE
FT                   RLYRTGDLVRYMNDRNLEYIGRIDNQVKIRGFRIELGEIEAALHDHSSVKEAVVLVKED
FT                   RPGDKQLVAYVVGEGDTGEWREYLKKQLPNYMVPAYFFQVESMPLTPNGKVDRKALLEL
FT                   EAQFISEDITSSRTPVEELIVSVWSKVLGIRNISVQDSFFEIGGHSLLATQVVSRLQEI
FT                   FQIELPVRELFEYATVESLAKRLDQLRKGDRKRDIPPLMPMERGETIPLSYAQQRLWFI
FT                   DQFTPNSALYNMPIVCRLTGSWLPEALETGWNQLIERHESLRTVFHEVNGQPVQQIEPY
FT                   AFRLIPKTDLTMLSPEGREEEVKRLIQQETEMPFDLGEGPLIRTSILQVGEEEWILLCT
FT                   LHHIISDGWSMEVLLEEWMAFYEKATDGKIAELEPLPVQYADFAQWQKGWLKAEVLDQQ
FT                   LQYWKEELSGELPVLQLPMDRPRPAIQTHDGSTYTLVLPSALHDKLNEFSLQEGATLFM
FT                   TLLAAYQSFLSRYTGQEDILVGSPIANRNYREIEGLIGFFVNTLVYRANLSGRPTFQDV
FT                   LSQVRQKALKAYEYQDIPFEKIVEVVQPERSTSHSPIFQTMFILQNLKQEFPVLSGRSI
FT                   EMIESHSPIAKFDLSVMVAETEEGVRFTFEYNKDLFNATTIERMAGHFEKWLHEVSHHP
FT                   KNPLHSLSMLSEPERTLLLETWNDTVMEMPPQGLICDRFEEQVAKRPEAIAVVDQTKDW
FT                   TYGELDAQANQLANVLQRKGVAPESVVGVYLPRSAELMVSLLGILKAGGAYVVLDPLYP
FT                   KSRLEYMIEDAGIQFVVTAEGQEGLFEQVEMVRLEELTVESVIAPTRQINPENLAYIVY
FT                   TSGSTGKPKGVMIEYRSLMNMVSWHHEVYRITAEDRATQIAGIAFDSAVQEIWPYLTAG
FT                   AALYLSTEELRINPEALRDWLIDSRITASFAPTPILERLLKLSWPDKTDLRFIITGGDQ
FT                   LTQYPSNDIPFAVINQYGPSENTVVTTDCYVPVGVTTGTPSIGRPIANTEVYVLDSHLQ
FT                   LVPSGVIGDLYIGGKSLARGYANRPDLTKEKFISHPFKSGERLYYTGDKASYLSDGALQ
FT                   FHGRIDDQVKIRGFRIELGEIEAVLQAHSSVKEAVVLVREDDPGDKRLVAYVVGEGSVQ
FT                   EWREHLQTHLPNYMVPTNFIEMEFLPLTPNGKLDLKALPIPSKLSTENTVHARTPLEEL
FT                   IASVWSQVLGIENIGVQDSFFELGGHSLLATQVVSRLQEVFQIKLPVRELFEYSTVEAL
FT                   AKRLDQLRKGGKKREIPPLMPMERGNAIPLSYAQQRLWFIDQFTPNSALYNMPMVCRLT
FT                   GNWLLEALEVGWNQLIERHESLRTVFHEVDGHPVQKIQPYTFRSLPQIDLTKISPEERE
FT                   REVEQWIQTEVESPFDLEQGPLFRGQIVKISEEEWVLLCNMHHIISDGWSMEILLQEWM
FT                   AFYEEAIGEKPADLAPLPVQYADFAQWQREWLIDEVLNQPLAYWKEELSGELPVLMLPM
FT                   DRPRPPVQTHHGLTHNVLLSRSLLDKLNELSRQEGATLFMTLLASYQSFLARYTGQSDI
FT                   LVGSPIANRNYREIEGLIGFFVNTLVYRADLSGAPAFQELLSQVRIKALKAYEYQDVPF
FT                   EKIVEVIQPERSTSYSPIFQTMFTLQNTGQELPKLHGRSIEVMDSHASIAKFDLSLTAA
FT                   EVEEGLLLTFVYRTDLFDSLTIESIAENFGNWLNLIVEQPDKSLAKLPILSGLQQKQLE
FT                   EWNNNAVAYPQEFGIHQLYEEQVNRTPDAVAVVDEKQQLTYRELNEKANQLAHYLQKCG
FT                   IGSESLVGLCFQRSAEMIVGLMGILKAGAAYVPLDPSYPESRLRYILEDTGIQVLVTNE
FT                   ALEGWITEEIKTVCLDRDKAMISRESTLSPICEVTGENLAYVIYTSGSTGNPKGVMVEH
FT                   HNVIRLFKSTECWYQFDEKDTWTLFHSYAFDFSVWEIWGALLHGGRLIVVPYWISRSPK
FT                   DFYQLLVKEKVTVLNQTPSAFRQLIQVCEQEDEKKDLHLRYVIFGGEALDPTSLVPWFQ
FT                   RYGGQEPQLINMYGITETTVHVTYYPITQDDVQHASRSNIGKQIPDLEVYVLDACQQPV
FT                   PIGVAGELFIGGAGLARGYLNRSELTAERFIPHPFSSDPGARLYRTGDLARYLPDGNLD
FT                   YLGRIDHQVKIRGFRIELGEIESALNAHVSIKEAVVIVREDQPGDKRLVAYVVGDGNVG
FT                   EWRDYLKAELPSHMVPSGFVMMEAIPLTANGKVDRKALPVPEERKIESECVATRNGNEE
FT                   TLATIWKQVLGIKKVGIHDNFFEIGGDSILSIQIVSRAKQAGLQLTPKQMFEHQTIAEL
FT                   AQVVNEERGVQAEQGVITGELILTPIQQWFFAQDHPNPHHWNQSMFFRTKERLDIVLLE
FT                   KAVRTLLIHHDALRLRYERLPNGAWKQWNEGIEEQSTLTVISLDEVPQAEWHQVIQAEI
FT                   DTAQASLHLHAGPLMRMVYFDEGEKRAGRLFWVIHHLAVDGVSWRILLEDLQTAYNQAS
FT                   QDQMIQLPTKSTSFKAWSEKLHHYAEAGIVQEVRDYWEQQSEQEVAMLPVDTTLEVPAN
FT                   TGTEEITVVLDEKETRTLLKEISSTHRVQINEVLLTALVQATAVWTGHPALTVDLEGHG
FT                   REEIIEDVDLSRTVGWFTSIYPVHLNITGADTPIAALKAVKEQVRKIPNKGVDHGILRY
FT                   LNTTICEQWGSQHTPSISFNYLGQFDQMFSDDAILIPENGFKRLDHASGSKRSHLIDVI
FT                   GMVTDGKLQFTWVYNVGQYAKSTIQSIAENMLHQLSKLIQSAGGESALTVSDFVMANLD
FT                   QASLTKVLTKMNRGNNYPITDLYPLSPLQEGMIFHTLHDQGEEHVAPYIVQLSFMIRGE
FT                   LDIATFEQAWKSVIQRHEIFRSAFLWDEVEEPLQVVYESVPFKVNVEDWRTLTAEEKEE
FT                   KRKAFLALDRKQAFLFDKAPLMRVTVIQEGEEEYRIVWTHHHILLDGWSLPLVFNELLT
FT                   VYQKRMNGEAVHLPNSSPYKKYIQWLREQNQEQAEQFWREKLKGFTAPTLLGLESKEQE
FT                   KGYTEKVTYLSEEQTQALQNWAKRNRLTLNTVIQGAWAYLMSRYSGEDEIVYGVTSSGR
FT                   PTEIIDVENIVGPFITTSPTRIQLIDNIKVMDWLLKIQEEEIERRQYEYASLTEIQGWS
FT                   EIPRGTPLFHSLYVFENYPVKEGSSGNLEIGELEGVEQTHYPLGLTVVPESQLLLKLKY
FT                   DRSKFNGLTIERMLGHLSQVLKQMIENVDQTLSELVYVTEIEQKQLLEEWNDNAAAYPR
FT                   ESVIHKLFEDQVDRTPDAVAVVDENQRLTYRELNEKANQLAHYLQKMGIGTESLVGLCF
FT                   QRSVEMIVGLMGILKAGSAYVPLDPSYPESHLRYILEDTGIQILVTNEVSQGWMPEEVE
FT                   TVCLDRDQAMISQENTLSPICKVTGENLAYVIYTSGSTGNPKGVMVQHHSVLNLSYGLQ
FT                   KEVFSHRAHDNMRVGLNASIAFDSSVKQLQMLLYGSSLYIISTEVRSDPQQFISYIREN
FT                   KLEMFDITPSLLQLLIDEGLLETNDSVHVPSKVLVGGEAIMPSLWEQLVENDHIHFYNV
FT                   YGPTECTVDATCYRIKKDSKRVTIGRPLPNVQAYVLDEKLLPVPVGVTGELYIGGAGLA
FT                   RGYLNRPELTLERFIPHPFNEGERLYRTGDLVRYLADGHLDYLGRIDNQVKIRGFRIEL
FT                   GEIEANLESHPSVKEAVVLIREDQPGDQRLVAYVVGEGSMHEWREHLKRQVPNHMIPAH
FT                   FIEVDAIPLTTNGKVDRKALNSLTIQRENTFSTPIIPRDEIEYQLITIWQDLLQLEDIH
FT                   VNDDFFNIGGHSLLVIKLISKVREKFGKEIKVPALIKNPTVEGIACLIRENHRMEESLS
FT                   VLVPLQESEKRPFFCVHPFMGNVLCYIQLARLLKDHCSFYGLQNPLVEKEGMNGLILSE
FT                   VVQLYIEEMKRAQPEGPYRLGGWSLGGAIAYEIATMLRNQGEEVEVLVLLDTKVPSERD
FT                   YKTEDDMLSYILEHFIHIELVDQEEELVHQQDMLVEQLIVEGVLPPDANLTNLKQLINA
FT                   HRKCLNLMAEHDLTPYFGEVIYFSAEEGKELFTDWKPLLKGRVNMYSVPGSHEEIVASP
FT                   AVEKLAKYLLNELEGIKETSLSLTEK"
FT   gene            complement(235095..241565)
FT                   /locus_tag="BcerKBAB4_5618"
FT   CDS_pept        complement(235095..241565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5618"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; condensation domain
FT                   protein; phosphopantetheine-binding; KEGG: bce:BC2453
FT                   peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5618"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46586"
FT                   /db_xref="GOA:A9VUL5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL5"
FT                   /protein_id="ABY46586.1"
FT                   /translation="MGDVIDIYGLSPLQKGILFHTLYDQDDEHSFSYIVQVGFLLGGQL
FT                   DVATFEKAWEYVIHRHEVLRSVFVWEEVEKPLQAVYQRLPFTIHQEDWSAHSHEEREKK
FT                   LHQFLTADRRKGFLLDEAPVMRVTAIKEAEEETRIIWTHHHILLDGWSVSLVFSEVMEV
FT                   YLKMIKGELLNFPKPLPYKKYIQWINKQDQSQAEEFWTEELKGFYAPTPLAMERKDQEQ
FT                   EKGYGECVYQVSEELTENLQEWIRNSRLTLNTLVQGAWAYLMSRYSGESDIVFGVTSSG
FT                   RPTDLIGAENMVGLFINTLPTRIRLTNDTLVVDWLRKIQMKEMERRQYEYNSLVDIQGW
FT                   SEVPRNSSLFHTLYVFENYPIQGERNDDLRLLDVKSAEQTNYPLTLIVMPGKEITLKLM
FT                   YDRSYFNEETINRIQGHLLQTLIQMTKSLDSKLSEITHLTMEEQTQLLEEWNNTQVKYS
FT                   AEGMIHTAFEEQVKKTPGAIAAIYENEQITYRELDERANQLAHYLQKRSVGPESLVGVY
FT                   MERSLQMMIALLGILKSGGAYVPLDPTYPESRLRYILEDAGIEVLVTEENSENLYISED
FT                   VETICMNKDYTAIKKEESIPCISGVTGRSLAYVMYTSGSTGNPKGVMIEHHSVINYLEW
FT                   MQHKYPLSEKDVVLQKTPFSFDVSVWELFWGIHVGASISFLPPGGEKDPTIIAEVIEKH
FT                   QVTIVQFVPSMLSVFLDHLNHIELNMNCSSMRHVFSGGEELSSGLVRRFQQQWNHSGQV
FT                   KLTNFYGPTEATIYVNAFDIQPNQEFVSIGQPIQNTQLYVLDQNQRLQSIGIEGELYIG
FT                   GAGLARGYLNRPNLTAEKFVSHPFRLGEQLYRTGDSVRYLTDGNLEFIGRMDHQVKMRG
FT                   FRIELGEIEATLEKYSFIKEAVVLVREDRPGDQRLVAYVISDGNTQKWREYLQNQLPNH
FT                   MIPAHLVELEQFPLTPNGKIDRKALPAPDEQPMGDFNVLPRTPTEELIASVWSQVLGIE
FT                   NIGIQDSFFEQGGHSLLATQIVSRLQELFQIKIPLRELFKHDTVESLAERVDQLRKEDK
FT                   KREVPPLVPMTREESIPLSYAQKRLWFIDQLMPNNAMYNIHAACRLTGKWSIEALEAGW
FT                   NQLLERHESLRTIILEQEGEPFQQVQSHVFRHIPQTDLTDLSLEDRKREMKRLIQNEAE
FT                   ETFHFGQGPLIRTRILKVDREEWVLLCTMHHIISDGWSMGILLEEWMAFYEGALSEKPP
FT                   ELKELSIQYADFVMWQKEWQKEENLDQHLQYWKEELSGELPVLQLPMDRPRPAVQTHRG
FT                   ASQSLMVANSLQEKLKGLSLQEGSTLFMTLMAAYQSFLSRYSGQDDILVGSPIANRNVK
FT                   EVEGLIGFFANTLVYRADFSGNPTFQELLSQIRKKALKAYEYQDIPFEEVVESVKPERN
FT                   TSHSPIFQTMFTLQNTKQEFPQLSERHMELMESHTSVAKFDLSLFASETEEGLSLTFEY
FT                   NTDLFNDTTIERMASHFEHWLYQIVSHPKDLLSELNMLSKVEYKQLLEEWNETGVVDIR
FT                   ESTIHTLFEEQVEKTPEAIAVVCEDEELTYRELDERSNQLAHYLQKHGVGCESMVGICV
FT                   TRSSEMIVGLLGIMKAGGAYVPIDPAYPESRLQYILEDAHIKVLVTLEKLQQKMVIPKS
FT                   VAVICIDRDREEIEQEVTTVCTSEVTGDNLAYIIYTSGSTGNPKGVMIEHRNTVTMIHW
FT                   AHHTYSQKELAGVLASTSLSFDLSVFEVFVPLTMGGKVIVAENALHLDKLSTKGVTLVN
FT                   TVPSAAKELVRAKTIPSSVKVMNLAGEPLPYSLVQDLYERSTIEKVYNLYGPSEDTTYS
FT                   TYMELEKGVMHRVPPIGKPVFNTEVYVLSAEQKMVPIGVVGELYIGGSGLARGYLNRPD
FT                   LTQDRFIPHPFKEGERVYRTGDLVRYLPDGNLEYLGRIDHQVKIRGFRIELGEIEATLQ
FT                   KHALVNEVLVMVREDYPGDPRLIAYVLGDGDAHKWRDYLKDQLPNYMIPAYFVGLNAFP
FT                   LTSNGKIDRKALPAPERQEIASGYIAPRTPTEKTIVSIWHQVLGVENIGVQDSFFEIGG
FT                   HSLLATQAVSNLKEAFGIELPLHDLFTFHTVQQLAKQIDQLFYNKNQEIQNDSKENVSL
FT                   QDYIQKEAEVSNDEELLELLKQLEELSEEEAQGIFESNLVEEGVKK"
FT   gene            complement(241568..246124)
FT                   /locus_tag="BcerKBAB4_5619"
FT   CDS_pept        complement(241568..246124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5619"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: non-ribosomal peptide synthase; amino acid
FT                   adenylation domain; PFAM: AMP-dependent synthetase and
FT                   ligase; condensation domain protein;
FT                   phosphopantetheine-binding; KEGG: bce:BC2452 peptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5619"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46587"
FT                   /db_xref="GOA:A9VUL6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL6"
FT                   /protein_id="ABY46587.1"
FT                   /translation="MANEECYPLSHPQRRIWYTEVIHSGKGICNLRFLFKLHRKMDYSK
FT                   LNRVVNRVISENDGLCIRLKENGHQEPEQYFIKHEEQEFEFFDFSSVEDSDLLEKWIEQ
FT                   KTKETFTLFNSDLYYFALIKLNDNECAVFGNVHHIIMDGLSIQIFTSQIAKYYYEMHNE
FT                   TEEGEIRNSYVQFLANEQTYLNSIRFQKDQKFWLEEFKTIPSVTGLKPYNTYQVSTKAS
FT                   RETFILSEHLKRKIELFSDDYKLSVYSLFVAAFSLSMCRWTSSLDIALGMAYGNRMTKT
FT                   ERELIGMMVSTVPLRMDIDPEEEVLSFIGRVSRKQSKSLRHQKYPFDLLLKQINKENNS
FT                   NVRLFGTTIDYRDRDESGDSLWIPNGEEMQDFAVHIENLTDIDSLQVHIDYRKELFSKE
FT                   EINRFFKTMLAVIENTFKNPKQKVSEIEIISEEDKRKSLVEFNNPKLDFPPQVTIHELF
FT                   EQQAMIYPNSIAVTYEKGKVTYRELNEHANQLAHYLQKKGVGPDTLVGLCVERSLEMIV
FT                   GILGILKAGGAYVPLDPTYPEQRLQYILEDAGIQLFVTQESLKELKWLPENIKSICLDR
FT                   DRDEIGQESKTLPFSDVSSQNLAYVIYTSGSTGNPKGVMIEHHNVIRLFKSTDCWYQFN
FT                   EKDTWTLFHSYAFDFSVWEIWGALLYGGKLVVVPYLISRSPKDFYQLLVEEEVSVLNQT
FT                   PSAFRQLIQVCEQEDENKNLNLRYVIFGGEALEPISLLPWFQRYGEKEPQLINMYGITE
FT                   TTVHVTYYPITQDDVRHASRSNIGKRIPDLEVYILDAYQQPVPIGVEGELYIGGAGLAR
FT                   GYLNRPELTAERFIPHPFSSDPKARLYRTGDLARYLPDGNLDYRGRIDHQVKIRGFRIE
FT                   IGEIESTINAYASIKEAVVIVREDQPGDKRLVAYVVGDGNVGAWREYLKTKLPSYMVPS
FT                   RFVTMEAIPLTANGKVDREVLPMPEEEQTNSEAVAPRNSNEKILATIWKQVLGVKKVGI
FT                   HDNFFEIGGDSILSIQIIFQASQEGLKLTPKQMFECPTIAELAQVAIETQGVQAEQGIV
FT                   TGEVPLTPIQYWFFEQEHSRPEHWNQSMLLRVKERLDVKLLEGAILNLLKHHDALRFRY
FT                   EQLPNGTWRQRNEGTDEHSVLHVVKRNKANEQAWNKVIQEEMNITQTSFNLVTGPLMRV
FT                   VYFEDTLSGNDRIFWVIHHLVVDGVSWRILLEDLQAVYNQMKQGQGVRLPAKSTSFKEW
FT                   SERLQAYSDSGISKEVQDYWNERVEKETMKIPMDYPMQETTEESIDQVTRTLGVEETHA
FT                   LLQEVPVTHKTRINEVLLAALGQAIVDFTNEQTVSIHLEGHGREEMVEGIDLSRTVGWF
FT                   TSIYPVHLNFQGTKTPIEGLKAVKDQLRQIPNRGVDYGILRYLKKELLPFYQQKPSISF
FT                   NYLGQFDQVFSKESLFMQETGFTFLDHAPDSKPSHLIDVIGMVKDKKLHFVWMYSREQF
FT                   SRLKIQAIADGMLRHLRQLINKPTTESAFTVSDFADAEDLTEESLSKVLLKLTKKRV"
FT   gene            complement(246139..247401)
FT                   /locus_tag="BcerKBAB4_5620"
FT   CDS_pept        complement(246139..247401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5620"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bce:BC2450 macrolide-efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5620"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46588"
FT                   /db_xref="GOA:A9VUL7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL7"
FT                   /protein_id="ABY46588.1"
FT                   /translation="MKTTESKSLWGNTIYLQVFSAYSLLMLGVFIDMLAIMTIVSFEWE
FT                   VDPTMIGLIPVAYALPGIIFSSWAGVIADRFRKIPIMMFCNLMVGLLTIVLLFVQTIHW
FT                   LLLALMIRSIFTVFYYPAQQTLTRQIVSPDLLTKAVSINGIVEQGTKILGPLIGGMLLS
FT                   WFQPEFCLIIRAICCLLAALVLLPTIRLQESLSREHIEKKQQSTWTAWLQGWGYVLSNR
FT                   MILSTMIFFTIAMAVLQLVDSQFPTLFKSLFPNDKSKMGYIISIIGLGGIIGAFLTQKL
FT                   KHFQYGWVICGGIALMGIGFGGISLITLINPGASLIFAYLISFIAGIGSGLMLVSNQVI
FT                   LQIESHQEQVGRVFGIQSSLANAVLIISPAMSGPLVHFFGVIELYFYVGIGLIIIGVIG
FT                   VSLQKYIWVKHKQEPIRVNNF"
FT   gene            247805..248512
FT                   /locus_tag="BcerKBAB4_5621"
FT   CDS_pept        247805..248512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5621"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bca:BCE_3336
FT                   IS240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5621"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46589"
FT                   /db_xref="GOA:A9VUL8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL8"
FT                   /protein_id="ABY46589.1"
FT                   /translation="MEKENLYKWKHYQPDIILLTVRWYLRYNLSFRDLVEMMEERGLSI
FT                   SHTTIMRWVHQYGPELDKRIRRHLKQTNDSWRVDETYIKVKGQWMYLYRAVDSKGNTID
FT                   FYLSKTRDQKAAKHFFKKALQSFHVSKPRVITVDKNPAYPIAIEQLKKEKSIPGGMLLR
FT                   QQKYLNNIVEQDHRFIKKRIRSMLGFKCFDTATSILSGVEVMHMIKKEQVDLRDQSVQN
FT                   QKEFIHQLFGLAA"
FT   gene            complement(248760..250742)
FT                   /locus_tag="BcerKBAB4_5622"
FT   CDS_pept        complement(248760..250742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5622"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Carbohydrate-binding family V/XII; Fibronectin
FT                   type III domain protein; KEGG: cbh:CLC_2047 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5622"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46590"
FT                   /db_xref="GOA:A9VUL9"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR021862"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL9"
FT                   /protein_id="ABY46590.1"
FT                   /translation="MIIQKTRRSFNKVIIITAACSMFSMFGTSISHTKAETHSAAPAVY
FT                   VSPQNIPASDIISIDWSPVQTAPYTYWAVHNWNAGGEAGGYAGFQQQSGFDENGKRTLH
FT                   FAIWDPISSKEAIKAEYLSPNSQAGLFGGEGTGLKVQTTYGWKDYNWYRMTMRSWQEDG
FT                   HTKFGQWMKDVTKNKWHLIAIMDFPVANVAFNHGLGMFQEDWADSGQNVREARLKNGYS
FT                   RKLVDKQWSSWNNQNISGTHDNTYQYDGGATSEYVWVKAGGNTQSTIGSGKIFTLNQPT
FT                   QPEIGKLDFDIQSIYYENEKLNVSWKLKENSTPQFKGKIEIYNNENMTGQPINVIDDIK
FT                   SYQNGISQSISLPTNAYAKIVLTDLFDQTVEKKVQIKNQSPNIFEGNEFAWSLKGIGDF
FT                   EFAKVNLNRSIEEIQIALKAGVPHNYFDSTYASIKVQNTSGKVVYNKEIYGNKQQNAEQ
FT                   VKVPVKVGDFIEFTHLEGANRATITNMEKNIQESFGNKAVYEITKEGLKKVDNIVNPKP
FT                   DTEAPTQPQGLYASNVTSNSIELKWNPSTDNVGVKEYQVLRDGQLIQTVQGTTFTDQNL
FT                   TVNKEYKYAVKAVDAAGNTSIQSDILPVKTKNQNESYEKWDPKKAYTKGDKVEHQGKIY
FT                   EAVQNHQGNGDPNWIFALALWNPLT"
FT   gene            complement(250883..253132)
FT                   /locus_tag="BcerKBAB4_5623"
FT   CDS_pept        complement(250883..253132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5623"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Carbohydrate-binding family V/XII; Fibronectin
FT                   type III domain protein; KEGG: bcy:Bcer98_3446 S-layer
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5623"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46591"
FT                   /db_xref="GOA:A9VUM0"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR031161"
FT                   /db_xref="InterPro:IPR035423"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="InterPro:IPR042279"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM0"
FT                   /protein_id="ABY46591.1"
FT                   /translation="MKRVQKQKTKNLVMITATLSMFATGVTPSLEVFAEEQAQQKKVST
FT                   TLLQNENSVNVENRVFVVPGKGDVSQLQNIERRERNFSAYEPTGLYAKPNEQIIIQVQG
FT                   NQSIQAYIGTFSFDASWREDSKIKSFTLNPGTNTIQSPNGGMIYFYNKQQGGTIQTTVT
FT                   TGGAATPLFELGKHTKQDLINMLNQYPNAHAVELKGERVLITASPARVKKYLIGSNTDP
FT                   VQLLKKMDEATRIQDKISGLSEEQVDKHYLHYVEDNHSLDYYMYAYPHRTAYVGDAIQH
FT                   VLDINKFTNDGWGPWHEAGHMRQQAPWNFKNMTEVQVNLYSLAVEKAFTSNQPFRLQQE
FT                   GAYTKAFQYLEQSNKNYDEISDAFVKLVMLWQLQLAYGEDFYPKLHQLYRDMPLNEIPQ
FT                   TDETKKQLFMISSSKVAKQNLIPFFEKWGLRPNNDTIQKVAALGYPNLTAEIWKSTDSN
FT                   PVKPDTPNFSNILEGNQFAWSLKGIGDFEFAKVNLNKSTEEMQIALKAGVPHNYFDSTY
FT                   ASIKVQNTSGKVVYNKEIYGNKQQNAEQVKVPVKVGDFIEFTHLEGANRATITNMEKNI
FT                   QETFGNKAVYEITKEGLKKVDKIVNPKPDTEAPTQPQGLYASNVTSNSVELKWNPSTDN
FT                   VGVKEYQVLRDGQLIQTVKGTTFTDQNLTVNKEYKYTVKAVDAAGNTSIQSNILPVKTK
FT                   DQNVSYEKWDPKKAYTKGDKVEHQGRVYEAVQNHQGNGDQNWIFALSLWKPITIK"
FT   gene            253576..254115
FT                   /locus_tag="BcerKBAB4_5624"
FT   CDS_pept        253576..254115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5624"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; KEGG: pth:PTH_2445
FT                   site-specific recombinases"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5624"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46592"
FT                   /db_xref="GOA:A9VUM1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM1"
FT                   /protein_id="ABY46592.1"
FT                   /translation="MANIYGYIRVSTKDQNEQRQLHKMMERGVEGRRIFVDKASRRHFD
FT                   RPQYQLLRKILSTGDIVVLENETLFDSRKFREMGDMGRLMEDQFLSLLSYVADQERKKI
FT                   HQRQAEGIAIAKSQGKHLGRPPVNLSTLSKQQIKIIEKTHSKWKSGEITAVMFMEMLEL
FT                   RKNTFYKIMKEYEEGK"
FT   gene            complement(254700..254888)
FT                   /locus_tag="BcerKBAB4_5625"
FT   CDS_pept        complement(254700..254888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5625"
FT                   /product="RNA chaperone Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein core; KEGG: bcz:pE33L466_0115 host
FT                   factor-I protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5625"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46593"
FT                   /db_xref="GOA:A9VUM2"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM2"
FT                   /protein_id="ABY46593.1"
FT                   /translation="MYNLQEDMYEQLKEKKGDITIFLKNGVPIRGQILTTDKFTVLMMV
FT                   HGKQQLVYKQAISTILK"
FT   gene            255202..255945
FT                   /locus_tag="BcerKBAB4_5626"
FT   CDS_pept        255202..255945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5626"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="KEGG: oih:OB3394 methionine aminopeptidase; TIGRFAM:
FT                   methionine aminopeptidase, type I; PFAM: peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5626"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46594"
FT                   /db_xref="GOA:A9VUM3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM3"
FT                   /protein_id="ABY46594.1"
FT                   /translation="MVVKNKEDFNGLKVIGEICGAIRDELVHSTKPGITTKELDEIARE
FT                   MFEKAGAQSAPKGEYNFPGYTCISINKEVAHGIPKRTRTIQEGDLVNIDVSGSKNGYFA
FT                   DTGISFVVGEGEPTLQKICDVAKEAFYAGLKKAKPGSKKSALGKAAHNVAKQHGLTVIK
FT                   NLTGHGVGRSIHEEPKHIFNYFAPWDDEILKDGMVIAFEPMISTFEEEVFQSEDGWTCL
FT                   TDESFVAQYEHTVILTKEGPIITTL"
FT   gene            complement(256480..257343)
FT                   /locus_tag="BcerKBAB4_5627"
FT   CDS_pept        complement(256480..257343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5627"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46595"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM4"
FT                   /protein_id="ABY46595.1"
FT                   /translation="MNHLAFSPRELGGKSSPFLLTIEEWRSFAHYLNRWISAPTSIDQV
FT                   RERMYLILDGKVKNNWDRLITTSIFRELVEEAIATKLNVREKCRFWDNGGHKDILILSQ
FT                   NIVAFADLISIKYYNDLNQVIFEAQNGKLTPNTKSKFINICKDLSNHAQTYYQQSQSMA
FT                   TSLSEFYSEIQKYEETVQTWSHRMSYLSLHDSNDFVVAQNTVVYLVAPVMNLVQSKEFV
FT                   FPVIRKVHRIWSAISYDLKELADNIDDIENLEEFIAALELELAFEDWKAIRDEAENFYK
FT                   NAINIS"
FT   gene            complement(257391..259715)
FT                   /locus_tag="BcerKBAB4_5628"
FT   CDS_pept        complement(257391..259715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5628"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ckl:CKL_2802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5628"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46596"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM5"
FT                   /protein_id="ABY46596.1"
FT                   /translation="MLAHKVDYKKLYEELLNNQHIPGTFYSSTTKTKYEIRSLFVDLGE
FT                   VYKFIEENQLAPNMISIFADVVRIPDKFNCTLKDMQLVIRTRRVEIESDGKAEIRLDYK
FT                   DGSKLAQLTIYGLELSGTLHAIPIYNQSSPSPYPIELRNKGVRLSDKDGTFTKEEITYV
FT                   VPTPQFPKLFMSVFQVACLFYESQPDIAADQLNWLKAFTAQYKDLSSLCIQSTALLTIL
FT                   TANHGENTFVPLLDKDLYRDEIAAFLAAAQQFEEQYHRYLDRNLAIADRKAAATLMLQH
FT                   EQDTLLFKETLINQAKDNLRSAQNAVESSLYQFEKQQHVVTIAKIDFEYGLKKYHYEQQ
FT                   MKMAFKMLTAVLNFAESIGSIIATGGTAAPGEIIDIINSLKEVIEAGGQLAALAQSLKE
FT                   CMEKLNELVELINKIYALAAEISKASTDMDFSEELLKKIQENEWELPKEDLTGEATWKI
FT                   FQLKIAAALEDAIKKEVEGAREYLLSLDILAVYGQTLASNQVIIIRCSQELFRLLLEKH
FT                   IHQADLARLKEYIKNLEGQESENEEMEQKLYQRYLDMKQILFVALANYKHAYKYWALRD
FT                   SDVNPNILKDVSELKVDVATLQKDCMEALKQFNPPPQPFQNRTIEITDSNALKTLKETR
FT                   EASWEINLNDSFFENEYRVRLKLMRIWLDGVDATSKVQIRITNSGHYYDDYKNKKFQFN
FT                   TEPFNRGFSYVGATIITDGTIAEEFAYDYFIPNPFTTWTIKVQDGPDLSKVTKIRMELA
FT                   GSLVANYKKHNPVLNGLMESF"
FT   gene            complement(259943..261004)
FT                   /locus_tag="BcerKBAB4_5629"
FT   CDS_pept        complement(259943..261004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5629"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_2803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5629"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46597"
FT                   /db_xref="GOA:A9VUM6"
FT                   /db_xref="InterPro:IPR008414"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM6"
FT                   /protein_id="ABY46597.1"
FT                   /translation="MVKRDISARDLGGKEDNPFLLKKDEWIRIQKYTGDGAYLPVNVNE
FT                   MRKALALENTAELPDFGELYTVNTSIKGHCKNWNDTTYREILDVANQIVNYSRRAEVFY
FT                   APLLDYLPDILEGDTVALEKFQKICEKLAKEAKAFSDHAETLAKTVKQFADDTTNDYKN
FT                   LINVKVKYDALYGKNSEEEIKLRAEVKKLREELEKYIEDYEDYESESWLSLLLGPVFGF
FT                   ILKGILDSTHGQMLKAKVDATRQKIEATCATIQRNVYLMSLLDKADVGTDKTQKQIEEA
FT                   LPVINKIKAIWSALHKDLLTLSTITMKDIHDDPEFADLGIELAIMQWVKVGKQADDFRI
FT                   NADVGYILDQYIA"
FT   gene            complement(261431..261526)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5630"
FT   gene            complement(262208..263032)
FT                   /locus_tag="BcerKBAB4_5631"
FT   CDS_pept        complement(262208..263032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5631"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46598"
FT                   /db_xref="GOA:A9VUM7"
FT                   /db_xref="InterPro:IPR036716"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM7"
FT                   /protein_id="ABY46598.1"
FT                   /translation="MNDTMCPETSTCSSCSPEPYSWEWVAVEATGGVISGVAGFAAVAL
FT                   IKHLFIKEEADQTRDLFKEAVEQICNYINKAIDEAFIREYLADTDNVKEQLKYFAGSNG
FT                   NNIKLIEDIQSEASRLVQRFYRLGDIAIGALELACSLHLVILKTLATHNPDNWKVPFET
FT                   STKEYAEMLSHNANEFLNNVKSRITPPEFGMLPDGGIPPTKLTLGCQFNVDDEPLSFGY
FT                   GTVTISDDQAIERAREQCNQRHKEKYDEIVNPGILVYNKIMAVSTDLKNIQF"
FT   gene            complement(263503..264936)
FT                   /locus_tag="BcerKBAB4_5632"
FT   CDS_pept        complement(263503..264936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5632"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   baa:BXA0056 IS231-related, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5632"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46599"
FT                   /db_xref="GOA:A9VUM8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM8"
FT                   /protein_id="ABY46599.1"
FT                   /translation="MTLSIQDEFHLFAEELQRYLSPNILQQLAQETGFVKRKSKYGARD
FT                   LDALCIWISQHVASDSLTRLCSQLYANTATLMSPEGLNQRFNRCAVLFLQRIFSLLVKS
FT                   QLNDSSQIKNQYTSYFQRIRILDATIFQVPNHLAPIYPGSGGCAQTAGIKIQLEYDLHS
FT                   GKFLNFQMEPGKNNDKTFVTDCLDTLSPGDLCIRDLGYFSLKDLDQMDQRGVFYVSRLK
FT                   LNNRVYVKNDSPEFFRDGTVKKQSLYVLLNLEDIMHQIKPGDTYEIRNAYIGQQKLPSR
FT                   VVIYRLTSTQTHKRRKQQTYVEKKKGVTYSEKSKRLTEINVYITNIPWEIVPMEQVHNI
FT                   YSLRWQIEIVFKTWKSLFGINHCHNIKRERLECHLYGQLIAIFLCSSTMFKMRQLLLQK
FT                   KQKELSEYKAIYIIQDHLYLVYEAIQKDTQEVSKIFLCLFDFLQKNGRKSHRYEKKTVF
FT                   DILGVVYQFTVSNLKQKTA"
FT   gene            complement(265011..265394)
FT                   /locus_tag="BcerKBAB4_5633"
FT   CDS_pept        complement(265011..265394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5633"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46600"
FT                   /db_xref="GOA:A9VUM9"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM9"
FT                   /protein_id="ABY46600.1"
FT                   /translation="MIQMKKKATLFFFLNIVIIGMLIFNLFVFTTRMPFLPWFIEDGWG
FT                   YLGLVLTSFVLLIISLKSYQLYKNGEITILQISIPLVSAMFSLFVMFMPLNDFMTIFSL
FT                   IVDVSILIISLISFRGTVTSLSN"
FT   gene            complement(265485..265943)
FT                   /locus_tag="BcerKBAB4_5634"
FT   CDS_pept        complement(265485..265943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5634"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: dsy:DSY0300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5634"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46601"
FT                   /db_xref="GOA:A9VUN0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN0"
FT                   /protein_id="ABY46601.1"
FT                   /translation="MDKQEFIQLVNKKLKLIRIENDLSQDKMSEVIGLSKKTLVEIEKG
FT                   RRSLTWTGAVCVVTLFEDSDIIQMTFGDDINEIIKTIAFTHYNNSSSKTLGGKLWWRQI
FT                   RELNGYKIQQNILSQHYRILNKENHRICSSFELDEIEKRFIEVTKSLQ"
FT   gene            complement(266142..266510)
FT                   /locus_tag="BcerKBAB4_5635"
FT   CDS_pept        complement(266142..266510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5635"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46602"
FT                   /db_xref="GOA:A9VUN1"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN1"
FT                   /protein_id="ABY46602.1"
FT                   /translation="MIQMKKKSNHYLFINNVIIGMLILNLFIFTSSIRFLPWFIEDGWG
FT                   TLGLLLTSFVLLITFFKSYQLHKNGERTILQTSIPLVSAMFSFFVMLTLSDFMTIFSLI
FT                   VNVSILIICLISFGKNSN"
FT   gene            266931..267311
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5636"
FT   gene            complement(267692..270076)
FT                   /locus_tag="BcerKBAB4_5637"
FT   CDS_pept        complement(267692..270076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5637"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: bcy:Bcer98_1722
FT                   penicillin-binding protein, 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5637"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46603"
FT                   /db_xref="GOA:A9VUN2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN2"
FT                   /protein_id="ABY46603.1"
FT                   /translation="MSENYLSRTERKQVHKNEKPNTKKNKKQTSFFRKLLIGCLVLGTL
FT                   GLIGVATTFFTLIKDAPILEKSKLVNPLSAKIYDKDGKLIYEYGKEKRTNITYNQLPKL
FT                   IENAFLATEDARFYDHSGVDFKGTARAVLVSLTGNYGSQGGSTITQQVIKNYFLSTEKT
FT                   AKRKVQEIYLAHKLEKRYSKHQILEMYLNKIYLGNRSYGIRTAAQNYYGKELKDLTLPQ
FT                   VAMLAGLPKGPSIYDPTKQQNIEKATERRNVVLSAMYQNKYISEEQMTEASRVSVKEGL
FT                   MPPKEVNEMPYPVFIDAVVKEVEKELPDAHIESDGLSIYTTLDPKAQKFAENILNTNII
FT                   SYPNDNFQGAFTFMDTKTGEVRAIGSGRGENKATFKGENMAIELKRSIGSTMKPIFDYG
FT                   PAIEYLKWPTSHQLDDSNYKYSTGQKVQNADRTYKGMMTMRDALKMSRNIPAIKTAKEV
FT                   GISKAQGFAEGLGIKFGKEVPESTAIGTNEGSPTEIAGAYAAFGNDGKYTKPHFVKKVV
FT                   YPDGESKSFEPKSKRVMEDYTAYIVTDMLRSVVTSGTGTAANVDSLDVAGKTGTTNYSA
FT                   ADVAKYGIPSSASRDSWFAGYTPQYTMAVWTGYMKNGPEDYISSKNTKIAQQIFKEMMH
FT                   KFGTNKSKFKMPKTVIQDNSELRVKGAKQESSPNVNTNTVIQMETGEKDQKQEQNEQDK
FT                   NQQEQKQGEQDKNQQEQKQSEQDKNQQEQKQSGQDKNQQEQKQSGQDKNQQEQKQGEQD
FT                   KNQQEQKQSEQDKNQQEQKQGEQDKNQQEQKQGEQDKNQQD"
FT   gene            complement(271598..272314)
FT                   /locus_tag="BcerKBAB4_5638"
FT   CDS_pept        complement(271598..272314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5638"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracyclin repressor
FT                   domain protein; KEGG: lla:L154512 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5638"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46604"
FT                   /db_xref="GOA:A9VUN3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN3"
FT                   /protein_id="ABY46604.1"
FT                   /translation="MKWRIPMKKQQPQISEDKILEASWELLGEEGIEKLSMRRLADRLG
FT                   IQAPSLYWYFKSKQNLYQRLANQVSKIILEEFHSEGDWKEQLSELAVTVRSVLSRYPCS
FT                   TQIMMMTLPHEPDIIRFTNRMLLCVESTPLEQEQKMQVVTTLVNYVYYFVLDDYQHQRN
FT                   VSAILKVNETLPGEEMIPGEEMIRLLDSMNETDAGLFRRMFTNGLFELMGTDRAFEFGL
FT                   NLILLGVEQVIKEQVE"
FT   gene            272427..273779
FT                   /locus_tag="BcerKBAB4_5639"
FT   CDS_pept        272427..273779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5639"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: ssp:SSP2140
FT                   putative Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5639"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46605"
FT                   /db_xref="GOA:A9VUN4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN4"
FT                   /protein_id="ABY46605.1"
FT                   /translation="MDAENLYYFEKASVSKAVAHFAVPMMLGTSMSVIYSILNAYFLGT
FT                   LHSTAMLTALALTLPLFAIIMALGNLIGMGSGTFISRLLGEKKYDDVKHVSSFAFYSSL
FT                   VLGLIAIAVGLPLIDQIVYGLGATSDSFEFTKDYVTIMIIGSPFVILFFTLENIVRSEG
FT                   AAITSMIGMILSVVVNIILDSLVIFVFHWGVTGVASATVISSVVASAFYAFHIRYKSQF
FT                   LTVSAKWFKVTKEILSNVFKIGVPVFIMSIFLGAMSLILNHFLIEYGDQAVAAYGISSR
FT                   LLQFPEFILMGLCEGIVPLIAFSFTANKMRMKHTIGFTIKTIVALAFVFGVIVYLISDN
FT                   LIGLFTNDPHLIEMGSYILHVTFLSLFITGMTALFTGIFQATAQGTAAFIMSIIQGITL
FT                   IPVLFIANHMYGFHGVIWSLVIADAVSFLVGAIMLYVLRNKLQPDLDSLVQ"
FT   gene            274389..274583
FT                   /locus_tag="BcerKBAB4_5640"
FT   CDS_pept        274389..274583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5640"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   lme:LEUM_1982 predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5640"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46606"
FT                   /db_xref="GOA:A9VUN5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN5"
FT                   /protein_id="ABY46606.1"
FT                   /translation="MKNIIRILRKEKKLSQEDLAKLCHVSRQTINAIENNKYDPTLELA
FT                   FNLAKSLGVTVDQLFIYKI"
FT   gene            274649..274987
FT                   /locus_tag="BcerKBAB4_5641"
FT   CDS_pept        274649..274987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5641"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46607"
FT                   /db_xref="GOA:A9VUN6"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN6"
FT                   /protein_id="ABY46607.1"
FT                   /translation="MGLLAFEWYEKQQISITSLFVATIILQSLFMKRILKGKKESENFI
FT                   DEMFLHIRQKSLSICCFVMYVLTLGTLFLSEGTWNFSHMHNKPLIFLVFLYPIVYQISH
FT                   IFVSRNNS"
FT   gene            275505..276251
FT                   /locus_tag="BcerKBAB4_5642"
FT   CDS_pept        275505..276251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5642"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46608"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN7"
FT                   /protein_id="ABY46608.1"
FT                   /translation="MHYYPPFLLVFWFSKPFIHCLSAYNPFLTLPFRMQKVTWLQDLGV
FT                   CQQIKARRHGKIAPSVYILTLHTNYLKIVEYFKIKWTVAIDICSTFISFLTNKHSKKNI
FT                   QTSSSVDLFSLEEQLKPNTDIQSKEDKNRLQDLNDYLSDDQKKAYYYILSQELTYLSEN
FT                   DAYIIALRLPPDIDRYTRWDIEECVQWFQFNTAEISNPAHFIKMFNQKSKQNQERRKRH
FT                   TKKTNSFLGANNNRKFIFFNFLEENS"
FT   gene            complement(276848..277036)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5643"
FT   gene            complement(277903..279594)
FT                   /locus_tag="BcerKBAB4_5644"
FT   CDS_pept        complement(277903..279594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5644"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5644"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46609"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN8"
FT                   /protein_id="ABY46609.1"
FT                   /translation="MAKPFVIKNKRSLNGETTTPVLVTIKAWQKLVEALEGKYYSFKDT
FT                   YLEDIVNSMSYEERIADEEGFVEKAKPSFSLQMKNLFTKANGRKHKLYGITNADLEVFL
FT                   FLHKKCNTYGELSHVSIHMLWEDYKNYKEVFAHIHHSQFYVALKKLSLHNIIEIENEYS
FT                   GKYKITLTDFMNKETNKANPYTFISPIVFTKEFFDLSIAAKKLFIDIAMQQKRETTLKR
FT                   SLYKFDEQGQQTHFGGIYRFLHKKYPHQIRSVMAELTTKSTATGSSLFKICKLEKGKKN
FT                   KKQYTTLHLSVHPDFLCNKEIGEEYRDPFTPRLTYKRKAKFIEESLVEMNIAEFTKDIN
FT                   QFVNVLKHSCHRQIRQVIRGLREMIDRQEGFPKNLVYTLSKLLKQSSQYRVLDTAAKTG
FT                   IYSLITHNVPREKQEDAVFKFGTHFAIYSLQNVKKLFCKAHDLLHATYAVPVTEEAYHR
FT                   NYMQYQEETLFRKYAFEQGVNVNAYIALEIKIRELLKSHGHKEHHIPSDIRELFIEKID
FT                   RLPKEKIRVIEVPKDFNLIDFLHSLEAYYRKNSETPCTVDQLLPAM"
FT   gene            281471..283168
FT                   /locus_tag="BcerKBAB4_5645"
FT   CDS_pept        281471..283168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5645"
FT                   /product="putative transcriptional regulator, RpiR family"
FT                   /note="KEGG: bcz:pE33L466_0224 possible transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5645"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46610"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN9"
FT                   /protein_id="ABY46610.1"
FT                   /translation="MEKVLVLFSDALLLAAPMYEKNTQLWGKWNRYYEEVQGNHDKVVT
FT                   SANISPSFSALVSWLGQKQEQGISLLHIYANLDKYKIEIRNVLDKIIEQEFGGTSEEVE
FT                   TAIISNTTDEKLKEHSIDLQEDYYPVSNDAVYYQLRDGIAKNHFEEDEVGAVSVLPLET
FT                   KNTSGVAQLSSHKDEDLRLVNTNEAERWSILVDGVISNMDDLTADCLDTITIQWLNQAK
FT                   SPDDFIDFSYENVLDMCNIPKASANGIEYYRAEDKIKIAQRIAALASIFIYLNDDNEVV
FT                   VLNDRAETGEQFEMKREIIKRLFVLDSVVLWRDKNTNDYVGIESCRIKPGSFLSMYLYG
FT                   SSSTTALLSKKALEYNSYRHKFHKRLIRYLSWQWRIRQQYSNLKRPYSIDGEKGLLSVM
FT                   GINIAKGRPHRIREQLENVLIDLEKEKVISHWEYAEEIDESRIGERNWFKNYYSKLGII
FT                   ILPPKELMDNIGSLAKKKVIDTPDKQENNVIINTIAHSTVSTEELIREKIMHQHMHQNR
FT                   TMREIADELGLSPATLSRFCNKKMKRISNSVNDKLTKWYERQMIIESM"
FT   gene            283310..283993
FT                   /locus_tag="BcerKBAB4_5646"
FT   CDS_pept        283310..283993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5646"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; fatty acid
FT                   responsive transcription factor FadR domain protein; KEGG:
FT                   ilo:IL1821 negative regulator for fad regulon"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5646"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46611"
FT                   /db_xref="GOA:A9VUP0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR014178"
FT                   /db_xref="InterPro:IPR028374"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP0"
FT                   /protein_id="ABY46611.1"
FT                   /translation="MKEKERSSDKIENELIRSILAGVYSVGSTLPPERELAKEFGVGRP
FT                   TIREALQRLERSGWITGRKGMPAIINDYWSNGNLTTLINIVENHHTITDEFIMYLLEFR
FT                   SSLTPTYIRDAVTFNQPKVVALLANLEQLEDSAESYAAFDWYLQKRCAGLAANPIFLLI
FT                   LNSFDSIYVDMAKRYFSVKDHRGLSFNYYHDLLKAALKGDAIEAERLCKTTLEKSLALW
FT                   KDRKK"
FT   gene            284015..284647
FT                   /locus_tag="BcerKBAB4_5647"
FT   CDS_pept        284015..284647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5647"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: btk:BT9727_1488
FT                   fatty acid hydroxylase FAH1P"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5647"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46612"
FT                   /db_xref="GOA:A9VUP1"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP1"
FT                   /protein_id="ABY46612.1"
FT                   /translation="MKLKYFKEYFSYPDILIMSCLFFASFGFMILHLTSIGIWGAFILG
FT                   MIMYSLAEYATHRFIFHLKPPKNAFLLKILKRLHYDHHTNPNELHLLFLPLWYSVPNIA
FT                   ISGAIFYFLSSSFVMTNAFIAGIMLFLLFYEWKHYIAHRPLQPISPWGRWMKKVHLWHH
FT                   FKNENYWYGVTNPAYDFLMGTFKDQKDVDQSKTAKNLEKRGDQKIEL"
FT   gene            285907..286323
FT                   /locus_tag="BcerKBAB4_5648"
FT   CDS_pept        285907..286323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5648"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5648"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46613"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP2"
FT                   /protein_id="ABY46613.1"
FT                   /translation="MNEVLSEKYKVIKFPAEVVNMFADILEEDEILYNVFHYIGSEVNK
FT                   QYQETKYMRGISINEIVGNVVIDRRVKKLKGKSYSLEVERTNISRRSAEVSVSTLSSMS
FT                   LITEKIMHPYKFLISTIRGQQVLIELGKRKETNR"
FT   gene            286344..287798
FT                   /locus_tag="BcerKBAB4_5649"
FT   CDS_pept        286344..287798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5649"
FT                   /product="putative FtsZ/tubulin-related protein"
FT                   /note="KEGG: bcz:pE33L466_0217 possible
FT                   FtsZ/tubulin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5649"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46614"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP3"
FT                   /protein_id="ABY46614.1"
FT                   /translation="MAKNFLKNEVAVKMTMVGFGQAGTRMVDKFAEYKHTDGTSVYNCL
FT                   ALNSNDGDLAELKNVPKSNQVSLKLGGLGKNPERAVKVLESNDEAKAKLKEFITERVRP
FT                   TDELVLFFAGLGGGTGTSTIIKAIEEFSAFHNKPIIAEELKSMAMKISREELIANQQKY
FT                   ARIAFNNAIERKDFIKMGIVVTLPVRADGPDVLRQVNKFSQEIWKLANEPAKGVAFVVF
FT                   ADNQHFYDEFKGLNENEKKGIANSRDYANQRIGEIIHELNTASNGAGTSVILDSQDFKR
FT                   ILLEKTGCLVINKISRNMNQIENSKEIVDMFSESLKGSSFHPPIELMKKNDDGELEASK
FT                   VHHFGMLAILDEQKNIDDSFMDDAKVEVTNTLPINGTVFNGYLISKNDFMGSVYTFYKT
FT                   DALPSRLSKGLVEEFNEFKEKQNQIQFKKSQISTIEMQDQDDDFSINFGDYIDMGTSNE
FT                   EPSADAENDEELAAFMDPDKMFGTSK"
FT   gene            complement(287834..288571)
FT                   /locus_tag="BcerKBAB4_5650"
FT   CDS_pept        complement(287834..288571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5650"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="KEGG: bcz:pE33L466_0216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5650"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46615"
FT                   /db_xref="GOA:A9VUP4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP4"
FT                   /protein_id="ABY46615.1"
FT                   /translation="MIKQENQSEQTMVDDENSLHEDAFEKAWRITEFSKLVGRHHNTVY
FT                   NWFNTLEEKGLHGTLRTNNTNEKLYNSLDLNIALFIKQKRDEKWSLDAIIELLPHQFEL
FT                   RPVSPENHSNEVLSQIDFQDAAETIEKLVEQKVQAHLQNIEIQFQEKFENVLKALPQPE
FT                   DPIAMKERQRQERLDNIIIEHRARKELRRQAEKLWNEKPEEERVKKVGWFKKEEDLAKK
FT                   HLFIENYLNENMIEYMQSIMTSE"
FT   gene            290656..293061
FT                   /locus_tag="BcerKBAB4_5651"
FT   CDS_pept        290656..293061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5651"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: btk:BT9727_2889 sensory transduction histidine
FT                   kinase; sporulation kinase A; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5651"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46616"
FT                   /db_xref="GOA:A9VUP5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP5"
FT                   /protein_id="ABY46616.1"
FT                   /translation="MIIKDYFINLSIFSLLVSAAIFIQVFTIHSRRYFEKFYGGIIAVT
FT                   LMFFSFPYMGFSYDLRAVPLILSFIYFGRIAGWITLISIIIMRIFYIGGYWEPPVMAYF
FT                   GMGILFTIFKTYFKSLHPFKSAPLYFSVFVGMKWLVGVFFITTVLYTPGLVFIALGLLI
FT                   GVFLMEAYQRLYYLTQDLSKMNQKLKKSKQELKDTVHELQGGIFKFKKTDKHFIHTLCD
FT                   GQFYYQNGIYSERVVGKSLRTIDASIIPPHLVPQLMKYYLQAWEGKEIIFELPWPNDKT
FT                   IILIALRPIKRNGQVIEVVGSTVDITERKKVESELRATKELLESFIKHNVDAITISDRE
FT                   GHILQANKAYEKIFGWSSHEIIGKRLPCVPDFLMDESLGNIQKILTGESVVTRLETVRQ
FT                   RNDGSLLDVSLTVSPILDVRGNVIALSAICRDISERKQAERERQRLHQQLRDSEMKYRA
FT                   LIEQATDAVYVVELNEDQFPSRFIEVNPVGCNRFGYSREELLSMPFPNNVPQDSPIIIQ
FT                   LLEKIREGQTSFTLQDEHIFPTGKTITTEFSVRIFNLNGKKVFLSISRDITERLKTEEL
FT                   LRKSEKLAVVGQLATAIAHEINNPLTAMKGFMQLLKSTENENNQGYINIVSSEIERIES
FT                   ITNEFMAVAKPQVVRIQPNDISVLTDQVLLILQPQAMMNNIQIRTDYTPGIPLIPCEGN
FT                   QLKQVFVNILKNAIESMPMGGEILIQIDKLDNDQISIRFIDQGCGIPKERIPYLGEPFY
FT                   SIKEEGIGLGLMICYKIIETHQGKVFIESEVNKGTTVEVTLPICTIQK"
FT   gene            293301..293652
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5652"
FT   gene            293937..294845
FT                   /locus_tag="BcerKBAB4_5653"
FT   CDS_pept        293937..294845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5653"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   sen:SACE_6215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5653"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46617"
FT                   /db_xref="GOA:A9VUP6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP6"
FT                   /protein_id="ABY46617.1"
FT                   /translation="MKGWIIMSSYFPKVGRLIGVISMLVILLSSFWLIWNGETNIRYSG
FT                   DHEGTMSFGNKWIPVIIGIFLVRFLPFHRKNYNPIQQHEPRHIMIQTFVLFLSGFLFTI
FT                   CLLIANFEGMALQLWFMISKIILLLLTPLMLLLFYQSNPNKERFKPVKSLVSNRWYRLT
FT                   PLMVIIIWGYFNFFSVFSTPFVSIGMDRTILIATLFLGFFINSVLEEIFYRVWLQTRLE
FT                   LLLGTWPAILLTSLLWASWHIAIHGSGHWGTDTATVITNLGIVGLFLGYLWARYRKVWV
FT                   IIIVHGFINAHPQQLLEILFN"
FT   gene            295276..295947
FT                   /locus_tag="BcerKBAB4_5654"
FT   CDS_pept        295276..295947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5654"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: btl:BALH_3003
FT                   nitroreductase family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5654"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46618"
FT                   /db_xref="GOA:A9VUP7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP7"
FT                   /protein_id="ABY46618.1"
FT                   /translation="MIGTDSKKQEILKAYQFRHACKVFDTKKKISDEDFHFILETGRLS
FT                   PSSVGLEPWKFVVIQDEALREKLKSVSGGAQGQLPTASHFVIILARSKEGLRHDSAHVI
FT                   KMMKDIHHMPEEVVQNLSGFYKSFVETELEDNDRLVFEWASKQTYIALGNMMTAAAQIG
FT                   IDSCPIEGFDKKQVNAILQNEGIIDGNDFGVACMVAFGYRKEDSKRPKTRQNLDEIVAW
FT                   R"
FT   gene            296827..299463
FT                   /locus_tag="BcerKBAB4_5655"
FT   CDS_pept        296827..299463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5655"
FT                   /product="Microbial collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /note="PFAM: peptidase domain protein; Peptidase M9A
FT                   collagenase domain protein; Peptidase M9 domain; KEGG:
FT                   btk:BT9727_3286 microbial collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5655"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46619"
FT                   /db_xref="GOA:A9VUP8"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR013661"
FT                   /db_xref="InterPro:IPR041379"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP8"
FT                   /protein_id="ABY46619.1"
FT                   /translation="MVKYSRISKLIVGVGLVTISCSGLQIQAETKEKNVKNVLQMEPVG
FT                   LRKSVDELAHPSNVQENGSFTKRLKLADLSQRPPMPNENAKQLVEEKKYSMAELNQLSN
FT                   KQLTDLLVTIQWYQIPELFQFNNDSLKFYQDDSRMQAIIAKLAEQGQAYTKDDSKGIET
FT                   LVEVLRSGFYLGFYHQELSKLSERVYHDKCLPALKTIAKNPNFKLGTTEQNKVISSYGM
FT                   LIGGASADVEVIQYAGEIFKQYNDNLSTFIEDRTKGDAVYNLMKEVDYEVQSYMNATGK
FT                   EPKDMLWYGKIDGFINEINRFALIGTVTDKNGWLINNGIYYASRFGKFYSTPTKGQQVV
FT                   TEAMGIYPYLGQQYFAAAEQIATNYGGIDANGKTVNLDQIREDGKKHYLPKTYTFDDGA
FT                   IVFKAGDKVSEEKIKRLYWAAKEVRSQYYRTVGSDKPLESGHADDVLTMVIYNSPDEYQ
FT                   FNRQLYGYETNNGGIYIEGTGTFFTYERTPQQSIYSLEELFRHEFTHYLQGRYEVPGLW
FT                   GQGEMYQNERLTWFEEGNAEFFAGSTRLDSVVPRKSIIGGLSNDPSKRYTAAQTLNAKY
FT                   GTWDFYNYSFALQSYMYNNRPDMFDKVHDLIRTNDVPGYDAYRSTLSKDNKLNEEYQTY
FT                   MQMLIDNRDKYTIPQVSDDYVAQHNPKPLSDVASDITNEAKLKNVKVTKNKSQFFNTFT
FT                   LQGTYTGSAAKGENEDWKVMNQATNDMLKHLAEKEWSGYKTLNAYFVNYRVNAAGQFEY
FT                   DVVFSGVNTEEGTAVEKEPNNSFDAANPLSLNALLRGNLSDQDQVDRFVIDVKDPKDLQ
FT                   ITVTNEQNLGLNWVLYSESDLNNYVTYATKRDGNKLLGNYNAKPGKYYLSVYKYGGGTG
FT                   NFTVEVK"
FT   gene            300541..301248
FT                   /locus_tag="BcerKBAB4_5656"
FT   CDS_pept        300541..301248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5656"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bca:BCE_3336
FT                   IS240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5656"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46620"
FT                   /db_xref="GOA:A9VUP9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP9"
FT                   /protein_id="ABY46620.1"
FT                   /translation="MEKENLFKWKHYQPELILLTVRWYLRYNLSFRNLVEMMEERGLSI
FT                   AHTTIMRWVHQYGPQLEEKVRHHLKSTNDSWRVDETYIKVKGQWMYLYRAVDSKGNTID
FT                   FHLSKSRDKQAAKCFFKKALAFSYVSKPRVITVDKNPAYPVAIQALKEEKHMPEGIKLR
FT                   QVRYLNNIVEQDHRFIKKRVRSMLGFKSFGTATSILAGVEAMHMIKKEQIDLRDQSVQN
FT                   QKEFIHQLFGLTA"
FT   gene            complement(301343..301573)
FT                   /locus_tag="BcerKBAB4_5657"
FT   CDS_pept        complement(301343..301573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5657"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bcz:pE33L54_0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5657"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46621"
FT                   /db_xref="GOA:A9VUQ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ0"
FT                   /protein_id="ABY46621.1"
FT                   /translation="MFWKFGGKNRTKLGDFLDRNGFTQNDLEKTAKLSRPTVSKACNDK
FT                   EYIPSPTVMKKILKVIRQIKPNVKSTDFWDM"
FT   gene            301865..302185
FT                   /locus_tag="BcerKBAB4_5658"
FT   CDS_pept        301865..302185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5658"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46622"
FT                   /db_xref="GOA:A9VUQ1"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ1"
FT                   /protein_id="ABY46622.1"
FT                   /translation="MRARKETIPFREFMDRSYKDKEQKIRKYNSLSPFAFLHMSDQVLH
FT                   TYIALGVMGTILIGAVMLEKYLVRHDYISAAKFVSEGIYHGTRIGGVCLIGYVFVRIVI
FT                   MF"
FT   gene            302201..303367
FT                   /locus_tag="BcerKBAB4_5659"
FT   CDS_pept        302201..303367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5659"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: gtn:GTNG_3465
FT                   DNA segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5659"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46623"
FT                   /db_xref="GOA:A9VUQ2"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ2"
FT                   /protein_id="ABY46623.1"
FT                   /translation="MGIIKEWVRTQRLRNQLMEVFGKAGLYTEHQTRGGKVPIYPKVHN
FT                   VSSSAESVRYVFTIPNGLDPQKIEKKWFCFQQILGPNITIEGDVKKFVLHVFRSDAGLK
FT                   PYNYCYKEWQPLLKGYRLPVVVGRDQFGKTITYDMVDSNTPHLLIAGETGSGKSSMVRV
FT                   VLSTLIQYMSPDTLHLYLGDLKNSEFHFLRRVKHVKEVCMEEIEMKIMLQKMWKEIRER
FT                   RKLMEEYEVDHIDAYNKLNPDHQKPYILLAIDEVAMLKDEKECMTTIEKISAVGRSLGV
FT                   FLMLSMQRPDAKVLDGKLKLNMTVRIGFKCDSAINSNIMGTPGSEHLEQSGQMILKRNG
FT                   LKKVQAPYLELSKAKQIVEPYRMSKGERILHNSLQEEMPLFGVLDDEE"
FT   gene            303354..303965
FT                   /locus_tag="BcerKBAB4_5660"
FT   CDS_pept        303354..303965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5660"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK0554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5660"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46624"
FT                   /db_xref="InterPro:IPR025855"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ3"
FT                   /protein_id="ABY46624.1"
FT                   /translation="MMKSRDKGILNDLNRFRCMSRDDIIDLHFQGLKNAVTCCNTVMKR
FT                   LRRDGYVDANVLQHPYIYFPQPSSIRKTSQKIPHFLGIVDVYKQLVHYENPKLFEVEPK
FT                   YRKEYMEPDAFTIWRRSPFFIEVQKSVYSKKLMQDKINRYELYFHNQEWHNEYWQPKAS
FT                   KFFPSILIITDKHYDVQSPYFRIFQANSIESFMNNLTVKS"
FT   gene            complement(304042..304122)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5661"
FT   gene            304362..305009
FT                   /locus_tag="BcerKBAB4_5662"
FT   CDS_pept        304362..305009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5662"
FT                   /product="antigen"
FT                   /note="KEGG: bce:BC2461 antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5662"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46625"
FT                   /db_xref="GOA:A9VUQ4"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ4"
FT                   /protein_id="ABY46625.1"
FT                   /translation="MKNTSKKQIIILFFISILGLGTMLGILYFNHKTNIQQNKALATEK
FT                   RVLQYEPTLKKELEKYNLGGKTAVLLGIMYQESRGEGNDPMQSSESLGLKPNEIQETSL
FT                   SIKQGVKHFAKMYKYGTEKDVSMDTIIQSYNMGPGYIDFIASQEVKQHSEDSAKKFSKM
FT                   KVNQNPAMYTCGGNKNNFRYPYCYGDFTYATKVNEKTILIEELLRNVHDSSK"
FT   gene            complement(305092..305799)
FT                   /locus_tag="BcerKBAB4_5663"
FT   CDS_pept        complement(305092..305799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5663"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bca:BCE_3336
FT                   IS240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5663"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46626"
FT                   /db_xref="GOA:A9VUQ5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ5"
FT                   /protein_id="ABY46626.1"
FT                   /translation="MEKEYVFKWKHYQPDIILLTVRWYLRYNLSFRDLVEMMEERGLSI
FT                   SHTTIMRWVHQYGPELDKRIRSHLKQTNDSWRVDETYIKVKGQWMYLYRAVDSKGNTID
FT                   FYLSKTRDQKAAKHFFKKALQSFHVSKPPVITVDKNPAYPIAIEQLKKEKSIPGGMRLR
FT                   QQKYLNNIVEQDHRFIKKRIRSMLGFKCFDTATSILSGVEVMHMIKKEQVDLRDQSVQN
FT                   QKEFIHQLFGLAA"
FT   gene            complement(306853..308562)
FT                   /locus_tag="BcerKBAB4_5664"
FT   CDS_pept        complement(306853..308562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5664"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: baa:BXA0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5664"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46627"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ6"
FT                   /protein_id="ABY46627.1"
FT                   /translation="MGKSFIIQNQRSLNGETTNAVLVTLKSWQKFVEAFEKKYYSYKDT
FT                   YLEDILQHMTYEERIADVEGFVEQAKPSFSRRAMSALAEKTGRKHKLYGITNADLEVFL
FT                   YLHKKCYTNGVIPNVTIHMMWEDYKQYKEEFAHIQHSQFYIALKKLSIHNIIAIENGVD
FT                   GRYTIKLTHFMNEETEKTNPYVYISPVVFTKAFFKLSVAAKKLFLDIAMQQHTETTLKR
FT                   SLDKQDERGNKTHFGGMYRFLHKKYPHQIRAVIEELTTALPCTENPLFKICKMQKGVKH
FT                   TKRYTTLYLSIHSDFLCTKESGEEQHRDPFTPKATYARKAKFIESVLQEMNIGELSSDM
FT                   NKFIHVLKHTCHRQIRGVIRGLRDMVDRKEGYPTKIVYTLKKLLHQTSQYQILDTAAKE
FT                   GIYPLIAQHIPKERNSDREQAVFNFGLHYSMYSLHSIKKMFKNVHALLKQKFAVPVTEE
FT                   SYHRNYLKYQEETLFRKYAYDQGVNLHAYIALEIEMREKLKVRGHKERTIPSDVREWFI
FT                   EAIDKLPQEKLRVIELPKQFNLLEFMRTFEHLIRAGATITAPDQVLSAMEIK"
FT   repeat_region   complement(309288..309738)
FT                   /rpt_unit_range=309288..309368
FT   gene            309840..311537
FT                   /locus_tag="BcerKBAB4_5665"
FT   CDS_pept        309840..311537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5665"
FT                   /product="putative transcriptional regulator, RpiR family"
FT                   /note="KEGG: bcz:pE33L466_0224 possible transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5665"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46628"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ7"
FT                   /protein_id="ABY46628.1"
FT                   /translation="MDNLLQMFRDALLISEPIYKKNEPLWNKWNAYFKDVKNNNNKVLT
FT                   SPYASPSFTALVSWLEKKQESGVTLVQIYAKIDSYKEEIYKEIEGFIEKEFQDVAPSNS
FT                   IILENDQNADKLNTVNHEDYYEVNNSAVYYKLRDGIAKNQFEEDEKSKVLQYPIETKSS
FT                   NGVAQLSSHKDEDLRLTNTEESARWNTLVDDVMSNMDDLTADCLDAITIQWINEAKSPD
FT                   EFIDFSYEQVLEMCNIPKTVVKNKEYYRAEDKIKIAKRIAALASIFIYLNDDNEVVVLN
FT                   DRDDEGERVELKREVIKRLFVLDSVVLWRHSVTNEYMGIESCRIKPGSFLTNYLYGSNN
FT                   TTALLSKKALEYNSYRHKYHKRLIRYLTWQWRIRQMYSSLKKPYSIGGDKGLLAVMDIP
FT                   KDWKPNRIREQLENVLMDLENEKVISHWEYSDPLDEQQIWKRNWFKNYYANLGITILPP
FT                   EEMLQSMDSGIGKKFIEEPQEQLPVVTVVEEVRETVEPVEQREKKIRDQILKVHNEKNV
FT                   SIREIADEVSISPSTLSRFCNYKTKRLSKKALEKLTKWCERQEILEKM"
FT   gene            311718..312194
FT                   /locus_tag="BcerKBAB4_5666"
FT   CDS_pept        311718..312194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5666"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   oih:OB0379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5666"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46629"
FT                   /db_xref="GOA:A9VUQ8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ8"
FT                   /protein_id="ABY46629.1"
FT                   /translation="MKLNNWDEISIEKSTNIGKEEMELLLLADPSPEVVNGYLKQGDCF
FT                   VLKKDAITVGIMILIPTRPETIEIINIAVSEKEQGKGYGKYLLGFAIDYAKKEKYKTIE
FT                   IGTGNSSLMQLGLYQKCGFRITNVDRDFFLRNYEEEIYENGIQCIDMIRLTQYL"
FT   gene            312921..314249
FT                   /locus_tag="BcerKBAB4_5667"
FT   CDS_pept        312921..314249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5667"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   6-phosphogluconate dehydrogenase NAD-binding;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   bay:RBAM_031240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5667"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46630"
FT                   /db_xref="GOA:A9VUQ9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ9"
FT                   /protein_id="ABY46630.1"
FT                   /translation="MVTVLNNEIKKTLVEKIVNKSACIGYIGLGYVGLPSALKCLEVGY
FT                   TVRGFDKNLTKIEKLECGTSYISDIQDTEIQDALHTNRFFISTEMNYINECDVVVICVP
FT                   TPLEKDSKQPDLTYIHSAVNELVKYIRKGTLIILESTTYPGTTREEILYKLEHETNFEI
FT                   GTDIFVAYSPERIDPANKSFSIQDIIKIVGGVTPNCTDCAAAFYSHLIKGIHKVSSPEV
FT                   AETAKLLENTYRFINIAFINEMTQICNELNINIWEVIDASGTKPFGFQKFYPGPGVGGH
FT                   CIPIDPIYFKWIANNKDLATKMIDVAQEINENMPNYIIKRALQLLQDEDGKNVLMIGVA
FT                   YKKNVNDARESSALDIMNGLMLEGYNVDYHDPFIEELIVDNHKVKKSINLTTNALNKYH
FT                   LIIVHTDHDCINFNLLNGVNCLILDTRNILKDQSIYKKNIICL"
FT   gene            314258..315415
FT                   /locus_tag="BcerKBAB4_5668"
FT   CDS_pept        314258..315415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5668"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; aminotransferase class-III; KEGG: bay:RBAM_031230
FT                   SpsC1"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5668"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46631"
FT                   /db_xref="GOA:A9VUR0"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR0"
FT                   /protein_id="ABY46631.1"
FT                   /translation="MVEFIPFYRPEINDEDVEGVIRALKSGWLSKGPKVIEFEESLKEY
FT                   LNTGHVVSCNSGTAALHLALLSLGIGVEDEVIVPSFTFCSSVNVIMHVGAKPVFVDIDE
FT                   EDLCLDLHDVKRKITKKTKAIIAVHFAGYPAKLQELQKLCKEHGLFLIEDAAHALGTKY
FT                   DNTLIGTHGDIICFSFYATKNITTGEGGALVTKNEEIAEKARLYGWHGITKNAWNRYGE
FT                   KGSWRYDVLLPGFKYNMMDLQASLGISQLKRADEMIEKRRRIAEIYQKELKEIQEYITL
FT                   PNYVNNPSIKHAWHLFVIKINPNSPISRDQMIQEMKKRNIGLSVHFIPVHMHPYYQERF
FT                   NVHLPKTEEVFDQIISLPLYSALTENEVEHIVTSLKSLYQLKVGR"
FT   gene            315422..316345
FT                   /locus_tag="BcerKBAB4_5669"
FT   CDS_pept        315422..316345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5669"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: bay:RBAM_031220
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5669"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46632"
FT                   /db_xref="GOA:A9VUR1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR1"
FT                   /protein_id="ABY46632.1"
FT                   /translation="MKIGVIGGGGFIGKHVTKELIARGYEVIIFDKFKPSMDVPFEEID
FT                   ILDIATLREKLINVDGVIHLAALVGVDNCRSNEEDVVRVNFEGTKNIVEVCIENGIGKL
FT                   LFSSSSEVYGDGVSVPFKENDVKIPKSAYGKAKLMSEDFLKEYANNSFKVRVVRYFNVY
FT                   GSQQNENFVISKFLKQAHNGENMTIYGDGQQIRCFSYISDIVNGTILAFEYERENFADF
FT                   NIGNNKPISMEELAGKINELMGNKSEIEFLNLGDEGVRDSNIEIFRRIPSIEKAQLLLN
FT                   YQPVISLNRGLEKIIEEKYGNTVSIS"
FT   gene            316320..317561
FT                   /locus_tag="BcerKBAB4_5670"
FT   CDS_pept        316320..317561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5670"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   bay:RBAM_031210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5670"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46633"
FT                   /db_xref="GOA:A9VUR2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR2"
FT                   /protein_id="ABY46633.1"
FT                   /translation="METQYLYPKNPKKIKYPIYPSFWSVFDHIYFLKSIYRSNHSNLKE
FT                   SLQTLYPNSEIILTNSGSSALVAGLKYLNIKKEDEVILSNFNCPNVIEAVLTVGAKPVL
FT                   IDLTTDYSLSLNKIKKYSNENTRAIILTHVYGCHEDLEVINWARDNDIYIIDDAAQAMF
FT                   SYQNEKSIGSLGDIGILSFGGTKPIPSIGGGALLLNRTVNDLCDMDEEKKAEVFLDYKN
FT                   HLKTQLALRIKKNRLLSLFTDYWEKLGILPSYNDSKLDSLPEETEVIYPKTMSTLRSLL
FT                   IDRHLKRMKKILEINIYNASLCYTMLQSIEEKYGVKIIFSAQNVYLNYFTIIFKEPSDR
FT                   YECSVYLAGKGIQTCWNYLPLSEIPIFSKYATESENIEFLWSRVLSIPFKYPLRKKDLK
FT                   YICSQILIYLEKKK"
FT   gene            317573..318454
FT                   /locus_tag="BcerKBAB4_5671"
FT   CDS_pept        317573..318454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5671"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bay:RBAM_031200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5671"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46634"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR3"
FT                   /protein_id="ABY46634.1"
FT                   /translation="MEIEICTDAQYWDACMEEYNGSVFHCYEWGKLMELLPGVQFFPVL
FT                   IKTRDTVVLSPIYVQDGRVLGSLIGYGGPVIIGQDKIDFAFYESIINRKFENKIQKLLL
FT                   PITINPFQSYSDEKWEYKETYMLDLPNNFEDLWTSCSGKARTSVRYARKQNVEIRPIAL
FT                   EELDEFYNLYQEHNNSIGASYSFSREFFYYLFINLKERILFLGAFLEEELISSSIFIMD
FT                   KQVLYYWININNIKGKNTQSSYLLLNVAFELAIHNKLKYADLGYSHNKGIARPKIYWGA
FT                   VLKKCFCLKERI"
FT   gene            318458..319147
FT                   /locus_tag="BcerKBAB4_5672"
FT   CDS_pept        318458..319147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5672"
FT                   /product="WbqC-like family protein"
FT                   /note="PFAM: WbqC-like family protein; KEGG:
FT                   bay:RBAM_031190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5672"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46635"
FT                   /db_xref="InterPro:IPR014985"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR4"
FT                   /protein_id="ABY46635.1"
FT                   /translation="MIISGHQPSYLPWYGFFEKIHKSDVFVFHDIAQFEKKGFLNRNRI
FT                   KTSQGVSWLTVPMQMKNYKEIPLNKLKIDNTQDWERKHWKTIRINYSNAPYFNVYKDYL
FT                   ENFYSEKWDNLNSMNMNFIHFIIQELNIDTELYYASELEGITGKKSDFVLELCQKFNAN
FT                   TYYSGSLGQDYLIESDFEHENIEIIYQRIREYSYPQLFGEFIPHLSMLDVLLNCGPEET
FT                   EKLIKGV"
FT   gene            319154..319831
FT                   /locus_tag="BcerKBAB4_5673"
FT   CDS_pept        319154..319831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5673"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: bay:RBAM_031180
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5673"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46636"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR5"
FT                   /protein_id="ABY46636.1"
FT                   /translation="MNVLVFAAHPDDEIIGVGGTIAKHVEQGDDVHVVILAEGKSSRSK
FT                   EYRELDLEVKSLSYKETEGACTTLGVTSFARLDFPDNRLDTLPLLDVVKEIEEHINKIN
FT                   PTIIYTQYGGDINIDHTVVYRAVMTATRPLPNSNIKWVFAYETLSSTEWNYNEKDKFLP
FT                   NYFVNIEEHLETKLNAMKHYESELREFPHPRSIEAMKHNAFVWGAKSGYKAAEAFMLVR
FT                   GTW"
FT   gene            319843..320778
FT                   /locus_tag="BcerKBAB4_5674"
FT   CDS_pept        319843..320778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5674"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bay:RBAM_031170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5674"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46637"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR6"
FT                   /protein_id="ABY46637.1"
FT                   /translation="MLIPQVPFFGLDSKQIDLKWVEQGYGLEANIFDGESLHDKSYTTK
FT                   FSDVLSFVQTLNPSLLTLHFPTDNADYLNSEFIKKQLYEFINLAIKYNAAGITVHANQF
FT                   MNIAEFQTYNLIDNRKRIIEFFKMIDEEIKGTNIWIGVENLPIIGNLGDDFDPIFVYPE
FT                   DFNDLVNLDLSNVGITWDICHWSITYLTRLGISKLLRQEEIEYKDFHKYINLMNHIKHL
FT                   HFSSFKHLTIPYSEVRCFEGESPTNGSINEHLLHETLLKVKNQVSSRNIGIVFEVQETD
FT                   YTNRVKSWETLNWFQKNITGIQANSNFLKI"
FT   gene            320910..322283
FT                   /locus_tag="BcerKBAB4_5675"
FT   CDS_pept        320910..322283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5675"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M20; peptidase M28; KEGG:
FT                   bcy:Bcer98_3876 peptidase M28"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5675"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46638"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR7"
FT                   /protein_id="ABY46638.1"
FT                   /translation="MKKLAITKKIIVSFGILLLFFFSNPYGEPVKVNAMVNNNLYSPVT
FT                   EQVRASRAIEHIRFLSEKIGPRPSGTMQEHRAAKYIGDTLQKLGYEVEYQALPVPDQYI
FT                   GSISFSMYGEKDWQVGAASNAFISKNPVVGSVVFIGKETNINSLSESIHGKIVLLEQAD
FT                   TIEKYNEQVEHVAIKGAKGVLLYSTIGDRGNYGEAFNPILKKEQSIPVFGLAYNQGIRM
FT                   KEKLLHNQNVVSLKAKQEVNLRSLNVIAKKKPKHTTGDEEVAIMSAHYDSVIGAPGAND
FT                   NASGVGLLLELAYNFKDIETNKEIQFIAFGAEENESLGAYHYVNQLSAKDKTRIRGVFN
FT                   ADMIATSYHQAKDLYAMTLDGSQNEVTNTAVATSKELRKSVVLTGKFDSSDHVPFNQAG
FT                   IPSALFIWMDVESWDPLIYHVERVFHTPQDTVLENISAQRMQDALEIIGTSLYYFIKR"
FT   gene            322392..323666
FT                   /locus_tag="BcerKBAB4_5676"
FT   CDS_pept        322392..323666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5676"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   btk:BT9727_0216 permease; probable multidrug resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5676"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46639"
FT                   /db_xref="GOA:A9VUR8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR8"
FT                   /protein_id="ABY46639.1"
FT                   /translation="MRSTWKEFKGMDLNVWIRFIGEALNGIAMMMLMPFFALYLKDKVD
FT                   SLLEVGVIIALSPIAASIGSLIGGHIADTYGRKPTMVLSMASNGLLMLFFLFIDGFIAY
FT                   AILSIGLGLCNSFFEPAASAMVTDVTEPEKRTEAYGLLRMAHNIGAAIGPIIGAAVVVV
FT                   SKDVIFLITSGTMLFYTILMVLFLKETKPKNVMIHEETPENSIRSTLRVVIRDRILLFY
FT                   IVTGIIIFMGFSQSEGMLPLHFSNEKTMIFGNSNPFPYLMTLNGLLVVFFQFPISKWLT
FT                   HKSIGKSMLYGAILFGIGLLAIGWLPKWFQVINTNDLVILVSLLIAYTVYTLGEMIMSP
FT                   VQMTFVANLAPEHLRGTYMGAANLQWITGNILGPLLGGLLLEHLLGHILFTILGVGCVM
FT                   SGFVYLLLDKLVEDRSKQIPIKQTS"
FT   gene            complement(323848..324315)
FT                   /locus_tag="BcerKBAB4_5677"
FT   CDS_pept        complement(323848..324315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5677"
FT                   /product="Transcription factor RsfA"
FT                   /note="TIGRFAM: Transcription factor RsfA; KEGG:
FT                   bca:BCE_3968 DNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5677"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46640"
FT                   /db_xref="InterPro:IPR014243"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR9"
FT                   /protein_id="ABY46640.1"
FT                   /translation="MVISRQDSWTNDNDSLLATIVLQNIRDGGTQLAAFKAVAKQLART
FT                   PAACGFRWNSYVRKQYEEEIQQAKQNRKSGNNKSPIQQTKETKSLSMTLDVIIIFLQNY
FT                   KEVNEVNNLQQQIEYLTAENKSLLQRLTTYEEEYRMLLNHIDKARNLIVVK"
FT   gene            324741..326381
FT                   /locus_tag="BcerKBAB4_5678"
FT   CDS_pept        324741..326381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5678"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: bca:BCE_3794 serine protease, subtilase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5678"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46641"
FT                   /db_xref="GOA:A9VUS0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034073"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS0"
FT                   /protein_id="ABY46641.1"
FT                   /translation="MKIFKGILVSSIALTAFNGVGGILPSEKSEVAYAATYNYSNKQLN
FT                   STVHKQVTKQLILKFKNEANLPYQDGIEKFIKEEKQDPELIKILAEYPNITINRLFSSL
FT                   NPTEIKNLGKEIKDSDHISSNLLNYYIVETQVDIDVQALLVKFEKSSLVETAYLQEEEA
FT                   PPEERLPNLSVNPYDEPRLTRQGYLEPAPLGINAPYAWSIKGGDGKGTTFVDMEYGWLF
FT                   THEDLVNQNIELISGQNKSEHHDHGTSVLGIVSAEDNNIGGIGIAPKAKVKVVSQIRDN
FT                   GRYNTADAILSAVNNMQAGDILLLEAQATYDGYGDKNYLPVEVKPDIFDAIRMGANKGI
FT                   IIIEAGANGGNDLDQFKDRNGKQILNRNSPDFKDSGAIMVGAASARVPHKRSYFSNYGS
FT                   RVDVYGWGNAVDTTDAKPSEFMTNLYTSSFSGTSSASPIIAGAAASIQGIAKNSQGKVY
FT                   TPSQLRDILSDSSTGTKSNDPTSDKIGVLPDLKAILSKLGFSPNLSNDSSIVFPEEQEI
FT                   NKGNEGSTITFPKEDSANSEGNSSFIFPE"
FT   gene            326837..327244
FT                   /locus_tag="BcerKBAB4_5679"
FT   CDS_pept        326837..327244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5679"
FT                   /product="putative nucleotidyltransferase"
FT                   /note="KEGG: bcz:pE33L466_0269 possible
FT                   nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5679"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46642"
FT                   /db_xref="GOA:A9VUS1"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS1"
FT                   /protein_id="ABY46642.1"
FT                   /translation="MIFQSMITAIIEKLQETVNPYWIIVFGSTAENRERDDSDIDIAYL
FT                   SDIKLGNYERFLLAQELADIVHRDVDLVDLSEASTVFQAQIIHTGKTIFCSDEERKTIF
FT                   EMKTLKMYSKLNEERKIVFEDIKKRGSIYEE"
FT   gene            327234..327647
FT                   /locus_tag="BcerKBAB4_5680"
FT   CDS_pept        327234..327647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5680"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   bcz:pE33L466_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5680"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46643"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS2"
FT                   /protein_id="ABY46643.1"
FT                   /translation="MKNEVILNKISTIERCIKRIQEVYGNNPDNLEDYTKQDSIILNIQ
FT                   RACEASIDLAMHIVAGKKLGLPQSSREAFDLLVDADLLSTELASKLKAMVGFRNIAVHD
FT                   YQSVNLDIVRQIIEKHLKDFKLFTKEVMGILDL"
FT   gene            327868..328095
FT                   /locus_tag="BcerKBAB4_5681"
FT   CDS_pept        327868..328095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5681"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5681"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46644"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS3"
FT                   /protein_id="ABY46644.1"
FT                   /translation="MDALLVRLIFYAGTEWLGFRTLFSSCNLIYQVIKELHIASLSKVF
FT                   GYAKPKFISHLPLGYALHTLEEGEFFRGIS"
FT   gene            complement(328115..328342)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5682"
FT   gene            complement(328398..328967)
FT                   /locus_tag="BcerKBAB4_5683"
FT   CDS_pept        complement(328398..328967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5683"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bca:BCE_1177
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5683"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46645"
FT                   /db_xref="GOA:A9VUS4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS4"
FT                   /protein_id="ABY46645.1"
FT                   /translation="MIKLEKENKKMKIIQSATILFSTRGVRNTTVDEIAKKAKVGKGTI
FT                   YYYYTDKTEILCDCYMRHIQLIRSQLFDLYKEEKDVLLRIQKILHYISLEYHQDPFVST
FT                   LFQEYKEYHSPEITACFKKSEEEAIKMISNLLEKGYQQGALHKVPLPLTAFMLVRMIFN
FT                   YEQDYIKDDKSDKEFLQLLKHMLLKN"
FT   gene            329369..331192
FT                   /locus_tag="BcerKBAB4_5684"
FT   CDS_pept        329369..331192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5684"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="KEGG: btk:BT9727_1586 asparagine synthetase,
FT                   glutamine-hydrolyzing; TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: glutamine amidotransferase
FT                   class-II; asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5684"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46646"
FT                   /db_xref="GOA:A9VUS5"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS5"
FT                   /protein_id="ABY46646.1"
FT                   /translation="MCGIAGWIDWSKDLSNEQETLKKMTDAITHRGPDAEGHWLSKRAA
FT                   LGHRRLIVIDPEGGLQPMLYKDGNDTIGLTFNGEIYNYQELRKELEGKGHEFQTKSDTE
FT                   VLLHAYLEWQEDCVQHLNGIFAFGIWDERFGKLMLGRDHLGVKPLFFAQRGSAILFGSE
FT                   LKVLLSHPLVDAEVDKEGLSEIFCLGPTRTPGHAIFKDIHEVRAGHYMTFTSNGSNTTQ
FT                   YWKLESKNHIDDIDMTVETIRSILQDTVKRQLIADRPVVSMLSGGLDSSGLTGLAGNEF
FT                   GNKGEHLHTYSLNFINDEKDFEQDFLRFDRDEPWVKRVAEYVGTKHHSIELGSDSLIEH
FT                   LLIPMRARDLPGVGELETSLYLLFKEMKKDATVALSGESADEVFSGYPWFHQEKFLDAE
FT                   IFPWSVNLWYSTEILSEDFKEKISPEKYQKQKFEDAVAEVPFLEGESDLQMKQRQMSYM
FT                   FITRFLPFMLERKDRTSMMNGFEVRVPFCDYRLVEYLWNVPFEMKSIDNIEKGILRRAF
FT                   ENVLPEDVLYRKKSAYPSTKDASYLQGISDWMLHVLNDPQSPILPLINVERVRAIAEGK
FT                   DKVISGNDARGIIDYLLQVNSWLQEYNIKLV"
FT   gene            331412..331966
FT                   /locus_tag="BcerKBAB4_5685"
FT   CDS_pept        331412..331966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5685"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bce:BC3148 streptothricin acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5685"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46647"
FT                   /db_xref="GOA:A9VUS6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR008125"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS6"
FT                   /protein_id="ABY46647.1"
FT                   /translation="MNLLIRELEVDDLDNLPEIDDSFIVNSRLILSLSKVNKQIEYTVE
FT                   DVPSYEKSYLQDQYDDELAYTEYINKPDQVIYIAILHDQIIGVMVLKKNWNHYAYIKDI
FT                   KVDKKYRSLGVGRRLIEQARQWVKESNMPGIMLETQNNNVAACRFYEKCRFVIGGLDFL
FT                   VYKGIHEESDEVAMYWYLHFK"
FT   gene            332192..332371
FT                   /locus_tag="BcerKBAB4_5686"
FT   CDS_pept        332192..332371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5686"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bca:BCE_3342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5686"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46648"
FT                   /db_xref="GOA:A9VUS7"
FT                   /db_xref="InterPro:IPR025143"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS7"
FT                   /protein_id="ABY46648.1"
FT                   /translation="MPLENSIYYIGVTIILVIIGALLGGIIRLIQHTSNYKKQDSVEQK
FT                   LDKVIQLLEKQNKD"
FT   gene            complement(332565..332720)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5687"
FT   gene            332985..333596
FT                   /locus_tag="BcerKBAB4_5688"
FT   CDS_pept        332985..333596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5688"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK1840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5688"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46649"
FT                   /db_xref="GOA:A9VUS8"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS8"
FT                   /protein_id="ABY46649.1"
FT                   /translation="MVDIVNATRQTTSLIESNKSSPSLKFYICIDGNFYSSLDKLFWRN
FT                   FKMEKLKKWFSLSTHKDERIQQIEMKIWAQSGIVVLLLAFIDVIIRGAYLHRPFLEWIA
FT                   SLAIILCYMIFFFIKSILTGVYETDINNKEQLNEKLKEKMSNTFIFCFVAIGATTYKYY
FT                   FPEDFGGWLAAIAKFIILFVFLFGIQYLITVIAWKRSNKI"
FT   gene            334029..334256
FT                   /locus_tag="BcerKBAB4_5689"
FT   CDS_pept        334029..334256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5689"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5689"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46650"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS3"
FT                   /protein_id="ABY46650.1"
FT                   /translation="MDALLVRLIFYAGTEWLGFRTLFSSCNLIYQVIKELHIASLSKVF
FT                   GYAKPKFISHLPLGYALHTLEEGEFFRGIS"
FT   gene            334291..334941
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5690"
FT   gene            335269..335535
FT                   /locus_tag="BcerKBAB4_5691"
FT   CDS_pept        335269..335535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5691"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5691"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46651"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT0"
FT                   /protein_id="ABY46651.1"
FT                   /translation="MFKKLVVGALATGVMLSGATGASAAVDTGNNLNNSNNSIAATCDY
FT                   KTFPYNSKDDMPMVVIKGGIKHYLKGTVINGGQLYGLYEPEYC"
FT   gene            336251..337777
FT                   /locus_tag="BcerKBAB4_5692"
FT   CDS_pept        336251..337777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5692"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5692"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46652"
FT                   /db_xref="GOA:A9VUT1"
FT                   /db_xref="InterPro:IPR013698"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT1"
FT                   /protein_id="ABY46652.1"
FT                   /translation="MDNQLPYQQPKREKALVIGAGIAGLLTARVLSSYFETVIVVEKDE
FT                   LPQKPSERPGTPQDFHPHRVLPRGEIIMNRFFPGYVDNLLNLGAHNVKNDKMIRFSPYG
FT                   ALELVIERKGAASSRALLEWTIRQRVQEISNVHFLSKQVVTGLLTSSDHKRVIGINIQE
FT                   RDELKTKRTVLTDLVVDTCGRQSKLNKWLTSMGYDVPEPERLKVNFGYSTRYYKVPPHI
FT                   KEKLSAISEGDPAKNVGAVGLLYIEDNIAQALLFVAGGTHYPPTNSKEYEKELDSLVTP
FT                   MMRELIKELDPISDPRGFRAHESTRQHFEQMENWPSGLLVLGDAFCNFDPIYGQGMTVA
FT                   AIEAEMLDTCLKEHSTHKPGFERKVLQRMQQAIEPAWWLSSIADLRWEGVEHVGAVPLK
FT                   GVKFTQKYFDLYLKQALKQARDGNSTMLQKYIMMNGLVYSPHEIINSDMLSMLITEDET
FT                   LEGNELLNELGEVDKRSLQERIHELIPSFTLAFENSIPNLFSSISISNAK"
FT   gene            complement(338075..338347)
FT                   /locus_tag="BcerKBAB4_5693"
FT   CDS_pept        complement(338075..338347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5693"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: bcy:Bcer98_1763 histone family protein DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5693"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46653"
FT                   /db_xref="GOA:A9VUT2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT2"
FT                   /protein_id="ABY46653.1"
FT                   /translation="MNKTELTKVVAEKAELTQKDAAAATQALLDTITNALANGDKVQTL
FT                   GFGTFEVRERSARTGRNPQTGEEMQIAASKAPAFKAGKELKEAVK"
FT   gene            complement(338481..338846)
FT                   /locus_tag="BcerKBAB4_5694"
FT   CDS_pept        complement(338481..338846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5694"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0426 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5694"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46654"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT3"
FT                   /protein_id="ABY46654.1"
FT                   /translation="MVKKACVSIITGILLICSTGCATQTDSITAKTQSIDDGTYTTKEI
FT                   TDAFPVGTPITTYIRKEEKLNVKHLTSITLTDGGVGRVLEATDGFVVVCGNEKGVFDVL
FT                   IFKTLEDVKKYEQSLAR"
FT   gene            339720..340145
FT                   /locus_tag="BcerKBAB4_5695"
FT   CDS_pept        339720..340145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5695"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mul:MUL_1266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5695"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46655"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT4"
FT                   /protein_id="ABY46655.1"
FT                   /translation="MLPDYIKIAHEIAKKAHVGQVDKAGMDYIKHPETVASFVNTTEEK
FT                   ATAYLHDVLEDTEITAADLLNAGIPYNVVEAVQVLTKEKYTPYFEYLSKVKENSLARTV
FT                   KLADLKHNSDRSRLARITDKDLKRLEKYRTAIKFLGE"
FT   gene            340334..340534
FT                   /locus_tag="BcerKBAB4_5696"
FT   CDS_pept        340334..340534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5696"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   btk:BT9727_2306 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5696"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46656"
FT                   /db_xref="GOA:A9VUT5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT5"
FT                   /protein_id="ABY46656.1"
FT                   /translation="MLNNRIVVCRAEKGWTQQDLGERVGASRQTIASMERNKYNPSLIL
FT                   AFKIAQAFGKPLEEVFEFKEE"
FT   gene            340539..340832
FT                   /locus_tag="BcerKBAB4_5697"
FT   CDS_pept        340539..340832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5697"
FT                   /product="group-specific protein"
FT                   /note="KEGG: bcz:BCZK2933 group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5697"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46657"
FT                   /db_xref="GOA:A9VUT6"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT6"
FT                   /protein_id="ABY46657.1"
FT                   /translation="MEFIKYAVIIIIVLSCLSELYMFKFQKSQEARDERGLDIQYKTTN
FT                   FLYNTLYLGIVILFLLNILQYITAEQFVNILLYFFISLGIIKVAYSYWRRSY"
FT   gene            340940..341107
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5698"
FT   gene            complement(341333..342007)
FT                   /locus_tag="BcerKBAB4_5699"
FT   CDS_pept        complement(341333..342007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5699"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46658"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT7"
FT                   /protein_id="ABY46658.1"
FT                   /translation="MKQVLRKSKRKMIYLVGSLLIALSMFATTSFAATEGAVKSVTNSN
FT                   YTGIAADINLPKSVVVKDGYVNWYLGIGASKVEGGISKTSSGYKVFLNSGYNESGQNSK
FT                   YWNTQYDTSIKDGDRVNLKLVNNGNGTVTMYVNGSPKYVNQPVYGTFSQYEPVKMVQGV
FT                   EDTGSNSFSQASFSNVLLRADTSGSTYKSWNSSISSSFSQHGTYGSNFKVYSQVPLSAS
FT                   LR"
FT   gene            complement(342709..342867)
FT                   /locus_tag="BcerKBAB4_5700"
FT   CDS_pept        complement(342709..342867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5700"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: bat:BAS2345 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5700"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46659"
FT                   /db_xref="InterPro:IPR030968"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT8"
FT                   /protein_id="ABY46659.1"
FT                   /translation="MKKIKKIVLSMVVVSALACSMISLHVSQPSSFNGGDTPSPTIPSV
FT                   SVEVSID"
FT   gene            complement(342867..343967)
FT                   /locus_tag="BcerKBAB4_5701"
FT   CDS_pept        complement(342867..343967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5701"
FT                   /product="response regulator aspartate phosphatase"
FT                   /note="KEGG: btk:BT9727_2305 response regulator aspartate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5701"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46660"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT9"
FT                   /protein_id="ABY46660.1"
FT                   /translation="MTVQEKSNKQLMELLHEWYEEIRLYHVKEAKQTYLKVQENLKGIE
FT                   TDQYLSFYYSLLNFRYKVLVDGMSITKDSFNKIEELPNIKDEFSFLAYYYHFFKAIHST
FT                   IIANYTEARTHFEKAEELLIDIPDEVEKAEFKYRISTYFYQSYQPFEAIQHVVKAKEIY
FT                   LNHVGYEINIALCDNVYGLSCIDLREFERAEECLNTVIDVFKKYDKEHLLLRVRYNLGW
FT                   LYNIQDLYPLAIRQSSEIINKIPNHFKALFVLARAYYKLEGVETAKSYIEQGMKYTNES
FT                   GNEEYKHRFAVLNELITELPRIKLEKVVTDAISYFEKEGMWDCVKEHAEILALQFYQAD
FT                   NHVKASKYFYISNNANKNHLRKGALK"
FT   gene            344999..345598
FT                   /locus_tag="BcerKBAB4_5702"
FT   CDS_pept        344999..345598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5702"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5702"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46661"
FT                   /db_xref="GOA:A9VUU0"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU0"
FT                   /protein_id="ABY46661.1"
FT                   /translation="MKGEENLKMLNSVAPKQIKNEDLPFDISWMTDWIVDWFGSLFNGG
FT                   SDVIKDGGNKVDGVVHASVPAFFDVIFLILSVVILISLLVFGASLWFKHIKWKKRSIYF
FT                   GVGSFILILLIRILPVLMLTTRSFDFQTFMSNMVGLITSIILGTAVLMFLISLALGMLY
FT                   KKFEHPKYGKWSSSLRYSSIFIFVMTLIVPALLRHL"
FT   gene            345759..345986
FT                   /locus_tag="BcerKBAB4_5703"
FT   CDS_pept        345759..345986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5703"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5703"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46662"
FT                   /db_xref="GOA:A9VUU1"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU1"
FT                   /protein_id="ABY46662.1"
FT                   /translation="MTTFVVMVSIFLILFVIGPKATKRKEERDRIEKEHKEKMEALEEE
FT                   KIDLDINGTKVRLHKKPKLKKSIYKIKGNR"
FT   gene            346173..346565
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5704"
FT   gene            346583..346981
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5705"
FT   gene            complement(347342..347811)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5706"
FT   gene            complement(347907..348281)
FT                   /locus_tag="BcerKBAB4_5707"
FT   CDS_pept        complement(347907..348281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5707"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bat:BAS3055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5707"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46663"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU2"
FT                   /protein_id="ABY46663.1"
FT                   /translation="MQGNQIRKNAARTVIHNDINNYPYLNIPMIINEKDGIIYEVLSAG
FT                   FHNNDAVAMITTDGFTTTRVNTPIVTVKNDDSSIQVFRLPLELDYWVLSCMRAASTGKN
FT                   PFPCKVAFGIIDTKCHVEFK"
FT   gene            complement(348324..348644)
FT                   /locus_tag="BcerKBAB4_5708"
FT   CDS_pept        complement(348324..348644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5708"
FT                   /product="YolD-like protein"
FT                   /note="PFAM: YolD-like protein; KEGG: bat:BAS3054
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5708"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46664"
FT                   /db_xref="InterPro:IPR014962"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU3"
FT                   /protein_id="ABY46664.1"
FT                   /translation="MNNANMQQGRGMVKWARFAGIREMIKEKNKVASPILTSEEKELIK
FT                   NMLLCSLLSEEEILITYYEGGYLLTNYMTIIDIDSLNNAIICTDAFYNKLTLQFSDILD
FT                   VK"
FT   gene            complement(348641..348889)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5709"
FT   gene            complement(349990..351117)
FT                   /locus_tag="BcerKBAB4_5710"
FT   CDS_pept        complement(349990..351117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5710"
FT                   /product="replication initiator A domain protein"
FT                   /note="PFAM: replication initiator A domain protein; KEGG:
FT                   ssp:SSPP204 replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5710"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46665"
FT                   /db_xref="InterPro:IPR010724"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU4"
FT                   /protein_id="ABY46665.1"
FT                   /translation="MLKKRINIKDIPNEEFYKLPKVFIWKKQYRENLSIGAKLLYMLIR
FT                   DRFNLSIYTTQISVDNGNDTPAFVDEKGDIYCILDNQEIEFSLNISNKTVTKFMEELIA
FT                   EELVSTESVDGGANRIYLNEPDPSGASLAHFLGEKEFYKHVKMRKKKKKEPLKTLEECI
FT                   ATAIDKYGVKKVDKKNSITREGKIPVPSDGKSTPLSEEKTPPLGEEKVHPNNIYSSYLD
FT                   LSEIYPNENDTNPNKSSKSKIDEEPIEELKNNIVLQKNNYALLNPILEQVGICPDLKAL
FT                   NVVKKILAEAGITTFHKVDVLNAIGKHAMNVKKYLSQGEVIEYEPAFFANNLVDRIREN
FT                   TLKRQNEVKKLKKIENQQTHETTFHFSSYNWLEVN"
FT   gene            351803..352237
FT                   /locus_tag="BcerKBAB4_5711"
FT   CDS_pept        351803..352237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5711"
FT                   /product="arsenate reductase and related"
FT                   /note="PFAM: arsenate reductase and related; KEGG:
FT                   sae:NWMN_0867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5711"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46666"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU5"
FT                   /protein_id="ABY46666.1"
FT                   /translation="MKSLNITIYTINSAEGERVAEKLAKYDLMVTNKHIVRDRFTFTEF
FT                   KALLALTDNGLDDLLTQRGSTIDFLTEQGIDLDDLTLREAYNVILQNPKLLKTTILTDW
FT                   NRIAFGLNGTKMFLPRHLRKQEQRKMYLKPEAQIEYEEAS"
FT   gene            352955..353419
FT                   /locus_tag="BcerKBAB4_5712"
FT   CDS_pept        352955..353419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5712"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5712"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46667"
FT                   /db_xref="GOA:A9VUU6"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU6"
FT                   /protein_id="ABY46667.1"
FT                   /translation="MTNILKEIYVNNELDVLVDTNTEVLEAAKLMKRLQSHISEFSYNL
FT                   KSSGMQEKEIVCGGQIQSIVNMNNLSDTASANIVYVTLNDGFGELLIVVPVTLWQKLSA
FT                   KKGDVVIASGKMFALKRDCKFKSRANTDIIVSHGFEPFRVLVREIKLLPE"
FT   gene            353634..353873
FT                   /locus_tag="BcerKBAB4_5713"
FT   CDS_pept        353634..353873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5713"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46668"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU7"
FT                   /protein_id="ABY46668.1"
FT                   /translation="MNRLATEELGPVEGSVLDAVPDVVVPHVSGFLVRGIIHCITLKTK
FT                   EDFLNTNKHLLTRVDFHIFEIADSERYINRVTNN"
FT   gene            353906..354700
FT                   /locus_tag="BcerKBAB4_5714"
FT   CDS_pept        353906..354700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5714"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:PF10_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5714"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46669"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU8"
FT                   /protein_id="ABY46669.1"
FT                   /translation="MQKTLAKEYIESVAKALLETSPREVIEFKTVLNAHPQGNETHAGI
FT                   NEVISRIFTDPLLTELLSIVGIESEEKTVQEPILASLLASQISTQQLSKQIREQVAKVD
FT                   MDSSVMIPYMKLEPKANLAAFIKEQAAFNKLVEDIKAQFEVNTKEDFAANIKDQVEQQR
FT                   PAKTTEGKIKSILDEVVNEIIEDGAASQTVCLDPSGIKVYEILFSSVFYKKANMLGFKE
FT                   SVEYKHEYTAYILSELATYLVEEEGFKLSFEVVEDKVVAGLA"
FT   gene            354924..355910
FT                   /locus_tag="BcerKBAB4_5715"
FT   CDS_pept        354924..355910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5715"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="KEGG: bat:BAS3490 prophage LambdaBa01,
FT                   N-acetylmuramoyl-L-alanine amidase, family 2; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SH3 type 3
FT                   domain protein; SMART: SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5715"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46670"
FT                   /db_xref="GOA:A9VUU9"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU9"
FT                   /protein_id="ABY46670.1"
FT                   /translation="MAIPVIQNLVAASKYPIKAPYSMNAEYITVHNTYNDAPAKNEINY
FT                   MVGNNNEVSFHFAVDDIEVIQGIPVNRNAWHCGDGSGNGNRKSIGVEICYSLSGGPRYE
FT                   KAESLAIKFVAQLLRERGWGIDRVRTHKSWTEIGVRNGNSRAVKNCPHRILDEGRWNSF
FT                   LAAVQAELTGTGATIAPPVTQPPSSDGIGVVEILVPELNVREFASFDSRVVKTVKKGEM
FT                   YQTWGLSNGLYNVGGNQWVSAGPAYVKFTPAGSSNGNPENLAGKRDPIGKITTTANLNV
FT                   RTQSSTDGDIIRTIPNGETWNIYDISGGWARVHDGWVSLAYANLTRY"
FT   gene            357113..357484
FT                   /locus_tag="BcerKBAB4_5716"
FT   CDS_pept        357113..357484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5716"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; nucleic acid binding OB-fold tRNA/helicase-type;
FT                   KEGG: amt:Amet_0033 single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5716"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46671"
FT                   /db_xref="GOA:A9VUV0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV0"
FT                   /protein_id="ABY46671.1"
FT                   /translation="MHQIITITGRLTRDPESNTYGEKTVCRFAVAVDDGYGDKKTTDFF
FT                   NVSVWGKMGEKVQRYQKKGSVVQVIGKMKSSKKDKTTYWELRANNIVFFTFDNNSNQQQ
FT                   NNFEMFTDDINISDDDLPF"
FT   gene            357515..357847
FT                   /locus_tag="BcerKBAB4_5717"
FT   CDS_pept        357515..357847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5717"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5717"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46672"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV1"
FT                   /protein_id="ABY46672.1"
FT                   /translation="MSDQRRLRSELKQGLHQFTMTLYNSYRQTLSHEKSVEQLSNCLIE
FT                   EYEYLTKQVMKQEKTFNLGSLVEKVEKRAKDEKDPVKQFELYEDVEILLRAQELVTKYE
FT                   TGKDNK"
FT   gene            358134..358274
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5718"
FT   gene            359188..359406
FT                   /locus_tag="BcerKBAB4_5719"
FT   CDS_pept        359188..359406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5719"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5719"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46673"
FT                   /db_xref="GOA:A9VUV2"
FT                   /db_xref="InterPro:IPR006479"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV2"
FT                   /protein_id="ABY46673.1"
FT                   /translation="MFKDILMDNKGALIRIIVFVLAWLNQYLTSKGYQPLPVLGEAEVA
FT                   AVVTFIASVLTLINDNKVTSKTKELKE"
FT   gene            360366..361085
FT                   /locus_tag="BcerKBAB4_5720"
FT   CDS_pept        360366..361085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5720"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46674"
FT                   /db_xref="GOA:A9VUV3"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV3"
FT                   /protein_id="ABY46674.1"
FT                   /translation="MNSANLGWFVLSQTILGIGSYAIMCAIFCLRFHRNITMISLLSFL
FT                   TSIINYSIYFNKQEGIGYLVPIIGMLITFLYLAAIEKLSIMWALVVTVAGGVIIPLIIQ
FT                   IMIIFASLGFFSPSELKEHIWRNYAMDITSGFSYALLAFVLYSQEWTFKFDFEKIRFKY
FT                   EKYIVIGISLVAAIVLPASMFMTHVKGTDLNLIFLTISSTLVFILLLIFSIRKERTEKQ
FT                   FDKTIKEVKTNAQKNDV"
FT   gene            361481..362068
FT                   /locus_tag="BcerKBAB4_5721"
FT   CDS_pept        361481..362068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5721"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46675"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV4"
FT                   /protein_id="ABY46675.1"
FT                   /translation="MSNKDKSNIFEKTFGELLENNKEENDAVIDQSRDKLEEVLLRAEG
FT                   KKILSHEDRGESTEGYISPSIKDEKLEEFVGEMPLPPINREQESRAVSIGLQEIREMKE
FT                   YMLYIHRYMINEFNRIYASFPILFAKDFEDKFGTAHKELATIMEDIERFIIGDIYNVEA
FT                   VKNDFKLVQTLEGKRLSILYDFLEYQNNKKLQ"
FT   gene            362131..362409
FT                   /locus_tag="BcerKBAB4_5722"
FT   CDS_pept        362131..362409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5722"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46676"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV5"
FT                   /protein_id="ABY46676.1"
FT                   /translation="MIFKVKQLLQILHRDEVVYMENKQIVSYNAQSRGHKTKGNTYKER
FT                   YVENTCPECQNPRAYKDEWKTRIKYTCLKRACRHQWFEKKEFPEVKE"
FT   gene            362534..363271
FT                   /locus_tag="BcerKBAB4_5723"
FT   CDS_pept        362534..363271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5723"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; KEGG: lmo:lmo2522
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5723"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46677"
FT                   /db_xref="GOA:A9VUV6"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV6"
FT                   /protein_id="ABY46677.1"
FT                   /translation="MKTKIKKGKIIQNCLKVTAATVVASGVGFQFYEIQELNKEVKSLE
FT                   KNHKQTVLELKTANEKNKVLEEQKKQIAANTEQLSIELEEIKNENEAINQGKHQSLEEN
FT                   QKLQAENADLAKQLREAKESARPVMPEKPSSDKSDPPTAKDTSVSRTIMGIGTAYTLNE
FT                   PGVTGITASGKTIQPGMIAMDRSVPMGTRVRITCDSYPYINGIYTVEDRGGAIKGNIVD
FT                   IYMTDADRMNDFGRRDIKIECLN"
FT   gene            363621..363921
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5724"
FT   gene            364877..365584
FT                   /locus_tag="BcerKBAB4_5725"
FT   CDS_pept        364877..365584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5725"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sae:NWMN_1328 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5725"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46678"
FT                   /db_xref="GOA:A9VUV7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV7"
FT                   /protein_id="ABY46678.1"
FT                   /translation="MYRLLLLEDEVEIGSTLEMILRSENYHIDWFTTGDEAVNAAVSND
FT                   YDLMILDVMLKKTVGELNTRISNGLEVARLVNQKKKIPYLLLTSRSEPLDIMQGLDMGA
FT                   EDYITKPYDLTVLLARIRTVLRRSCSNDISNGGITRCGNIEINLLTHKVIVEGKHVHLT
FT                   KQLFELLHYFIIHKGQIISKEELYKNIWGYDPSELQETNTLEVNIRRLRNSLDVDIIKT
FT                   VRGKGYVLEVSSC"
FT   gene            365559..367049
FT                   /locus_tag="BcerKBAB4_5726"
FT   CDS_pept        365559..367049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5726"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ppe:PEPE_0715
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5726"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46679"
FT                   /db_xref="GOA:A9VUV8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV8"
FT                   /protein_id="ABY46679.1"
FT                   /translation="MFLKSLVARRIKNNKLHMKIMAVAVIAVTLITIPIQLLFFVSVVL
FT                   KNGEEAFSHIKYRAIQIENEAWRIGGGDKIHQEFFDGILLKGEEIKVSSAAKNTEYTFY
FT                   IKQNEEAISSVDKYFSAFLIETLVKRHQKEINKLGNISIRNDETNGLYYMTYKHTFKHG
FT                   DNNETIIVKRNVTPIVIKLIEKYQKEFFIYLLYFIIAISIFIYFGLGLVFRFFGKALDK
FT                   SFVELKEKDYKARIDIKDSYGKEISNVQHQINGILEQMQNNIEVNIESMQDVSHEVNNK
FT                   LTSIKQSIDVLRFYGTNNKLIVEQKLKSIDDNIEQITKVMSTFLDLAKLDRGIYMDATK
FT                   SRDVKEMIENYLQYIKKVFPDFDFIGKYDVRSPSIHFSKEHFVLALNPIIENAVRYSLQ
FT                   SNEIVIHIRKGKYLNYVYIDIINWGIQIEKEEIPQLFNRYYRGKNIENSMKGFGMGLTI
FT                   SKKVMHLYKGKIHVKSYEDGKNIFTLIIPLHQESRGDT"
FT   gene            367049..368578
FT                   /locus_tag="BcerKBAB4_5727"
FT   CDS_pept        367049..368578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5727"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ser:SERP0988
FT                   sensor histidine kinase ArlS"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5727"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46680"
FT                   /db_xref="GOA:A9VUV9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV9"
FT                   /protein_id="ABY46680.1"
FT                   /translation="MGNKIRKFLNNFVKRDKLRVQVVLLTLILVLVSAIPVNLFSIYNE
FT                   LQLTTQREFESMFSRVEKIQDKIVLSGISASQELDSEFFKQISYPGESMKIRMGEQGAQ
FT                   DYHYAAEYEQNDKFGMFEAQILTLFVPTFFDSIKAHMKSLDATADKDSYSFYIDEKNKA
FT                   YGEILHSFKHKSHYDTIIIKKDITPNLKMQMVNSMENFLYMFIWFFFFSVVSVLVCLKF
FT                   IFKPLQSAMDSSFENVVDNNYQTRIEDPLYGEEISKIVHRFNAVLDRMHELVQNNLNSM
FT                   QDVSHEIKTYLTAIKQSVDVIKLYGKSDEKLVAEKLNAIEDNIIRATAIISTTLELARL
FT                   KQIPNIDSANYYDVKYLVNFLLRFKQETYPSFIFETDYDSEDVEIFIDRNHFFLMMSPI
FT                   LDNAVKYSMNSNIVKIDTISKRIDNMVYISIANTGVVIDQKEIPFLFDRYYRGKNLGNS
FT                   KQGSGLGLTIAKEVMDLYKGRITVHGTAAGVTSFILSFPKAIRREDSGNLS"
FT   gene            complement(368768..369037)
FT                   /locus_tag="BcerKBAB4_5728"
FT   CDS_pept        complement(368768..369037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5728"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5728"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46681"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW0"
FT                   /protein_id="ABY46681.1"
FT                   /translation="MKIYRGNIGVDLSLEEFSRLIVDEEKIDDLLNLIYTLEMDEIMNY
FT                   NRDDIQALEESLFQEIAEYQRKQNSNDTTAKMEYILAHLKKYER"
FT   gene            369686..370018
FT                   /locus_tag="BcerKBAB4_5729"
FT   CDS_pept        369686..370018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5729"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5729"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46682"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW1"
FT                   /protein_id="ABY46682.1"
FT                   /translation="MNKQEAIEIIKNSFYHLMFEENVKVGSINVLLYFPSIGIAVLEPN
FT                   KDRRHLLIEDNIEDMDELYIKKELKAKPIYLDLENDEFNIGFVINDILLEARFAPAENF
FT                   LESRGT"
FT   gene            370644..371078
FT                   /locus_tag="BcerKBAB4_5730"
FT   CDS_pept        370644..371078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5730"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46683"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW2"
FT                   /protein_id="ABY46683.1"
FT                   /translation="MREMRYGLSGYLAPDGIFYECDYGKHSELANELIEKYKIKNKTNY
FT                   NEIATRGEFLKFGTYPWSSKEGCSGCHVFKSLFHPLSNKQSIWINENLDKLTDKQRSEL
FT                   NRLLDQEELIRNKLAMESKKDVEKIQISYRVGTRLSAVGV"
FT   gene            371530..371881
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5731"
FT   gene            complement(371939..372376)
FT                   /locus_tag="BcerKBAB4_5732"
FT   CDS_pept        complement(371939..372376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5732"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5732"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46684"
FT                   /db_xref="GOA:A9VUW3"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW3"
FT                   /protein_id="ABY46684.1"
FT                   /translation="MTPDEIGIIEKIFVSITEGDKPFMVLFAIIMLFAIFMSIKVMGYV
FT                   RSVSDSHKDQMTSMNENMKEQREDHYKMIAEDRLRSDNRERELFVNLEKNTQQLEGIAT
FT                   TLKEVQFNFTSLENKVTQNFDYLEKEIESVKIKVSKKENYE"
FT   gene            complement(372909..373163)
FT                   /locus_tag="BcerKBAB4_5733"
FT   CDS_pept        complement(372909..373163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5733"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5733"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46685"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW4"
FT                   /protein_id="ABY46685.1"
FT                   /translation="MIEYIENDNSDKPQVNIYIGEDEWAKYSFQNKVRLLYRLKNSDNV
FT                   LAKELVKSISSLIEEEQKMSEIDYEATVKQCENMIEWFE"
FT   gene            complement(373167..373343)
FT                   /locus_tag="BcerKBAB4_5734"
FT   CDS_pept        complement(373167..373343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5734"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46686"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW5"
FT                   /protein_id="ABY46686.1"
FT                   /translation="MKSQRKKYEFSEKWVECLNCSQEYVIEYVIDERDTKGCPVCGSYA
FT                   HEDPASEYSNWSA"
FT   gene            373499..373957
FT                   /locus_tag="BcerKBAB4_5735"
FT   CDS_pept        373499..373957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5735"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46687"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW6"
FT                   /protein_id="ABY46687.1"
FT                   /translation="MNYMKKIDEAIELFKNLISATTNEAKSAVLATNQDNEIADKLLVL
FT                   LKNKTLYLPALTLLPSITKNDSNKRLRNYVSFVNAIDKLEGKKLNAYVFDYVLRHIDEE
FT                   ELKMYKAILTNADLVPVVKEPVDETVLEEKIQEEVTQVEKIQEDVESE"
FT   gene            374366..374649
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5736"
FT   gene            374646..374891
FT                   /locus_tag="BcerKBAB4_5737"
FT   CDS_pept        374646..374891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5737"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46688"
FT                   /db_xref="GOA:A9VUW7"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW7"
FT                   /protein_id="ABY46688.1"
FT                   /translation="MKKFIETLKKEIKEILDCCKKPLWKLRYFFYGWALGGAIGTTYFY
FT                   KIGEIDEYGVLLRITAAIILFILPLAYGEKNEVGSG"
FT   gene            375493..376014
FT                   /locus_tag="BcerKBAB4_5738"
FT   CDS_pept        375493..376014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5738"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5738"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46689"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW8"
FT                   /protein_id="ABY46689.1"
FT                   /translation="MIVGDIIVVSGKSLISKIIQKVAGSKWTHVALYIGGGYIIEIDWN
FT                   TKSSIVREKYSISNLECMVLRNKNALTKEQQDIIISTAVSYQRKGFRYDWLRLISLYLK
FT                   SKFPNNKLIDKLDRRNKFICTELVDEILKEAGIDLFPNQGGDIFPHDYLACEQLIALNK
FT                   VKWSSYKKAN"
FT   gene            376244..377140
FT                   /locus_tag="BcerKBAB4_5739"
FT   CDS_pept        376244..377140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5739"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: cbe:Cbei_3962 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5739"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46690"
FT                   /db_xref="GOA:A9VUW9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW9"
FT                   /protein_id="ABY46690.1"
FT                   /translation="MKFKIQSDVIDIQSVAPIQVIDWGVNLIQAPQMWSITKGEGIRVA
FT                   ILDTGIDATHPDLAANYKKGMNFTTNNFTDIMDRKGHGTHCAGIIAGCDNSIGIVGVAP
FT                   KAELYIAKVLADDGSGSVEAIVKGINWAISEQVDIISMSLGSSNDPGPVLQNAIKRAHE
FT                   TGIIIVAATGNENTHVGWPASYDEVIAVGAINRNLDRATFSNFGSETDVAAPGVDIYST
FT                   YPVNRYAKLSGTSMATPMVAGVIALILAYYRDIGKKLTPDQIMQLIREHSVDLGEKGVD
FT                   DMFGNGLVNVCELMKIS"
FT   gene            complement(377303..377732)
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5740"
FT   gene            378529..378786
FT                   /locus_tag="BcerKBAB4_5741"
FT   CDS_pept        378529..378786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5741"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46691"
FT                   /db_xref="InterPro:IPR025915"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX0"
FT                   /protein_id="ABY46691.1"
FT                   /translation="MEGLRYERFEQNLLDHWVKLKESAKVGLKTTVVCLQMNNGFEVVG
FT                   QSACMNPDEYDYELGVYYATKDALKRIADIVAYIEHEGTF"
FT   gene            379097..379576
FT                   /locus_tag="BcerKBAB4_5742"
FT   CDS_pept        379097..379576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5742"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46692"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX1"
FT                   /protein_id="ABY46692.1"
FT                   /translation="MATKEREIETYDTSSFLQKNRSKVAMGAVGGFAYGAKHLIQTQPV
FT                   QGLVKSEIFDEEKGIFKKAKKGSRMQFSGKKLGTAIGKGHYAVTATVLDVGRRIEGYDD
FT                   TEEIKGEQEFQLRKKMKKQREKNRNLYGNINQGEVVFNLFESRTGHHKMGNAKFN"
FT   gene            380203..380601
FT                   /locus_tag="BcerKBAB4_5743"
FT   CDS_pept        380203..380601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5743"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46693"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX2"
FT                   /protein_id="ABY46693.1"
FT                   /translation="MAILNSIKNFAKIGVLNTKKAVNGVKNAPNNIIKSTFIDTKNKKK
FT                   TLANLYTGKRINPKHFAVVGGGYLAFNQAKMSFEYQMEPLKRATMNDYQYIGSPEIMMY
FT                   DGVGQERVSKNLNVDGSIVFDLHNNRRG"
FT   gene            380607..381002
FT                   /locus_tag="BcerKBAB4_5744"
FT   CDS_pept        380607..381002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5744"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46694"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX3"
FT                   /protein_id="ABY46694.1"
FT                   /translation="MKVKSMIKTLTSPQAIFGYNVARGLHGGDSLGTSVAKASIKGVLS
FT                   ASNPVLFGVVTWGSLAQKGYWGLLEFNHQREQWWKAQYATSNVVGGNFLDTRGAQTMRQ
FT                   AAVQAIQGSKMNARSALGGEAKILSPY"
FT   gene            381046..382410
FT                   /locus_tag="BcerKBAB4_5745"
FT   CDS_pept        381046..382410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5745"
FT                   /product="replicative DNA helicase"
FT                   /note="SMART: Hedgehog/intein hint domain protein; KEGG:
FT                   msm:MSMEG_6892 replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5745"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46695"
FT                   /db_xref="GOA:A9VUX4"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX4"
FT                   /protein_id="ABY46695.1"
FT                   /translation="MSEIINLEREMLQIIHDPVQRGEHHLGGSPSWYQEQIIRQSHHRE
FT                   GLRYGERVGKCIEENQRIINSNTGEYKSIGELYQSQLDGIATPLLTLNEFYQLKNSKAF
FT                   SIEDNGVQDTFAVVTKHGARVTLTRNHPILTVDGWKEVDALCIGERIATPKFLTVYGTK
FT                   QVEKNKLRILAYMLAAGRLNKNSISFQIRYEGVGESLQKSCEAIGITTYHEHHKKATVY
FT                   LMDFRSFEFYREIEEKKIPSFIYELDRDHLAFFLGSLYSAGGWFCAGRISEIGYATKCR
FT                   KFALDLKHLLLRFGIQTNLLQKEMNGSVYYHLMVYHCSSILLFLEHLATPERNYEAVQQ
FT                   RALKMKPSEPTLPKEVWKYIEKERIVKGMTKAEVVGKGNRRYRTEKGISLSNAREYAEN
FT                   LQFAMLHYLIDSHVIWEEVVEIIPYGKRQTYDVFVPETHNLVVEDILVFSPCTNV"
FT   gene            383713..385068
FT                   /locus_tag="BcerKBAB4_5746"
FT   CDS_pept        383713..385068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5746"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5746"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46696"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX5"
FT                   /protein_id="ABY46696.1"
FT                   /translation="MDELLGKKVELDTELERSIIEYRPRVKYEPNKPFTVNLPTEEIIG
FT                   EDQKEFDEDGSFIPEEKPAKQYDKFVGTLELINELIEYIEKKMKGLQVPISIEELEKLY
FT                   ESQPFFEQDIGDEGFIDFETYQKTFENPEAPANSLIQDIVHSYAEDVEGSLELEFYEDL
FT                   KELHSIVEEGYFLFKETVLKNYLDGNIPKTPENNNGFTEQIEKAVKKQKQWFDQVTNLY
FT                   RNNESKYYDALRTQYGSPEFFKISDEYTKTKRPYDVVVRKEKTLNEVSSLIDGLLIGSQ
FT                   DCSESIKFGLAIGSEIDGEGVMNLLENQASTKEQLTGLLKLTQLSLKLQLNQQIEDKKQ
FT                   YRDVLKNINNLSRKKRAHDELLMALELRNTMYLNMYDSLQHLESPSKAPGVESFLNQMA
FT                   GGLSLVQEQYDSFLQDVYAMYMSEYEVRKEKIDKTLNKENARAGYSLVSEYL"
FT   gene            385541..387040
FT                   /locus_tag="BcerKBAB4_5747"
FT   CDS_pept        385541..387040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5747"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46697"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX6"
FT                   /protein_id="ABY46697.1"
FT                   /translation="MYTYNQLIFPSHMEKNTRFLVLAGFSLNGPVGTPFIIRDNIEPSY
FT                   ILGDCRLTENVSMAKKYGITPLILRLNGSHGECVVNHDELNTPAFRFKTLEATDESNNI
FT                   AIHLFPTYMIIKGINTSYSYLFADYKGVDDLAFAIKQDLYFGSGEVDVEVINQIPIKGL
FT                   CTSEKHVRFTGADDGFHYVSNHSNPDSEDKIQMQLQLLKDSFITEDGSEVFFTGELSSF
FT                   QVDTLLFTDIPYEKAPGQLSSIFGEFAKTKTTEQSIFCSVVLCSDLFSKSRYTVTGEDT
FT                   YETQVQLLVEKASINTEEHRHLEHIEVVVGIQNSENPKYSFMPVAANYACMRYKLPNFH
FT                   NSATNKQLLNINTLQNRELKKVEVAKLTSSGYICIVPSIKKGFVPYSSRNLYLQNKFYS
FT                   KPHYLRSIGYDVNRIAGFFNQYIGEPLSFVLLQSIITQVDAFIDSLAEDHPIYRDIKME
FT                   VLHYDQENLTLSISFELYGEIETVRTSFTYISSSEVSVSWQ"
FT   gene            387031..387669
FT                   /locus_tag="BcerKBAB4_5748"
FT   CDS_pept        387031..387669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5748"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5748"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46698"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX7"
FT                   /protein_id="ABY46698.1"
FT                   /translation="MAVEINKPTQANGSMDYEDMTKTIKHLLDAAWGTQWGSFTPEEPT
FT                   VTVDKPVEYPVIIHYLKLMQPGLIGKSIREIKPRQRYLAFNEDPKGTLPPATKVYGQVF
FT                   DAEIVFEIWEETNARVDKLTKEFRQTLATFTGFLKEKGLKELQFVKMETDLSKTNISNA
FT                   SKVRRLVYFAKFEELTEVPVDILRVIDVVEQKLQETTKTLRNKKIQLDE"
FT   gene            387716..389431
FT                   /locus_tag="BcerKBAB4_5749"
FT   CDS_pept        387716..389431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5749"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46699"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX8"
FT                   /protein_id="ABY46699.1"
FT                   /translation="MLYENLPGINVTLKDGGLIVPERGGSESILIIAPSLAKDAPEEPV
FT                   LIRSSTELVQAGFGDFYVAGEVNPIAAEWKAATDAGARMVYLVALKEISLERAAELEKN
FT                   AIDAYVAAGNQLVDAQAKFKDVLVGSTEAVRMRRKFIYFYDMLMSDLLDFTVDHVVLKG
FT                   VTLEDEATNLVGEFFTEVPNSEDFPYISGMVTSSYVIESHSINYPVEIKTGTSDTLVVK
FT                   VDGKDVTFTLPAKTYNGSSLTIADLVKDLKAVIDADATGIKVNVREDSGKIVLYFDAPA
FT                   SIQAGTTAAGLQLDKQVATWKKTSFGVIHRGSFAQTVADYCSMKTLMKSAAIGYIGVKS
FT                   PVDTKVSTIRKYVDELSKIDTEISPYLQVVGSEVGVIMPTTNSIHYVNGATHYAALLST
FT                   LRKESAPTNKPIKGVKAIRFDYSLRQLSKLTSKKIVTFRLKDSTQLVVTDGITTAPSIV
FT                   MAGKVRESDFARLSTLRITQLAIQVVREAVEPFIGEANEMPQYNAMNTAIKSALEKIRE
FT                   AGAIQGYKFSIENLGVYLDEVTVTLEIIPAFELRRVQVQVNLTPPEYMLQGLSK"
FT   gene            389502..389684
FT                   /locus_tag="BcerKBAB4_5750"
FT   CDS_pept        389502..389684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5750"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46700"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX9"
FT                   /protein_id="ABY46700.1"
FT                   /translation="MSTTASRYSKTFTTYGGSDIVCTFNGQVVGQLQAITYSVTREKGP
FT                   VYVMGDPNPKSFSRG"
FT   gene            390311..390730
FT                   /pseudo
FT                   /locus_tag="BcerKBAB4_5751"
FT   gene            390836..391333
FT                   /locus_tag="BcerKBAB4_5752"
FT   CDS_pept        390836..391333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5752"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5752"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46701"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY0"
FT                   /protein_id="ABY46701.1"
FT                   /translation="MSSRYQKTYTSFAGTDIVAVVTPEGGKSVVLGQLQTISYSVYRPT
FT                   APVFALGQIAAKGVVRGARTVAGSLIFTVFDRHVLYEIMKDHNANGNSCPINKSDELPP
FT                   FDITINFMNEYGQSSKLAIYGINLISEGQTMSVEDMITENTMEFIALDIETMKPDVFDE
FT                   GW"
FT   gene            391339..392055
FT                   /locus_tag="BcerKBAB4_5753"
FT   CDS_pept        391339..392055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5753"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5753"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46702"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY1"
FT                   /protein_id="ABY46702.1"
FT                   /translation="MSDGAYTPAGKPKRGYANYYSGTDIRIYFGDNWIDEIVEIEWTMQ
FT                   EQLAPIYGYASYTWDKVARGNRLVQGSFSINFKEAGYLQTVLNSLSSEMKDENEWFSLA
FT                   EFNGENGQSAHKNTKVEDLIGNFQALADDYENALWGTNSNSSKLIDSRKTDTFFYSTNE
FT                   NEKNKNLKEHGFNILLTYGNNPCAVRGAGSYKTVQTIVGVQLTGVSQRVDPSGNPISEV
FT                   YTFIAKDISGNVQKAY"
FT   gene            392135..392578
FT                   /locus_tag="BcerKBAB4_5754"
FT   CDS_pept        392135..392578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5754"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46703"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY2"
FT                   /protein_id="ABY46703.1"
FT                   /translation="MAKRFEKEEAFTENAQEETSVVKVGDKFDEDDVSKAEQEIFPGGP
FT                   TYNELEKWKSMYAGEVYLTEFDEENIFVWRPIKRKEYKDIAKIPNADNFYKEERICEKA
FT                   VLFPANYGFMQMTNGKAGIPTLLHELVLEKSGFAAKTGAMRLS"
FT   gene            392632..393201
FT                   /locus_tag="BcerKBAB4_5755"
FT   CDS_pept        392632..393201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5755"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46704"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY3"
FT                   /protein_id="ABY46704.1"
FT                   /translation="MLIDPNLLDDKVKELPIEFETYEEEVDFKEQLRIWHEKHGHIFMQ
FT                   EISDVLFFFRALSKEELKIAQEVYNDDYERTEYICKTCVIEPIIEDYSLDIFAGVPEIL
FT                   CLSILEESGYTKAQKVKIMIARWEKYMEETENQLPLIIKEAFQDIPLSEIESWTMAKTA
FT                   EYYVKAKWLLENIRGLKLLSEEEVQQ"
FT   gene            393225..397577
FT                   /locus_tag="BcerKBAB4_5756"
FT   CDS_pept        393225..397577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5756"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5756"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46705"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY4"
FT                   /protein_id="ABY46705.1"
FT                   /translation="MADKRYMGEEKEKNHLLSNIAKTGSLKGGGVMAYRNFSMIGKSDA
FT                   LGETAYVSRKLRGGFDGNIQEKMYKKLENYVRRNIKKKQMLKNHLAQNNIEFVNRYYKE
FT                   FHKRNMWGFNKFEYAATQSFRQNKILENLLKLSSIKNNGGDKILNALIQYHNQNKGIFN
FT                   SPADYINDFIKQLENGKYAPKVKFLDDTQRNVFQKQMLQTLEWYQDIKKVFEENKGTIL
FT                   SQAKAMETASTYEFIQDAINQTDVLMTRLKKTGFNYTTLKDAEKLDTATKRKYGLIIDD
FT                   IDEKGNEKSIDVTGELRKFLDNNKHNDDLNALLGKKGISFVFENMILDSNLYTHAKTGE
FT                   IIDNRHLKAGAVRAIDSFQKSIKVPFFINSPMDLKSWQAFYSSLSKEELQVVASEQFHR
FT                   FVSNLDEKGFDSVTKTNQGGYIRNPLNNSDHFYTGGNVFPYTESGVRDLINEGSYLASS
FT                   QFGTFSRMDKSYARSGYKKELTGRDASQLYEDTSVKELGKGTWKYINLSEGFISLREAA
FT                   VDKSLPTLMEFMIPTFGEDVVRIPAIEKLRRSFHQFALRVLDNEASFFTQDVVKKDARN
FT                   KRILSELDIKNMKGLDTLTEFQGYDNIHTIDARPREAKILLEDVMNNDKGKAEKEIVSD
FT                   FNINNLKNYGAIDNGWDLAINTKMNASNAASTLVEQELAVSKDRLVGRHTYRDALANVK
FT                   NSTQDIEDIGRIDELSDFLKEEFYTASKLGNIYGFLTKTGVEYEDSWRGKTLVSSILRT
FT                   YPRHDFLVANHGSALPGIGRRYVSRGLNKVYYSPIRNKMSDCLTSIIGESTDLLLSDQI
FT                   QKNEIKLLGKVYETLVKHYSDGIGSDEFVNDGMFNRFPILAETNPNSGQYKVAKHQIPL
FT                   LRQSGGFTENMDKEFDEITKLIHDNQDTYYWYDKKFSNADIQEKSGTGSKIIDANTFMV
FT                   REFDTPVKLTQKDNRDVIYWMEQYFKLGEKDKIGFTRDLVARKNNNTYGSMDAVVYTNR
FT                   SEDGHFGFKTNKGQSFNALIGNRIWKNPFQISDDGSSTSTKAFNLNNMVAVGKYSEMLT
FT                   HDIVPKMPFAGILDDKFLQERTTIESYKRDQVYDSDWGPWPQPYEGWINTMINTVVSQN
FT                   PIITGEEMKAIGAGRILSRLGNVAVPQVREGEREINQHFDRLSYVKYYDLYEKSSKLAQ
FT                   SKEGESVEEFFDDAAGRGRNNIGLKRYLTDKKKTLSWAKKMGYGDTEAVKSKIDEFSDG
FT                   LGDISSTKEANQASKYIPLAIKYRQKYEGTLYSMGDTEDSGSTSLMRALKPKGKKYVPQ
FT                   FFETTSSKEGQEILQYVSEDTKEISQDSWGLRVDKQEDIEDYFNTHYLPTENWNGWNAS
FT                   TNLDDIKIKVMQKKGVNPTTSGYWSKDQARVEKTGEKEIQIHPLSSLINIGRLRDVLLG
FT                   MGLSDVDVQLTTSYGEGPGGINTSIDIMKNVKNEILDGFNAGVHSSLF"
FT   gene            397638..403889
FT                   /locus_tag="BcerKBAB4_5757"
FT   CDS_pept        397638..403889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5757"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46706"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY5"
FT                   /protein_id="ABY46706.1"
FT                   /translation="MEDIKRVPIKNRVLRPINESADDLGEIRTENQTEHAAAEYRQSVL
FT                   AQTYNELTKDNRISTLGIWELARTPNNFNVNAQQALDPFMKLKGDDHVLFFDIEAIGTP
FT                   EHMRSNKGLDLFAMTELSFSGTNFNGKDFVNKKGAIVSMAVAPEKDVYARLKQQINKLK
FT                   QNPMMSVSQDVHCTLLDLTKYTDASKFKSATSNGKSYMSLLGHSRVPSIDTAFTRNTIE
FT                   EIERGLNNLFYKGTKLEDALSIFQGHIMSSNAKLGGYNIHHYDLPAILGIVKDTSTKKF
FT                   FNDAAKNSLDFFHGYSATVKNPYSLTGASLRQEHIYQALLAKRKIKAGKEAIDGNPPLF
FT                   LYHLAKDDIQANIDIAGFTHQKIKSFIKGAEESPTYDFSSSAIKKNTLELGQELFSYQS
FT                   SYFDKDKYKYNLVGKLGKDGKSIVPRWGNLNTSLPSNENFVIREFLKDVALTGTDKKGF
FT                   GLRLDSKDVKGKILLLMSETQEGLAQQIHSSFMPMDDAISRNLRDLKVKHDASFREYER
FT                   MFDNNGWEKMKEYYNYLEKAGSVEEDFDWRSYIIKNGGTEELAMKFPYMVARLEGERDV
FT                   WGTAISTLKASGLSDKQKSIALRQIKSKLDEKGDNKAQVTAKGNRFLNFNFDKEYNTIF
FT                   NAKETNSIKDSFRSYINDRRGDRIGNLEKSYKLARIDELQELIINNFKLSPDRKASNDV
FT                   KYLVNQMKKEVMSGNKTEIALNEMSNLVREKVENMGTDNFVREVTNQMTDSRVTAIKGL
FT                   MKNLPNVMRESIENARSFRSANEILNGNSPLKKFLKEQDNRIKKLFEKKFGTHGMNDLD
FT                   IISRTSGMAAKYEELVDKIMSAYSKYFNTQIRFMDGGNPLLILASKKSIMNLSEVRTYE
FT                   ELVRNPRVFTIELPSFDKDMKVKYGGNRKTSVIRSGIGAKGAYHSTSVTDALNMILDYS
FT                   KKAKELSEIAESIDSKNAFVQIRQGLRYRVERQVDPVSTDASRKFYFDDKGMFDIKSAM
FT                   SDEVRSSKWDITGYAESWYRANSNRLGFSISADIIAQNAIEKGITFFEAMGQRAKGYAI
FT                   AGELLNFAKGASGLKGSMVGINTRSAAKGFVATTNTDTRTYRALGNYYAHTVENPNEPI
FT                   NYRKVDQEVASRVLRNSGKDQSFRTKNSFISSPAFKALDDANEVRGITMQTGYMTNEEI
FT                   ALKLNDANTIMKYKSMIDTAQSKKQITPVEASQMKGSLDKCMISTSEGLAFMDYKLMKA
FT                   FDGMDEVRINMNAEKVMFNNYIEIAIEKEAEKQGLANGLWKEKGITFDKPLEIDINSMF
FT                   NEKNHLTLGKYEINNIKNEIVDERRFKKDDTVSIIGFNTDDINKRSLVLGRQRKTGHGF
FT                   KVVTEGGFHATMTPMLGDIMSDLFGVEGVEQVISYQVEKKGATDLPALIRGYDTQIRQQ
FT                   FSGSVANNKITTDYATEERALSSFYKDVEQMLGIKTTNKDGQYVVDSNFGLDGKQLDYK
FT                   GREKLSSKWMDKLGFNREVFADITMAHEAWDRQGGISRDKVTVKEIGMLDNSDIRTGLY
FT                   GPGESSIYANFMHGMVYRSQTKPEIKAQQKVFKKMVKIVSNYENDWEPKTGDVVIDYTS
FT                   DGTGLMADVNAQMKDGVLHISKDSFEERPRKFGHNQTFTVEDYGKTVINAGLMEFNLES
FT                   GVKGKKIQEHLLSTKGTAYLKLPEFAANQYIPLLDINSMKLPGNVNYVEKTEFLDTLKG
FT                   NYTSIVRKTEEYNDLFTIDKFSASDIATRRGVLETEINREVSHLVANLSNSTSKEGVVE
FT                   RISGNFSRDNLSVFFPHYGINEEKQRNAVMNDITRLHVSDKANNKLAGDVITASEAFFS
FT                   ENSAENLTLGNLYGAKAYEKIRESLKGTGVNNDWGTVKNGELRIGKSEHEKSILASTTS
FT                   STISSVNNTRMRTSAAFMMMAETKKEPFNETEGSSQNAEEVMDNRRAVGPEIFLNEAVP
FT                   IHHTMRNEMNESLSDIATVGKKAFSGSAISLTGDGPIGFGELWATNALMKGTPTPEGLQ
FT                   EMAPVAPKTLGPPTARITPNQNGEYINISVKASASKRMNHNNLAAMINNEIMTMSNVKM
FT                   NTSVNVNDNSKKIDSKWLESAIANAMNKGYAY"
FT   gene            403957..411324
FT                   /locus_tag="BcerKBAB4_5758"
FT   CDS_pept        403957..411324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5758"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5758"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46707"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY6"
FT                   /protein_id="ABY46707.1"
FT                   /translation="MKEKILITSLTRVRKNAPWRVGIYINEGYTFINVGDKGNIATSPR
FT                   FNIFLSEVEKKVSRYPVDVSFYSIEDNREMEVTMMRDQIIYIDCGYNSHRLLSSARFYY
FT                   EKHVLSNPLELAQQKPEENNGLFNVMEKHEESITSSDYIAVGRVEKVTDGDTIDVNLIK
FT                   LSDYLSKHFKVNQTVTIRYNGVDTPEKAQLGAEKYKDPKNAKFGKTYGVTMQDMYTIGE
FT                   EAYKYNETILGGSASQKPLVIIHFDRNKSGDPPKQDAGYGRYIADIYATNEKSADIVFD
FT                   KVKDGTKFVHVNKSLLVKKSAKFPQIPLGLFPFGYANTATVLNPLNWIIELGLKAYDTG
FT                   TGSPSKDPNSDPDIGSPEPYDENINEQEINIGGTTGPTHNALDFFGPYDDRLSVFTNGI
FT                   KTIDDLKRHSKVRIGDVILTIPPISIEVNKTANISKIKTLRTKSSVLVNRGQSLTTLSM
FT                   DLYFHDIESINGKKYPWKKEYAKGEEAKHFYVDGLRPLLAQFAKAPFLPIDNYYINDVL
FT                   GIRDVALMNIEVTTVPNFPESLTAKLTLVEFNSEAYLMDKSTLGDSINYPMLRWYYNQS
FT                   LAGRGDKYRFFKGLEGPIKSDIKFTLADETFLATRKHAIDYMKNADSPEQRKVELETKN
FT                   TDYKNRKEDASVVKEILDQYYRYKDFDIKKHTIIDYFSKPGLDKASTSIQGLIRDKYKI
FT                   KKEEAENAIVEAGELFSNIYDNKYKDVNTILMHKEIFLPYESRLFYKIRFDWNFLESFN
FT                   NRYDEDPSVVYDKKQYQGKEKDGLIILKKLKDAGSQKILENKFKEFYEKETFRIPANDT
FT                   AIDALKKIAEGAKKMEEEVAKYKGEFDEYMKVIEASERMIPMKEYPISGKVIPISINAR
FT                   FSNEFSMAHVLSSEAASLQYMGGGDPYIDLILEVDESGARDFNNLISTSDYYAKTYNQG
FT                   ITNGYIGIENDLAQLFGIRYVMFESISVNTVPSFPGRYQIMLQGIAFDKTQRQREELTA
FT                   LPGNSKQMDLETLKNNKTAFANDRMIEARLHKLEVYPDMELPTYSQINDVLPEIDAGAK
FT                   EYPNLTGGTYLDPDFYFSTGNTLRQLIESSYQGNHQVNMFDATGVAAYTSNMSTDKLFD
FT                   TTEEDWEKLKALQETEGVEPIGWVFKWGQEQEAAKSDTPNTSAGPVMADQGGTASVKNA
FT                   DVQKFLTEKKDDEFAYETFPTMEEWKTLFPDGGNDYSTLAKDPSGDEALIYQEIDSLVD
FT                   KYFKKYYSFPDFIEECRGDLKDADKSKKLVSYQPAEDLYYASFNANRNKLHDANIGMVS
FT                   DLIKKGTIKEPKKTDRMDSKDFHKTEVKITKERFMTLMKAFLDKTSQWKHFKGKIPTVS
FT                   KAGRVGIAQVDVSSGDMKVDEVKRLMYNWRYNLQTAVKQLAEHYEKLNKLDKDCENFEV
FT                   ICRPWDGMFALYEKPDAKIKFAKDIEDNSFASGVISRFNHYATKPFNTFSGYNKDVYKG
FT                   KANLSMDEYITIGNGNKDDYVDKLLELEYYDLSVLKENKLKVDSDKKNIKKVMKEHLEK
FT                   MDKDELFSTYQKHLKFLYELSKQDSKIEKTVDFFGKWSLPNLVTWGKAGKMVDKATDVI
FT                   AGSKKDKNGYEYSRKIFEKAAKLYESIIDVDKTATASTESTDTRLYNDVDPRVLYEEMF
FT                   YDLRYHDQRGRMLRAFPGFQMFIIHEGDYFGKYKFWDNMYGFNAIQSIDVHRSRKIAAD
FT                   TAVISMTNVYSNLTTRRTDVDYADREMKWWDNYIWNEIPQDLIDKKENEIHKNLFLETG
FT                   ARIHLRMGYGATASDLPIVFNGTISELELGDVIEIVAQGDGIELGNVVSGDPEDTNDGL
FT                   FQVTEPRDLICSLMSSKGSWAKDFMNGVVDERLFKDNPLGIMHFGQPFDSNGSIDSKPL
FT                   GNLVWFNDNYGEVAQNIYSSNGTPTFSQWLHPNGERNNIFEDFSWKRLWDNKFKIFNPG
FT                   DEDNVVLKLYNNTVWDIIQSITYSTPDYIAAVHPFELRSTLFFGKPYWRCAFEYGSRYE
FT                   FEAADKTWKRYLTSQPKRPYMQNKFYMSAYDIIENNIKASEDNIFTNVIVNYDGKQTPV
FT                   LYADADIRYDKQKTRVVEADIVAKFGDFYTSEVMATHFGHSTLRDSMKDMYKGNLLVLG
FT                   DPTAKPHDMMYINDEINDLQGNALIKSVTHHFSMETGFITSIEPDLLVVNDDQVILEMS
FT                   KWYMSFGQSVAATLAIRAAANKAGRNMTKWITKSNSIPAKVGKWVSTKGLRHTVRMANS
FT                   DGDMDKILKTLDDIISKEDGDVKALQQKLAKDFEEAAQKVTKEVGEEAGKAAGKAAGKT
FT                   AGKTAFIKNTSKQALLKSGAAFAKVLSNSDDIAKIGKGAVGIIRGAASFTPVGLIVNAS
FT                   IWIGTEMLFEHYRRFKENLQCVVAMPLTYRGKELTAGINNHAGMIYGDAPGRYDVMFNA
FT                   KFGDDNGEDFFGSSLIKLANFFTGSGGEDGVYAKTEKARQLNELSKKQQQ"
FT   gene            411420..413507
FT                   /locus_tag="BcerKBAB4_5759"
FT   CDS_pept        411420..413507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5759"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   Lytic transglycosylase catalytic; KEGG: noc:Noc_1884
FT                   peptidase C14, caspase catalytic subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5759"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46708"
FT                   /db_xref="GOA:A9VUY7"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY7"
FT                   /protein_id="ABY46708.1"
FT                   /translation="MTEKEKPKDKPKTNDKQTYNIETYVKKIKAAKEVYEERKKFLQSF
FT                   SLKKKKEKPKADGGEVAAASGGGSVNFNGELPTVAQYTGPDVYTDKLLNGGVYQNGLKG
FT                   KVAGTDQWNQHIKEQAAKAGVNPLMIKVIMATESGGDHVKTPNSSNCVGLMQTEKEITG
FT                   NLGLDFGKACNDPVYNIYVGCMILKSKHDYAGGVISRGKNPYSDYKSLGYELKQNGHGV
FT                   AWLYNGFSVPLDGKNKVYRGGYVYANQVTAMYKGFGRDAYTDTILTLDVLSGGGGGGGS
FT                   SSSAGGKGTGGKWEYGKTFASGAEVVKFLDTVDTTTINGIYVHHTWDPDHTKAKGVSLA
FT                   TLNDNMRRFHTQTNGWDDIAQHFTIGVDGQVILGRNITSVPCSAKNYNGTDANHPAMYE
FT                   MIGNFDKGKDVLQGKQLESAVAIAKYFSGRPNGVKFHREGLINGQEPKSCPGTGVDKNW
FT                   FMGLVNGGAKASAFSVQSAPLSDNEIEENFAAGCDLYQDPVREKAVEYTAKLPPTGEEL
FT                   AFARSFSAKISIPVAKLKESRIVAPEYTRSSYVEDFKMSSSYDMKKNYSPLSPNEFIHL
FT                   NGPQDNFYTSEARQAFRLLKDRLGYRTLRIARGFDPSDGESSHSIGISMDIYADSTEEA
FT                   VYIADTAWIIGFRSIAVGPNFVHVDIGPEAVWGYDKLPIYRGPGTLKAGAFRYGYKQAN
FT                   L"
FT   gene            413482..414813
FT                   /locus_tag="BcerKBAB4_5760"
FT   CDS_pept        413482..414813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5760"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: sen:SACE_6672
FT                   metalloendopeptidase-like membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5760"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY8"
FT                   /protein_id="ABY46709.1"
FT                   /translation="MATNKQTFNIEVYKRKIKAGKEEYAKRKEFLAKFNLPKLNDDEEE
FT                   VEEKPSDDSKKTEDQGNAVKEPDGGVGNFTGSGELSVPAEPKSYRFTSVMGARWGTTHN
FT                   GVDLAPNTPGDTNCKILSAGDGVVLQARSGVGGFGTWIVIKHKDDLYTIYGHMHPSTLK
FT                   VKSGDAVKRGQHIANMGMQGESTGVHLHFEVCTDFVNNRRGTTKNPEDYVNVRASASKI
FT                   EVNSFAPQAKFSAKADTKEEGNEKTMHPHYDNDGAELSEEEKLIDQTYRSSFPYLPVQF
FT                   IGDSIKKNDITREFFLLNRVGWARTTKYEKMVSLHKERFIHSEKYDGHEGNLYSPDAKR
FT                   LFESLLLKTQKPYFEVISGFRFSNDGQLSPHEAGCAIDILVKSIDEVREIADCAWLLGV
FT                   RSIAIGGDFENNKGFIHLDIAPKGKDFMYDGVPIYGGPGKWVTQ"
FT   gene            414810..415175
FT                   /locus_tag="BcerKBAB4_5761"
FT   CDS_pept        414810..415175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5761"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5761"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46710"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY9"
FT                   /protein_id="ABY46710.1"
FT                   /translation="MNFNSQIHQSIYSKVVVPSLNRLQGTIEGYVIQVDYTKLTCEVVY
FT                   SDENSHALRTMKNVSLPKDGDGVFTQAVKNGDRVSISFKNKSKESPYISTVYKSNHSEE
FT                   NYMSPYGGRTIRQSRIF"
FT   gene            415190..415759
FT                   /locus_tag="BcerKBAB4_5762"
FT   CDS_pept        415190..415759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5762"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5762"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46711"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ0"
FT                   /protein_id="ABY46711.1"
FT                   /translation="MNEAYVNKTYGDGDKDIHYPYWRQVLQSELVNFKAKSLEKELENW
FT                   QFISEDEIALKHPVTGSTFKLCDDGSIEMFVNEDTGIRLDTKENGIIFYGDSIHFATKE
FT                   MRMHTKPYGFIWNNHNLNPYLYYGDKVGEERNIPKASMVSTLQDGQANINVPLFQEQKR
FT                   KHYYDQKVTSMIEDLGIETSRIKRGG"
FT   gene            415763..416251
FT                   /locus_tag="BcerKBAB4_5763"
FT   CDS_pept        415763..416251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5763"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46712"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ1"
FT                   /protein_id="ABY46712.1"
FT                   /translation="MKVDFRFSPEGDLELGSPSYNDFDELLYVDSVGNISTDSSEGLLI
FT                   RDIPLQVSYLSEKQVILNRLRTDNPDWFIHKDIGADLSELIGLPNTRETGELGKTLIEK
FT                   SLTDDKFILPADLDVRPVPVSSSEILFYITVKRKVTDLVMPVLFNLEHGLLSEYEVNS"
FT   gene            416251..417051
FT                   /locus_tag="BcerKBAB4_5764"
FT   CDS_pept        416251..417051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5764"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5764"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46713"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ2"
FT                   /protein_id="ABY46713.1"
FT                   /translation="MRKSKDEMLEDVLTRLRTDGGITETSPGSIARMFSEVMIDEFSPF
FT                   YDELELIIQMGFVSTSTGGYLDLIGELLNCTRDGDESDDNYRARISNQVSVEQNANLIA
FT                   IRLKTLRIDGVADAQFKRFTRGTGSFTCYVTPQVYPIENDLLTRVESIIDEVAAYGMNV
FT                   EVKTSEYNPVDITLNLIFHSKTTSLERQHIRNKVIQNVGAYMKQLNMGSPIIINEIIQR
FT                   VMETSEQILDMEFKKLVVNEKEYFIKNVEPSLEERYFLRKINVA"
XX
SQ   Sequence 417054 BP; 140889 A; 66922 C; 73481 G; 135762 T; 0 other;
     gcaggtgaca ctattgttaa acaaacatac aacaagtatg atgtccatgc ttccgcaatg        60
     gatgaagatg gccaaagatc caaaatcagt aggggccttg tttttagatg catttggtgt       120
     tgaattatca gagattgaac gatacataga gcaagcttgg aacgacatgt acattggtac       180
     aacaaactta caaaaggccg attactgtta taagattccg cttgctactc gtgatgttgt       240
     agatattgag acactagatc tccacgttcg tttagttatc gacggtgtac gaagagactg       300
     tatgccggct gatactttac gactattttt tgagagtgat gacaactcct acatgattga       360
     tactatcgaa ggttatgtat atatcaaagt aatggattac tatatgaaag ataatatctt       420
     caaaccattc gatgcaattg aagtagggga cacccttcac tatgaatata tgcttcatca       480
     tatctggaat gtatttgatg agttcggtat gttactaggt atttctagat taccaggtga       540
     aagaaacgga gactttaaga atcgtatctt agatgttttt aagaatcctg gcggagcaac       600
     aaagcaagga ttaatcaatg gtattagtag agaactaggt attgataaat cggaagttaa       660
     attaggctca ctatctgatg ataagtatgt tcaaacaaaa cttatgaata cagatggtac       720
     accttccgaa acatatatcc aatacgtaaa tcagattaat agcaatctag gtttttcttg       780
     ggatcatatg aactggggag aagcttattg gagaagtatt gaagagaata atatggggtt       840
     ccattatcta cctcatattt gggatggttt ctctgcttca tggaaagaca acgaagtaca       900
     atcaggtatt ggtagcggag atgacttatt agtaaccgca ccgaaagaag agtctcccgt       960
     tcgtgagttt aagacttatg ttggcttaca tggtacagaa gaacaaatag aagagaatca      1020
     cccagaaata caattcaaat acaagatagt ggcgaaaggg aaaataccta atgatgaata      1080
     cgaattggaa gattacaagt atacagtaat gtcttcagaa attattccac tacattacgt      1140
     attagtcgct ttacgtgagt tcttatatca aactcacatc acttgggata atcgctatgg      1200
     atacactttt agtgataata catctcctgg tatggaagtt gttacaggtg aagatgttct      1260
     tcacaataac gaagaacccc aaattaaaat tcatgtagac atgaaaactg cggatagaac      1320
     agtgacacct gttttagaag agcttatagt ggactggatc gatcagaatg atgcacctca      1380
     gtcttacaaa ttaacaactg atgaagattt taccttaaac aatacaagga ctcaaacaac      1440
     gttagccgat gtagaagtag gtaacggttc tgtaactctt ggtagaggtt cattctctgc      1500
     tgttattgat acagagggtt cattcttaag aggatcacaa ggtatatccg taagagttaa      1560
     cagagaaggt tctttatctc ttaacctacc aaactaacaa ggagtggata aataatggct      1620
     gaaactggat cagtacaaaa tgcagttggg aataatattt atcccgattt agttcttact      1680
     cgtttccctg aattattcga tgagcgtagt ggttctaaat caaaccccaa cttgcaacga      1740
     tggacaaacc ttaaagatta caacatggct gaacatgtaa actccctgca agatgctacg      1800
     atggcaatac agcgtatgct aggagaatta gctcaaatgc cagctgcacc aaaggatgca      1860
     aatggaaaac ctattacaga cccaaatgtg ctactaaacc ttaaacgaac ttctacagtt      1920
     aagtctcgta tagacgcact tgagactcat gactggtatg ctgagttcga taagcgatac      1980
     ggtggaccag tatggaaatt tgataaggat aaacctacaa atcctacgat tcaacaacac      2040
     cgtcacttag gtagtgcttc agggattcct ggtatgccag agaagattgt tcttacagaa      2100
     gaagtacaag gtaagcttcc aaaggcaaat gttgatttaa caaagactgc tacaggaatt      2160
     actggttcgg atatctatgt agaatcaact tcaaacacta aagtatccga tgcaattaat      2220
     gacaaaatct ccgaaacaac aggtggaaca attgcacaaa atgcagaatt agaagtgtta      2280
     ggaaaaacaa acactcgatg gacaagagaa tttgattcta atgatgcttc ttcaactggc      2340
     aacactgcag ttgctgacgg aaaaacgtta ctaaacaaag caattgagag tggtgctact      2400
     gctgcctcag acctattaaa tgctccatta gatggaatgc attatggtcg ttatgttgcg      2460
     attgtgagat tatccgcaag cagtcttcct tctaatgggc ttgttgagat ttcagcagtc      2520
     aactcaaaga caaaccaagt tattaacaaa actactttaa acggaacaga cttcgataca      2580
     agtggacaat ataaaacatt ctacttgatc ttcaatcatg atggttctac aaaaatacgt      2640
     gttcgaaaac tagctacaac ttcttctgta aaagttcgtt tcgattatgc gattgttgaa      2700
     ccagttcacc cagcggtatt tgatcgctaa gaaaggatgt tatataaatg gcaaaacgac      2760
     cagaagggtt atctcctaat tttaactcca tcgtttctcc agacgttcct tcctcattca      2820
     ttttttcatg gacattcatt aaagaaaact ctagtgatta tcagaaagat gcagaagtaa      2880
     aggtatataa gacgggctct aacacagccc ttattacctt ctcttcagga acagataacc      2940
     aagtagatat aacttctcac cagggtgttc ttgacccaga gcagaattat gaatgggaag      3000
     taaaagtaac agctgctaat aactcgactg cttttagtgg aagaaaaaga tttaaattcg      3060
     gaaatatatt tctacaagat ggtcttgtgt ggccagatgg accagatgcg tacgaataca      3120
     ttggaacccg caagtacttt aatgagatta aagaaaatgc tgcctcagta cttgaagatt      3180
     acgtaataga ttctagagaa gaaaacgatg cattagaaaa agctttggct ttatttactc      3240
     gtgaaactgt tcctagtcgt accgattttg aaaacctcga aagtatccta tggttaatcg      3300
     caaaaaaaga aagtacctat caagatgaaa tccagagact cattgaagat ggtctagggg      3360
     ctcaagatat tcataagata tatacacttt ttgaccgtct tgttaagatc ccaccaaaag      3420
     aaccaagcaa tgtgtattta agctttggtg gctttgagaa gctttacgta aaagaaggaa      3480
     aagcatacaa caatggcaag gaagacttat ctgttgatat caactggaag ccctcagatc      3540
     ttaaatcagg tacgtgtacg attaacttct tgaatgaatt gacagaggat gtttcgtatt      3600
     acagggttga actagaggtt ggtttcactg atgaagcttg tactcataca ttactttatc      3660
     gggtagaaga tatagattcg ttaggaagaa aaattgatat cccaatggat cacatcagct      3720
     ttgtacatct ttcttcttca aaagaaacgc gttacgtact tagagtttat gcagtagata      3780
     aaagacgaaa acagtcaacc aattattata aaccatataa cgtaaataac gttcctcttg      3840
     gtgtagcaag ttacaatctg cgtgttcaac agaacgactt gtcaaatcaa tgggctatcc      3900
     agtattacca tgatatttac aatggcccga atacagctta tgttcataat gtaacaggga      3960
     atgtagatgg tatttaccat tacgctgttc gtgtatttga tataaacgga agcgttagtg      4020
     attggtattg gttccccgaa caaataaaaa tcgacccttt aaaaccccct tcagctccaa      4080
     aaccatattt aaattggtct actcaaactg aacttgaatt tgcttggtct gctgttccta      4140
     ctgcagagta ttatgaatat atacctacat ggtggcaaaa tccttcaact caaagagaga      4200
     atggtcttac tacaaaacac atatggttaa attacgatac tacatatgtt caaaaagtaa      4260
     gagcagtaaa cagagcgggt gcatctcctt gggttaccgt tagtggtaga acaaaaccaa      4320
     gaccaattgt tgaagcatac caaaagggtg caggaagcag aacttggcgt acagattatg      4380
     tcatttataa acaaaacgga caagttagaa aaaattcgtc agagtggcgc tatgaatacg      4440
     acgataacga agtatttcat ggagaatggg tagagcttcg aaacaagatt caagatggta      4500
     tggccgttaa aaaaggaaca agatggggca ataacaaatg tttattcttc cttgaccaca      4560
     atgattggag acaaaaattg cagggaaaag agattttgga cgttcagctt tatattcgta      4620
     gaagaaatac cgaacacgga tatccggaag atggtcgttt ccttcatgta tgggcgcaca      4680
     attatgcagg aaaatgggat ctgccttcag gatcggatgg tcctgattta aacaatcacc      4740
     aaaagataga aagaatagac tttaatcgag gtgagtctca ctggatttct cttaataagt      4800
     cgtttggtga aggtctacgc gacgggtgga tcaaaggggt tgcattttat catcctggtg      4860
     cagattatgg tccatactct tacatgcgtt ttgacgctta tacattccaa ttttacgtaa      4920
     aatatcgata gggagagagt aatctcccct ttattttttt aaggtggtga cacagattgg      4980
     cacaatacca aagaaacttt tattctagtt cattatatgg acgactaaaa gcattttatg      5040
     gagattatct aacagaagaa tttgatgctc aagaaccttt tagctatcat atcgatgcga      5100
     aaatccaagc acaattacct tctacttttt acgcagcaac aagcagagaa tttacaagaa      5160
     ttgactcaac aaaatggacg gtatccggta aggatattaa aacaagaact gctaatacac      5220
     cagtagaatt cttagctaca ggtgacaatt tggaagtcca tgttcgcctt caaaatgttg      5280
     gtgttcaaaa tatagaagca aagctattta aagaggaact tgtggcagaa acataccagt      5340
     gggtagagaa acaaacaaaa acaatcaata cgttatctct tactaatcct aataaggtgg      5400
     ataaaatcgc ttttgattcc tacggatttg gtgattataa agtagttatc caagcacttg      5460
     atacgacagc agatgcaatc attgtcggcg ggaaactaag aacaagtgac tttaatattg      5520
     agattcgtac ctctgccaat aaaactacat ggtcgaaatg ggaaccaatt actctaacta      5580
     agacatttgt tcaaggacag gactatctat gtacgggaca gagcgcaacg ctttacaaaa      5640
     acgttcgtta tgttcaaggg aaaataattt tattatcctc agataatgca acttctccta      5700
     ttatcgataa ggttgagtta cgttcagaag atagtggatt gtatgaccaa gatggtgatt      5760
     acactgttaa gatcgattta acacaagtag cgacaagtgt tggaaagatc tttaaatatg      5820
     ctaataagat acgttttatt cagaagcaac caatcggtac cgaaatgaat attcgttctt      5880
     cttcaagtcg agacaatata ttctggggtc caataacagc accttatcgt cagaatacga      5940
     atcgtcttcg attaaaacgc ggagcaacaa atcatagtgt gacgctaggc ccaattaatg      6000
     aagggaataa gtttgatttt agtaagacaa ctgcattatt gaattgggac acacaagcat      6060
     tctctccaaa agatgcaagc aacactaaga tatcttatat cttctcaaaa acaagaacga      6120
     atcaaaaaga tcctcgtaat cttcttcaag taattgataa cccaatgaat gtaaaagacc      6180
     gaacaatgaa gttctctcct caaccgtatt tcttaactgt agaaatgaca cgttcttcgg      6240
     taagaggaac accagtagtt gaccttatag atgtgtatca aaacatcttg tacaaggaaa      6300
     tagtcaatgt gataaataag gacgtttctg ctgtagatag tttaggtacg ggtataaaat      6360
     cacttcaaaa gattagtgat tatgcgttca agtatcctag tacatcaaat caaattcctt      6420
     ttaatcagca acaaattact tctgctcaac aaagatatga gcttacagat caaacaagaa      6480
     gaccttctga cgttatggtt taccttaaat cagaggaaag taaagggtct agaacaggaa      6540
     agtctatagc tgcatccgat gaagtaatcg caaaagctat tcaaaggaaa ttggagtttg      6600
     gagaaaaaac aggagtcctt atgcattacc aatatggtgc agggaaggtt cagtacctaa      6660
     gaccttacga gagggaatta gactctacgt ttacaccatt cttattatca aatcttaagt      6720
     accgttacta cattcaaaat ggatggccga acgagttgca taaggttgtt aatgggcaaa      6780
     cactaaatga tgttgctgca atgtacaaca caacggtaac tgcaattaag gcaaacaata      6840
     aggatatcct gttgaatgaa gatggtacat tggtgaagga tcagcttatc acaattccaa      6900
     atatatctaa gaacagcaag gtttctctat tcttcaagaa cggtacgccg tatacacaaa      6960
     agtctagtca taattcgtta tacgacaaag atcatggtgt aaacgttact gacttctcaa      7020
     gtgagccaat aagtattaag gttcctacta agcctccaaa agggtatgtg gattgggcat      7080
     cagaagaaaa gatttacaca ggcgtaatta atgcgaatga tatccgtgga gaatttgttc      7140
     gtacacaatt caacctttct actctttcag atttcaatcg tgagtatgta gtagtaagtg      7200
     gagacacatg ggaaagtatt gctactaaat atgatgttca tgtacaggat ctaaagatga      7260
     ctaatgattc aattgaggaa ttaaaggtag ggaatacaat cattgtacct ccaaatatta      7320
     ttcttcctgc attagctcct gaagctgaat ttgaaaatgc aatgccttat gagatttcca      7380
     ttattgaaga ttctgttcat aagaagaatg gtgttagaat taatgaatca tttatcccta      7440
     tcaattggaa tgggaaacac ttaccgcttg aagtaacgta tagaacctcc gaacttctta      7500
     cagctgaaat ggtaagaaat gcagatgcaa atggaatgga tccacttcct ttaagtgatg      7560
     ttgctgaaat cgtttcttgt aagaaaaaag ttggtagtgt aacataccat atttggaatg      7620
     acactttaaa aactggtgac tttaaattaa agagcaacta cattgattgg tctccatctc      7680
     aagcaggagt attagaacct gcagccgggg aagaatacat cgttgtttat aaacgtcgtg      7740
     aagtaaatac tgtaaaggtt catttagata caacattctt tgaaaagatg ggaactgata      7800
     tcgtatggcg ttcaccggaa gtaaaagtat ttgacggagt ttgtacaccg acagaagact      7860
     ttaagttaga acttcctact cctcaatctt tcgaaggtta tgatggtatc tataaaaaca      7920
     tcggatatat tattgaggat aatgacttgt gggtagaaac aagtgttcaa gacattaacg      7980
     gtaagaagtt cttagtaggg actcttaacg gaaaagaccc aagtaagaat tggcatccag      8040
     aaattcaaaa agggtactac tacctaaaag aacaagagca ttatctatat tccgaaccat      8100
     taaaaacggt attaactgat aaagaattac caacagctga cggtatcgaa tatgtgaatg      8160
     gaccaactgg aatcggagca atgctgctgc ctgctagtag caacatggta aaagattctg      8220
     tattagaaaa cgatagttgg aaaaaggcta aggtctttaa cgcatcgtca ttctagttta      8280
     gttaaggagg gggagagatt cctctccttt tcttatggac attaatgaga aataaaggtt      8340
     agattgtcaa aagaaatcaa taaaaaggtg gtgcagaaat gttcactaat tctggaaaaa      8400
     ttattaaaca tgctacaata ccaggcgcta ttactttcca aagtgcggga tatgtttcta      8460
     tctcaaatga actatatgaa gatagcaaag tagtattctc gttttctaag ccgacggaaa      8520
     aagtagcgtt aatccctaaa tatttaagtg atggaaactt cttatttgct tctttagata      8580
     aagaaaacaa gttacatata ggcggaattg taaaggattc tgagaagatt tatggagtcg      8640
     tagatgtaaa agataatatc ttggattcta atactctaac agtctcttcg aatggatctc      8700
     attttacagt taccttaaac aataaaacag tattaaaatt tgaatctgct ttattcgtta      8760
     atggacaagt ccgcgtatat ggggaaatag gagaagtctt taattcttgt gaaatacaag      8820
     aaccacaatc taccgcatgg acaagtaatg caaacggtgg gggagtagag gccaaaacaa      8880
     ttaagataga agaccatgac tatgtaaaac tagtaggctc tgcaactaag aaagcaatgt      8940
     tctctcaatc tatctctcta cttgcaaaag attacacact ttcattcaac gctcaaggga      9000
     atggtgaata cctaattaag tctggagaga caattttaaa acagattgct atttcaaaag      9060
     gagagttgtc ttacatctct caaactttta atttagcaac cccacaaact attactttag      9120
     tattccagac aagtgaaata cttatcgtag gaaaacatca attagaggac cgcgtagacc      9180
     ctacgtcgta cataccgaat cctagtatta gtagttcggc aacccgcaag ggatcggcgc      9240
     tgaagtttcc agttaaaaac ttgttcgata aaaaagcagg aagtatctat ttgaaactaa      9300
     ctacaaaaaa tcgtatggat agagaccaaa ctattttctg ttcagataca agagagatgt      9360
     ctctttcggt acatggaact aacttatcgt ataccgttgg tgctagttca attaccctcc      9420
     ctaaaacact tgaaggaaat acgtcatatg aattcctttg tagttggaat gatgaaggta      9480
     ttgagctaac agtaaatggg gagaatgcaa aagctttaaa tactggtctt ctacttacaa      9540
     ctccccagga attaattttc gcaaatgaag aaacacctat tcaggaagaa gttgtcttag      9600
     aagaatgggc gttattcaat aacaaattac cagctaactc aaacataaaa gcacagctac      9660
     cttttgcagt tatgcagtct ttatttgatg gtggaatcag tggtcagaat gttacatggt      9720
     cagaaatccc tgtagctcca attgatcatt cacctattct agttcaaaaa gagaatggag      9780
     atacgttaca aaaagtatca ttctttaatc atgaaacagc agcgtatcaa acatggaatc      9840
     aagaagcatt ccagtatgac ggtaaaagcg atttcgttga ggttgcgtac aataatcttg      9900
     atgagcaatt tagagatatt gctattcgta cagaggatgg agaaaaaata ggagaacctt      9960
     atcgaataga tggtaagaga ttttatttct ctcttcacac aaacaggaaa gcagtgttaa     10020
     aaagcaaaac cctctatgca acgtatcaag tgaacgatac atacacgatt gattacaata     10080
     tcaaagctgt tgatggttac cgaatcgatt tcgctaaaca tgatggcggg aaaagaattg     10140
     tgtatcaaga aggaaaccgt tatggtgagc caaagaaact agcaacaatg attgatatga     10200
     atccaattca aaatcaaaat catgaagggt tcttatatat tacgaacaca ataaataaga     10260
     ccgatagctt tagaattaca gctactccag atcgattaca tgcagatgga gctagtttct     10320
     ctacactgat tattgaacca cttgattatc aagggaactt cttatctcac tccaatttag     10380
     agattattgc ttccaaaggt tttgtttctc gacacatctc aagagatgca gttgaagcac     10440
     aaaaacgatc agggcaatac ctgtaccaat accatgctcc atatattcaa tcgaagcgtg     10500
     cgggtgaaat tgtagaagat tatatttgga ttacagacaa ggataataat attggtgttt     10560
     gctacaagat gttattaagt cctgtgtcaa agccagataa agttcaatta acgcaggtag     10620
     aaaagaatct attaactgct aaaacgaaaa tcattaacta cctccttatg tatgagggag     10680
     tagagagata tgaagatgaa gtacttttct ctatcttaga ttttaaccaa gacggtcgtg     10740
     taacaatgga cgagatctta gtgttagaaa caaatcagaa agataatgaa ttgactgtta     10800
     tcttaaacaa gttaaaagaa tgggaggata caaaccatgc agttgcaacc tcataaagac     10860
     ctcgttcgta gtggtcaaag aaatcgcggg tatgctattc gtattgggaa caaagttcct     10920
     aagaatagtg ccaaccttgc atatgtacaa tcaaaatctg tatcacccga ggagaacatc     10980
     ttattagaag atgtttcttc tcaaattaaa gaaaacggat tatctaattt catagagaaa     11040
     gattacatgg tttacccgaa caacaagttc ctgttagaga cagaatcagg acaagctatc     11100
     tttcctaccg atgcagtatt tgtaacagat gaatttacta ttcgtaaaaa ccgtcaagat     11160
     actccaaaac cagtattcta tcaaatggaa ttgaaaggac gcttcgatgc aagaacttct     11220
     caggttatcc cttatctagg tggcttctct tctgaaacag aacaagatgc tattgcttta     11280
     gaagatgtcg tactggacaa aagaaacgat ctaatttatg tagggaatag tattcgcata     11340
     gaagcaaatg gtggacccat acaggaagag gacgagtata aggttcaatt aattcgtgaa     11400
     gataatttca tttatcgtat tgttgtagtt acaaacttcc gtaacgacaa agatgttaca     11460
     tacaaagtag tttaccctaa ctacagaaac gatattaaac agagcgaact aaaagaagaa     11520
     gttctcaatg cgtatccatt tttcgaacaa gtaacgatgg atcagtttga agacatcgtt     11580
     tctcagatgg gatctgatcc ggataaatac aagcatttaa aagtgtacgc aattgaagag     11640
     aaggggaatg acttttcttt ctatgcaaca tctgatgtta tgattgccaa ctaccaaaca     11700
     cgtactcctc aattatttaa gcaccgtgtt gaagccaaat taaaaacaaa gcttagtgaa     11760
     acaaacccag ggaagatgaa tattggattt agctttgttc aatcagtcgc aaatgttgaa     11820
     aacttatctt ctattggtaa ggcgatcaac gagcatttat ctcttcctaa atatgtggag     11880
     ttacagaatc cgcacccaac agaagttgat cttttgaaga aggatatagg ctactgggct     11940
     gttaatcttg atatgccaga ccatcattat gaagattatg atttacttgt tatcactggt     12000
     tacggtaaag ctgacttatc tatgtttaaa gacaagtttg agcattactt aaaaaatggc     12060
     ggtacgattt ggatagacaa tgcaggtagt ggaattaatg ttcttgattt caaaacaagt     12120
     aaaggaaaca catttgtttc tgatattgga ttctcatcga gcagcaatga gtttggagta     12180
     aaagaaatta cgaaagactc tccgtataca agtcgtttat tgccgattaa aaatatcgaa     12240
     gctttagggt atacggacat tgctcctact atcctatttg gacaagatga agaaagtaag     12300
     cagtgggatg cagtagtaaa acactttaat ggtggccctt ctattattaa gaaaacattg     12360
     tttgataaag gtactgttct ggtttctaac tgcgggatat tcagaagctt ttaccataat     12420
     caaaaagaga gcgtaaacct tgttttgaac tcaatccttt accactcaga agaacaatgg     12480
     gtgtttactc cttggagaaa tgactttgta tatcaccgag ataatttatt cgcgcaagaa     12540
     tacaaagtaa acaacactga cgtttatatc aatgatagaa gtgattataa cgcaaaccaa     12600
     attgtcgcta agaaaattct ttataaaaac tgtaaggaat atgtgaaaat ctattgcaaa     12660
     ccttggttct ataatgctat cggaacatat gaacatgccg taaatggtga taaatctatt     12720
     ccagttaaca atagtgggtt tgaaagtggt caggtggatt ccagtggtaa gcctattgtt     12780
     tcttggacat ccgacacagt gaatgcaata ccttcatgga atactaagaa gttagctggt     12840
     caaacagtaa cattcacaca tgattccgat aagagtctat tcggagttcg tcaagtatct     12900
     ctaaattcat caaatggaac aacaggcgct catgcctatt gggaaagcga agatatctac     12960
     ttatctattg atgactacaa agtaactgta tggacaacaa ttgatcaggt acgaggggtt     13020
     acaactgacg gtattaagat aggtgtatac aacctacagg gagaacaaat ctcttcttca     13080
     atttctatta cgggcaagaa agattgggtt aaacttgaaa cgaatttcca catcgacaaa     13140
     cctcaaaaca ttaagattcg tttaggtttt gtagacggta atggactcgg taaagcaagc     13200
     tttgataatg tcacactaga tacaatcgga gcagttcgag gggttgcaca gaatgaggga     13260
     gaaaaaactc tctatgcatt cagtatcaag ccaaacgcta caacgattga tatcgaagca     13320
     gaaggttttg ggaatgcaaa cattacaaga gctactccag aagtttcatt cacatacacg     13380
     attatgccat ttatccttca atggatttct tacggaatag attcaggaac tggattagaa     13440
     tatggtcgtt atgagcgaat gtatggacca ccggtttctt attctaaagc aattcgtaaa     13500
     acagacggct taaagaatct aggatactta catacgctgc ttcctccagt accaagcggg     13560
     aaacaatggt atgacaagaa caagatcttc tataagattg cacttggttc agaaaaccta     13620
     gaagaaaaca attttgttaa cctaaaacta tttgaccgta aaacaggtat ggaatggttc     13680
     tatagtggtg atcttgttat tggccataaa gatattttct gggcaacaga caaaccaagt     13740
     tttgttctac atgctgaaac tggtttcgaa acaattagag cctctaaaag aaacttcgga     13800
     ttaaagttaa ttgatgatcg tcgtatctat agcgaacttc cacaaacaaa ggatgctaaa     13860
     gaaaactggt atttaagaat ccataacgga cagtttatca aggacggtct aggatataag     13920
     gaatggtcag aactacatgc tagcaataat cctgctgtaa tgaatcaata caaagaacga     13980
     gttatgaaaa aagagaagta tcaaatcgat gaatacgcgt ctcaaatttt caatccttct     14040
     attggaatta tgacagtaga gaatgagatg gaatacctta ctccttctac agtgaaagta     14100
     cctcacaaca atctgttcgt aagccaaggt tttgtagaaa aagaacagct tttagttgag     14160
     ggattagcta attctgtggg aacattattc cgagctaaac aaaaagattg gctccgtaac     14220
     gataaagttc atatctttat agatgtttca aataacggta atattgtgga gatttttgaa     14280
     gagtatccat tcgagattaa tctcgatgaa ggtacagttt tcttccctgg ccgaatcata     14340
     actggcaaag tatatgcaac ttatgagcat cgcaatttcc gtctgtataa gcgaatctac     14400
     aagaatacta aaatgtcgaa cgacctttta gaaaataaac gaatcgattc agttacgaaa     14460
     gaagtaatca tgtatggttc aaaagaaaac tggttaattc agccgatacc agttcttaaa     14520
     acaactaaag gcaaggcaac atcagccaat acaatccctg caacaaatta tcgaattgat     14580
     tatgagaaag ggaaagtaat ctttaagttc gaacctgttg ggcctgtata cgcagactat     14640
     ggttatttcg agaatcaaga gctatcagca aatgactacg atatccaaaa tggaatcttc     14700
     ttcttaaaag aaaacatttc atttaaagat gatctattcg ctaagtattc ttatttcgat     14760
     aacttctacg aatataaagg tttctacaat gaaactcttc gaacattcct tcatttagac     14820
     ctcaatccat cagtggggca ttactcaact cttccaatga caacttatgt gaatggtgtc     14880
     caaaaggtag agtataagaa cgttccatct tcaaagcttc taaataagct tatccatatt     14940
     tacattgttc cggattctga aaacggaaat tcaattcgtc actgtttcag tagagaagaa     15000
     tggagaaaca ttcagcagtc gaaccctatg tacttgttac ttgctaaggt tcaagtaaga     15060
     gagcatacga atgtgaaaga cgtagttgtt atggatgcac gtactcgtgg tggtggtatc     15120
     tctgcatcat tatcaactaa ggcaattgac gagagagtac atggaagaca acgttattgg     15180
     gacattggaa attgggaggg gaaagcattt tatagaaatg gtgtcctaat tgtaacactt     15240
     ccaaaatcta ttctaactga gtacggcggt acattatctg aagaatatgc aaaagaagct     15300
     attgataagc atgttgctta cggtacttat tgcattatcg aatgggagtg agtggtgtga     15360
     attatccatt aggagtattc cagtactatg acaaggaaac tgatacaacc cacttacagt     15420
     ggagttatgt tgatgaccca aaccttactc atttcgaagt tgaaatcttt gatcaaaact     15480
     tacgcaaatg ggtgaaggct gatgggcgaa atggaatcat agaaaaacaa ccgaaaatag     15540
     gaagtaacta ttaaccaatg gggcgggtaa ttccgtcccg ttttttatag caaaagtatt     15600
     ttgtaatggt tataaaagaa gcatattaaa gacaaagtag gtgagtgtat ggaaaaagaa     15660
     ttgattttcc ctgtgcctta ttctgagttt gaccgtaaaa aagatgcaga gtatgacgga     15720
     gatcctaatg gtgattacgt catggctgaa gatgttaatg agcttcagga gtctattgaa     15780
     aagatagaaa gagtcattaa ctttacagaa ctagaaagca cagtctcaga tgaactaaat     15840
     aaaaaagttg ataaagcaac tatgtctgat tttggtagtc cattatttgt ggggtataga     15900
     ggcgcgtcca tcaatgcata cgatagtatt gagaaacgaa tcaacgcttt tagctacatt     15960
     cctcatgtca tgattaacaa agaagaatct actaactttg atttctttgt taatgaagtt     16020
     aagaagagtg gaacattgct atacggtatt atcaattatt cagatgttat tttaaataac     16080
     attgaagcca atataacatg gttccaatct aaaggttttc atggagtgtt actacctggt     16140
     ttcggattcg aaaacggatg gaacaggtca caacaaaacc aaatccttca atatattcat     16200
     gcaagaggaa tggttgctgt tattacaggt gaaattgata ccactttatt taacaagccc     16260
     cacaaaaaca atccccaaca agcagacctt aaaacatcaa aagatgacat ctatctagca     16320
     caagatgttt tcgttttaaa tggtgctaaa aacaatccta tcgtaattcc ttccgttgtt     16380
     ttcaatctaa acaaagctca aaaagaaaga ggaattcaaa tctttgttga agatacagcc     16440
     gatgcaagta gtgataacaa taagctttat ttatacggaa aaatgttatc tacactgtat     16500
     aacttagacg gatatagtct cgttcctaaa agccgatacg ccttaaatga gaaggtagaa     16560
     agataccttc atggttttga attagggaaa tggaaaacac agaatccgat ttatgtagaa     16620
     gaagcaactg ctacatcgcg ttctttctct aaaggaagca ttctattcga taaagtgaaa     16680
     aatgaatgct acataaaagg agtagggtta aacccttcca tctacacatg gcaagataaa     16740
     caaatccctg gtaatgcaat tgatttcgca agtgctattt atggttctga aggtgtaaaa     16800
     actcttgttg atgcaattaa taataacgac cataaaatcc actattcgaa gattgatggt     16860
     atggaagagg gtggcgtaac acctgatcta tttaaggata ctgttatccg agcaatcaac     16920
     aactctcctg cagccgtagc taaaaaccca ccaaaaggat atgacgagtt agctggtaat     16980
     aactttattc acggtggagt cattgactat attgatgcag gttctattaa gtcagggata     17040
     cttaatatcg acgcgattaa aacaaatatc attgaggcga tcaatgctta tattggtaca     17100
     gctaaaatca atacagccgt tattggtgaa ttatcagcag atcatatcgc agccaatgtt     17160
     atcgatgcaa tcaatattta tgctacaaat atttcttcta gttcagctaa aatcaataca     17220
     gctgttattg gtgaattatc atcagatcat atcaagggag cagttattga agctgttaac     17280
     ttatatgcag gagaagcggt aattgattct gcaaagatcg gtcaacttga tgcggatcat     17340
     atcaaagcaa ctgtaattga agcgataaac gcgtctattg aaacggctgt aatcgattca     17400
     gctaagattg ggacattaac tgcaagtcat attaagggta tggttgttga agctattaac     17460
     ctttatgcag gacaagcaaa aatcgatgct gctcaaattg gtgctttaaa agcagataat     17520
     atttcagcag gattaattga ggccttggag atctcagcag gaagtgcgga cttcgataga     17580
     ttgcaagctt ctgtaattga tgctattaat gcaagtatcg aacatgcttt tattgatgga     17640
     gctattattg gtgaaggtac agttgactct gctcaaattg cagacggtag tatcacagat     17700
     gcaaagattg ttagcttagt agctaataag attgttgcag gtactattga tactggacaa     17760
     gttaccctac agggaacaaa tggccattta agaattacgg gtaatagatt acaagttttt     17820
     gataatcaaa aaacccctat tgaacgtgta tccattggtg atgttaacgc tgatggaact     17880
     ctttatggat tacgtgtccg tggtgctgat ggagtaactg ttctatacga tgaaaagggt     17940
     gtttactcag aaggtatcac tgatggagct atcaccaatc ccaaaatcca agaaggtgct     18000
     gttgatggtg gaaagcatat tgcagctaac acggtcacag ccgataagct agttgctgaa     18060
     gccataacaa cacgagaact agctgcgaag tctgttaatg ctaatcactt gcaagtaggt     18120
     gccatcgttg caggtagtgg ggttattgga gaggccgcta ttggtgaagc ggaaatcgca     18180
     caagctagta ttacagatgc tcacattaaa aagctaagtg ctgatagtgt ttctgcaggt     18240
     tctcttcaaa tccaaagtcg aaatctagta tctaattcaa cacttagaaa aggattgcta     18300
     gattggacta ctgatccaat actagatatc gctgaggtaa gtgaagttgt tcgtttgaac     18360
     acaacaaata gtatgcattt atttaccaca ggaaaacaga cacaaaatct tagtgcatat     18420
     tctaagtttg tccctgcaag ccccggtgaa aactactctg cttctgtata tgtcctcaca     18480
     aaaaatatcc tcaattatga tggcggacac cctagagttg aaatcgagta tttcaatgac     18540
     tcagcccgta tctcatccaa aaatactgca gctcaattaa caagcaatga tctgtggcaa     18600
     cgtatcagta ttacggaagt tgctcccgca gaaacgacaa gagttcgttt acgaatctat     18660
     catcctaaaa acggagattc atacttctgt agaccaatgc tccaaaaggg taacatcata     18720
     acagaatgga ctggtgacgg ttcatacatg acagaagatg ggttctacac aggagactta     18780
     catgcaaaac aaataaaggt tggaaagatt aaggctgaga tgcttcaaat tggacccgat     18840
     acagaatttg aaccaggtta tagtcctggt gaacttcgtg aagaaatgaa agaccgcatt     18900
     ccttatcgtg tagaaatact gagcacaaat ggaatcgcct ttaagggtgg aaacatctct     18960
     acaacactta aagcgaatgt atatttaggt gctgaaaatg taactgacca aatggatgct     19020
     attcgtttta agtggatgcg cgtaggtagg aatggggaag atgacctagt ttggaatgct     19080
     gctcataaag gattaaaaga agttcctatt acaagagatg atgtatatca aagagctaca     19140
     tttttgtgtg aagttttgga tagttaaatg ttgtcaacca ttatttggaa tgcttacctt     19200
     tattcttgta tttataaata gataacttaa tagagaatag aggaaaataa gcatggcaaa     19260
     aacattagca actggtatga tttccattgt ggattttaat gatgcgcctt ccttaagcgc     19320
     attcgtttcc actacatcac caaagactca aatctacgat cctgcctcag gaacttatac     19380
     tccaaactgg acttccgcag gtccgacttt aactccttca ttatttatct ctacagaagg     19440
     aactacagat gcaatctcta gtgcaaaagc agttaagtgg tatgactcaa ttgatacgag     19500
     taaagttatt gtgactggcg gagcatacac ggttacaggc aacactttaa aaatctccca     19560
     aaacatcatg acaggttcaa catatgctaa gacatttata gctgaaatta tctggacaga     19620
     cccaacaacc ttagcagact tagtagttcg tgctgaattt acatttagtc gtgcagacaa     19680
     tggtaagact ggtgcatctg ctatctcagc agtactaagt aatgattctg acgttattcc     19740
     aacagacagt gcaggtaaca acggtaactt tactggtgct atttcaacga tgacaatttt     19800
     tgaaggtgca actgatgtaa gtgctagttg gacagtagca gcaaaccccg ttgatattac     19860
     tggtacttta tcaggaaaaa cttatacagt aacaggattc gtagctggta aagatacagg     19920
     gtatgtagat cttacagctt ctaaatcagg ttatgcctca gttacaagac gattcgcatt     19980
     aagcaaaagt aagcaaggta tatcaggtac aacacctaca ctataccgat tactttcaag     20040
     tgcggatgcc attcaaaaaa acctcgcagg agtttatacc ccaacaacta ttattttcac     20100
     agctaaatct caaactggat caggcgcata cggtgactat tcaggaaaat tcacaattga     20160
     agaaacaaca gacggtacaa cattcacaaa caaatatacg agtgcttcaa atgaaccctc     20220
     aaaaattcat acaccatccg caggcattaa agcaattcga gttcgactcc atatcgctgg     20280
     cgtaacacca aatggttcaa accatattga tgaacaaacg atttctgttg tttccgatgg     20340
     agcaacaggt gtatcaggtg cggatgcggt attagtatca gtttgggctc cgaatggtaa     20400
     cttgtttaaa aatgacttat caacttcatt aactgctcaa gcagaccttt acaaaggagc     20460
     aacggttcaa agttctggtg tgacctatga atggtttgtg caaaaatcag gtaatgcaga     20520
     tgaaggtgcc ggaacaggtt gggacaagat agatgctact aaccaagctt catacggtgt     20580
     tactggtgct gtcaatacag ctacaatcac agttaccgct gctggtatta caaacttggc     20640
     tgcatttaaa atcaaagcaa cttactcttc gaaggcctac tacgacacaa ttatcttcta     20700
     tgaccaaacg gatcctatca tggtttctgt ggaaagcagc aacggaaaca tcttcaaaaa     20760
     cggaagcgta tcatcacaga ttttatgtcg cctattccaa aatggtgaag agattgaccc     20820
     taagctagct tcggctacaa caggttataa gtacacatat acttggacta agttgaaaat     20880
     ggacggaaca caagatatgg actttggcgg taaagctatt tcaacaaaaa caggaaagtg     20940
     gatagatatt acagatgctg atatttttca aaaagctgta ttcaaggttg aaattagcta     21000
     gccaaatggt ttctatatag acaaagaata actccactat tgatttagtg gagttgtttt     21060
     atattgaaag ggcgtgaata tatgccatat gcagttggac agattactat tgtggactta     21120
     aacgatgcaa ttcgatcagg cacagcacct aaaaaccctg tcgatggaat gctttggata     21180
     gacacgagtg tgactccaaa tatattaaaa agctggaatg cagtttctaa taaatgggtt     21240
     gaacaaactt tgtctattgg aggcctagat ccaaacttcg ataaagacgt acaaaactta     21300
     aaaaaattcg ttacagatgc atctaatgac ggaattattc aaaccagtga aaaactaaat     21360
     gtaaaattac ttttagtaga aatcacaggt gatatacttg ctggaactac tctgcctaca     21420
     cttgcaacaa tcgataccgc aaagggagga caagtttatt tagcaagagc tgaagcaaga     21480
     gccgctggta tcccaataac tcatgcagat tatacagctt tcgaaacatc gtacaacgat     21540
     ttaaaaactt atttagaatc actttctcct agaccgtggc aaacagggaa tacaacaatt     21600
     gtacctgcca cttggacatc taaatgggat ttgtactatg acaagcttac taaattagca     21660
     gtcactacat ctacgtatct agcaaatagc attaagcctg gagaagatta taacggtgtc     21720
     actattaaca ctgataaggg gatagttgtt cttagaggtg ataatctttt cagaacaatc     21780
     cttaatgcaa ctgaaggtat ctctattgaa aagaacaatg caggtacatg gaacaagatg     21840
     ttctatacaa acctagacgg taaaatttat gcaaacggat tagttattag ctctgactct     21900
     acaattgcag gaactgatgc gaatacaatt aaaaacaatg ctgcagctgg taaagcgggt     21960
     attgatgatt taacaaatga cctgaaggtt actccgtcag agaaaacaac attaagtaga     22020
     gaatgggaat ccattaaagc agagtacaca caagtattag cacaagcaac ttctcttggt     22080
     gtcactactg ctacttatac aacatcttat acaaatctag atggcgtaac tcctaagatt     22140
     gctgctgagg tattagcaag catgacttct acttatacat tcgcttcagc ttctacacga     22200
     gatgcattta gagcaaaaat aaatacgtat ttcactgagt cggaaaagat caagaaagca     22260
     atcaatgacg cgattaatga atcagcaaat aatgctaatg acaaaatcga caatctcaaa     22320
     attggttcgc gaaacatcgt cagaaagaaa caagtaattc ctattaatgc agcatctaca     22380
     tcttatgacg aagctacaaa tacatggaca ctaacagcta atgatggagc tggcggagca     22440
     tggggagcag gtgtacgaat cactgataag ttttctgtta tccctatcgg aagttggtat     22500
     acagctagtt ttgaagtata ttcacctgtt gatatcactt ggaataacga tacaaacaac     22560
     ttcccaattg gtacatcatc tggcactaat gacaacgacg aagttgcgtt aaggaaaaat     22620
     tctggtagaa acataaaagc gaatgtatgg actaagtgtt ggttctctta taaaaacaaa     22680
     gacaattcca caaccgagct atatgaccaa tctaatattg gaatcgttaa taacactggt     22740
     gctcctatca cgtttaaaat ccgaaatgta aaaggggagc ttggaagcat tcctactgac     22800
     tttacatccg ctccggaaga cgttgatgaa atgattgcca acatttcctt tagtggtaga     22860
     aacctgttac tagactctaa taccgacttc tcaactacag gatatcttat caatatatac     22920
     aagttgtcag aagattggat tgtagggcaa gagtatacat ttgttattaa aggaactgtt     22980
     cctgcaggac aaaggttagg tgtctggcaa aatggtggtt ctaacaacat gggttatgca     23040
     acaactacat acgtaaatgg tgtaacctac gtaacattca aggcaatagc tccaacgagt     23100
     ggacaagaaa gaactttgag cttgtacaac tatcctagta atacaacact atcaaatgtt     23160
     gactgggttg ctttatataa aggtaacaaa ccgatggatt ggatgattgc tccggaagat     23220
     attgagagca tagttaaact tcaatcaagc ggcgcggcga atatgtttag aaactctggt     23280
     agcttcaaga atcttaatgg ttggatattg aatgcgggta aatcattaaa catagcagag     23340
     aaagatggat tcacagtttt agaagctgtt ggttctatta catctactaa tcatgttact     23400
     cgtaatgtac taaagccatc aactgagtat gtttattctg tagaaatcat gtttagcaaa     23460
     gataccaata tcgacaacac caaacctata catcactggt tctttgatac gggtggaaac     23520
     tacaatgcgg tagattccta taccctgata tcgaatgaca aagttgcaaa agctaacaca     23580
     tggactagag tgtctatcgt gtttaaaaca aaagctacta taacggatgc agcgtacttt     23640
     aaagcatttg tatacgataa tgtgcaacta acagacgata ataagtattg ggttaaaaac     23700
     gttatgttct ctgagacaaa cagagctgtt atctggtcac catccctagc agatattgaa     23760
     gagatggttg caaatgtttc agttggagga cgaaatatat tcctgaactc gggtcttcaa     23820
     caaggtgcga agtattggta ttcgaatcaa agtcaaaccg agattgtcaa tgatggcagt     23880
     gaaaaagctt ttaaatttat tactaattcc ggtgtagtga atggaggaat ctaccaaaga     23940
     caaggtggag tttcaactgg ttcattacca tttgaaaaag atcaggacta tacactaagt     24000
     gttctcctta aatcaagtgt aagtggtcag aagatggatg ttggtgctga aggaatcagt     24060
     ctctcattat ttactattgg aaccgaatgg aaagaatatt cattcacctt taaaggtaca     24120
     ggagcaggga acgggacaat catcttctac acaagatcag ctcctgataa cacacaaatc     24180
     ttcgtgaagc gaatgaaatt agaaaaaggt aacaagaaga cggattacgc agctgctcca     24240
     gaagataccg atcaagcaat ttcagaagta aaagactctg ttgctgacat gacaagtgat     24300
     atgaaaatca caccgttaga aaaacaaacg ctaagtcgtg attgggaatc tataaaatca     24360
     gaatactggc aagtacttcc acagggtcaa gctatctcta gtgtttctac aacagcatat     24420
     tcaactgctt ataccaactt agatagcgta tctccgaaaa tcgcctcaga agttttagct     24480
     aatatgaacg ccacatattc attcgcttca acagcagcta gggatttgtt tagaaatcag     24540
     attaataagt attccgatga agcagaaaaa gtaaaaagag ctattgcaga agctacaaat     24600
     gatgcaaaca gagagttagc gcaagctatt tcaaccggga agatgatgtt tactgacccg     24660
     atattcaaga acggtgcaaa taacataatc gcttataaca atactagtgg tagtgcagta     24720
     acagcgacta gggtttctaa accatcagat gctccaacaa catcttctag tgtgatggag     24780
     ataaaaacaa ctggagcagc atctcctggt catggtggat atgtacaaaa tttcaatgca     24840
     agatctggtg ctaaattctt agttcgaatc atagctaaaa taccagcagg atgtaccctg     24900
     aacgtagctt ctaattcaat gggtactggg tatacggaca aaatcctaac atctaacaaa     24960
     ggaacaggaa aatttgaaga atatattcgt cttattactt gtggaactac aggaaccttt     25020
     tcgaatggag gacacttcta tttaactagt ggattaacag ctacaccaga agcaccgata     25080
     acttggcaag ttgcctttgc aactgcatac gatgtgggag atgctgacta tactgtcatt     25140
     gataacaagg ataaatggga tagtgctgca aatgatgtaa aacaaggaca ggtagttata     25200
     aactcaacgt tctcagactg gcccggttcg tttccaaatg gacttggttc atggtctggt     25260
     tcaacagttt caaaagaaac aaccctaaca agaaccggga acgcaatgag atttaatgtt     25320
     ccggcagata attcacagat aggtactact atattaccta gtttctttat tccaaaccta     25380
     cctaacaata agtattatgc agttgagttg gactttatgt tggttagtgg ggcaattaca     25440
     ggagcgtgtt tattactgga ttggaatgga atgagtcctt ctagaacatc aatccatctc     25500
     tctgatgtgg aatctgctcc agttttaggt aagtggtata cgcttcgggc tgtaatgaaa     25560
     cgaccaacgg acaatgtaac tgggtacaca ggattggcag ggttcctcct tgctaactac     25620
     tcgggttcta caacaaacaa ggttaagaac attgtctttg accgacttgt ttttagagaa     25680
     cctacacaac aagaaataga tgcttatgag attacaacta tagagaatgg taaaacagtt     25740
     attgatggtg gaaaactcaa aacaaattct gtaaaagcgg aatcagttga tgcaagacgt     25800
     ctacgcgtta caaacaacag tggtttggtt acattagaaa tcacagatac aggggaagta     25860
     actgtaaatg gtaaagtctc tattaacagt agaaccgact ttgctgaggg atttgaccca     25920
     tcaaagaatg atggtggacg aaacattctt ttaaactctc gtttctctac tgcagacatg     25980
     acaagttgga caaactgggg agctccttct gtaagacaag tagaagatat tacggacttg     26040
     cctggttttg ataaagccgt taagtttaca acaacagcta ataaccaagg attgaaccaa     26100
     aacgtatcgg ttataaatgg taagacatac actctttctt cttatgttaa atcagcctct     26160
     ggacaaccgg ttcttcaggt atatgacggt gcgggttatc cttctgtagt tatgaactca     26220
     actgatgttg gtaaaaacaa atgggttaaa atatactttg tgttcaccgc taaagctaac     26280
     aatgtacgat tagacatggg taagagcgct gggggaacat taggaactta ttggtttact     26340
     ggtgttaaat tagaagaggg cgacaaatcg acaggttgga atccggctaa tgaagatata     26400
     gatgggttac ttggcaaagt agtagctcca aacggagaga ttaaagcact tgatattgct     26460
     tcttctatgt ctattacacc aggagctatt gatgtcataa gttcaagcat caacttaaaa     26520
     ggtaaagtaa cattttcttc ttttgcttcc ggatgggcac ttgattcaaa aggaaacaag     26580
     ataagcaact ctgatcaacc agattacgat cctaaaaacc cactttatct agatatggat     26640
     ggtaactaca gaccgttaac agatgagaaa gatttcatgt ctagtctgtt cactaaagac     26700
     gacaaaacgg gagttacagt tatcgatggt aactacatta agacaggaac aatccaagcg     26760
     aaatacgcca actttagaga tgttcaagta tataacgacc aagggcaaca aactttccgc     26820
     attgatacta acggtaatct atctacatct ggtacctctc aatctatcgg atatgaaaga     26880
     cagaaaaaag gttggaaaat tgatgctgat ggtagtgctg aattcaatgc tgctacattc     26940
     cgtggagata ttgaattagg ttattacaac gcaccgacta atgcttttgt cgttactggt     27000
     ggattattaa gtagtgttgg tggaactggt aaggatttaa gattctgggc aggagctaat     27060
     aaatctactg ctccattcaa ggtttactca gatggaactt tagaggctac taaaggttac     27120
     ttcacaggaa ctttctctgg tgaagtggtt gtagggaata tctcgattag agatacacca     27180
     acaaaaggag atgcaaaaat cattcttact gatgactcta aaatacagaa agttgtacta     27240
     ggtgaatcag cagtagaatt aaatacaaaa acgacttttg gtaacttctt aacggtagat     27300
     atcgataatc aaaaacttga ttttggagca aatgatttca aaatcgatta cacaaataac     27360
     acgattaaaa tgaaaagctt ctctcttaag gggacgacag ctttagagtt tatatctgat     27420
     ggctcatctg gggatgattt cgtatttaaa aacgttaccg gtgatacatc agttcgagtg     27480
     gatggtagct ttattgctag ggatgatatt gaaatcacga atgtcttacg tatgaaaaag     27540
     gctacagaca ccggcaataa aggtatcgat tatgtattca tttaatagag agattaagag     27600
     aggagtagaa aggcatggaa ttatttagtg ctttagcgtc gggctcaggc ccgaccatgc     27660
     tttatacagt ttacgcagac gaaacaagtc gttctgctaa ctcagtaaca tatagtgtta     27720
     catgttgggc taggttgcaa aaccaaacct atgattactt tggcgcagta gtttatccca     27780
     aaataaacat aggtggcaat acggtatctt tcgctaattt aggtacattc ccaaaaggag     27840
     ctggcgctaa atttagtact attagcgtaa ctgtatcagg tatatcagca acaacatcta     27900
     gcgtatcata tacgttctcg gcaacatcac aacttggagg aacatcaagt agtaccacag     27960
     gttacgttgg aggtaaatca ggtacagtat cttgttctat ttacgctacg actccttggc     28020
     taagtggtca aatttggatt aaagatggct caacaactgt tgattcttat tatagagaaa     28080
     atttaggaac aggatcattc gtcctaaact ggtcaggtgc aaatggagcc aacggaacac     28140
     ttacttatga aatacagaga caaataaatg gaggggcttg gacaatagta gctgccgata     28200
     ataacggaac cttttcagat gctccagggg caggtgctaa ctccgttcgt tattccatac     28260
     aggcaaaaaa taaagtagga acagatgtta tgcgctccga ttggatttat tctccgacag     28320
     tatataaaaa cgaattaaga tctccatcac taacatctag tgcctatgtt tcttatgcta     28380
     caagaacatt tacactatca ctcggagccg catcggacaa tcttggatca ccgataagtt     28440
     atacactaac aggaatagca agtaagttta caacaattaa tggaccaggt ggtgtgtccc     28500
     cagggaacat tactattaat gcaaacaatg gatcatctgg tatctatatg actatagaca     28560
     atctgaagac agcagcatta aatggtacag cacattcaga tacgaattat tatataggtt     28620
     caatcgattt acaagtaact gctacaaatg gtaaagggtc atcaaaaacc gatacagttt     28680
     caattccaat taatttagga atggatgctc cagtaagtgg aacgcctagc gttactatag     28740
     cggctacttc ttattactta atcaatacag ctaattatat tttccctgaa tataaacctg     28800
     tttcacttac aattgcagga gcgatcaagg atatgcttgg gcgaaattgc agctatgaca     28860
     tagttatggt agagggaaat agtcaatcta ttattaaaaa tacaggtatt gtaactgctg     28920
     cgactacagc aacagttaac catgtagaat ctggattact aactgctaag aaaaatgttt     28980
     ccttctatgt aagagcacaa acgttaggta atgaaggaaa accctctgca caaactccaa     29040
     aagtagatct tcattattat aaaaagccaa gtgttacttc aagtgattta tctcgtatta     29100
     caggtaaatc aacattcaaa gtagttgtta ctccttctaa ctcattaggt ggggctacta     29160
     atacttcgac aatgccttca ggatacacga aagggacatc gagtatagct tccggagtag     29220
     aaacctatac ggtaactagt agtacaactc ttgcggattc atatactgca ttaatttctg     29280
     ttgtcgttcg tgactcagta ggttacattt tgagttcaaa tggttcgaat gacgttaccc     29340
     tgaaagtaac tatccctaca ttcactcctg cattatctat ccgcgaaaga ggaataggta     29400
     ttaatggttt tgcaggaact accgaaaaac tttatgttgg tggtaatgtc aaacttactg     29460
     gtaacttaat tgtcggtgga ataatcgata tgggtaatac gaatatcgaa aatgtaaatc     29520
     acattacaat cactgatcca ggtggcggag aagggcttga atggaaagac cctacaaata     29580
     actggaagat cgtagttgca ccagacaacc ttggaaatgc tacaggtgac ttacaatttg     29640
     ctcgaaatgg tgtaagaaga gccactgtaa gagcaaatgg tgaagttgca gcagtaggtg     29700
     gttttgccac aatcaaccct agtaatacga atgcatcagt ttcattaaac ttccttaaca     29760
     atatcgcaag aattcgtact ggcggaacag gtgccggtgc agataatgga tttcaaatac     29820
     atggaactgg tgatgttatt agatggtcag tagacggtgc tggaaccgta tcaaactatg     29880
     gtcacttaca gatgttcaat ggtaaagaaa ttcaattcat gaacagatct ggcatggcat     29940
     ttgacggaaa tggaaacatg aaacctagag atcttttaac tcacgcagca ggtgcttact     30000
     ggtgggtaaa cgatgtaaat aataactacc cacttaaggt atggacagga gctaatggtg     30060
     gttatgctga tgttagaagt agaccattca cacaagtcac agcatttact aatggatggg     30120
     cggattacgg ttcctttggt ccagttgcct atacaaaaga tgcagcagga tttgttgtgc     30180
     tacagggttt attaagaggt aatagtggta cgagtgggtc tgcattccaa ctacctactg     30240
     gatttagacc aagcacatca cgtatattta atgtcgttaa tggtgttaac ggtcattctc     30300
     gtctagatgt aaatgcagat ggaaccgttg taatgcaagg cggtgcccct gaattctgtt     30360
     ctctaaatgg aattagattc ctacccgcat aataaaggag gatacgctat ggaaaatata     30420
     gaaaatatcg aagtcgtagg tgaagtaggg attgtagaac accctatttt tatagaaaaa     30480
     gaagaacctg tagagcttcc tatttctctc gaagtagaac atccatgttg ggaagtagat     30540
     gaagaaggtt atgttgttga acattattta atgtcagata gcaaaataga aatagcttta     30600
     tctgaaggac gaagagttct taagtcttgc tggaaagaaa gtttttataa accaagattt     30660
     gatgaagcta taaatgactg ggttgaaggt gctgatatgg aagagattct aaacctattt     30720
     aaaacaaata agtttgatga attaaatcag gcatgcaata aagatatctc cggatatttc     30780
     gatgctcccg ttggttcaga gacctataca ttttcatttg atggagaagc acaagctaat     30840
     tttattggta gcctagcatt attcaatgaa gggttgatga aagaagttga gtggactgca     30900
     tggaaaggtg aaaaacctca tagagttaat ctaagcaaag aacaatttat gaatgtagca     30960
     tttgtagcgt atcaagaaaa ggatacaaag atatccaagt tgcgaaatac attgcagcca     31020
     cgaattgaag catgtacaac tattgaagaa gtacaagcta tctattggaa tgaaaagcca     31080
     acattactag cttgatattt taataacgaa tccttatgat gtgttcagta agtaatatgt     31140
     tccaaatgtt cattaggagg aaaaataaat gggtcaacaa gggaatacaa caaacataga     31200
     tgtgaatcta ttgatcaaag aatatgaagc tacaattatt acgttaatca gtgaaaacgt     31260
     taagtacaaa acacttctaa aacaaagagc tatcgaagaa cagcaacgtc aggaagaaat     31320
     gatgcgacat gaagcaccac ccgcaccgcc tgctgttccg tcagaagaag ttgtagcgta     31380
     acaataacta attatatatt gactgattat atacgaatgg ttacgttcat gagggagcaa     31440
     gagctccctc ttattttatt ttggaggtgt ttttctgtat gacacaggta cgaattcgtt     31500
     ccattacaaa agacgaaaaa tctccctggg tttatattca agaagagacc agacaggaaa     31560
     ctccaaaagc aaatgtattc caagtaaaag ccgaacctgt tataagacga aacaccaaga     31620
     caaatcaata tggccgtttt cgttacagtg aaatgcaata tggaagaatt gaagcaatct     31680
     tagcttctgc tttagagata agtaaatctc ctatgagaat aagaaaccaa aacggagaat     31740
     gggtctatat ccaacaaaca accatcgatg gcgcttgtcc tgctattcgg atacgaaatc     31800
     gatatagtga acaggcaggt ccttgggttt atatccaaca taaggaggtc tagatatgga     31860
     atatttggat aattatttat ctgttctacc taattatgat cgtaaagaag tagagcagct     31920
     attacaagaa aatatggatt tgtttgatgt aaaagtcata acaaaagaag agttcgaagc     31980
     acttattcaa caacttgcaa atagaaaaga aaaggttaca actcttacga caactggtga     32040
     aaaagtcgat gccgaacatt ttaaccaaat tcactcgaat gtagctctgg atttaaagag     32100
     actttataac tcacatctta ttgttgagaa agtaattgcg aattacgaca gaattcttcg     32160
     aggaacatta gatgatgtaa aaagagaagt ggactcactt tctactcgtg ttgaggaatt     32220
     aaacctcaaa gcaaaaggag aagatggttt agtcgtaaag acatacggtt ttgaagaaaa     32280
     agaaaagagt ttgtacatgg aaacagatca tgatcaatat gcgcatttat tcttagaccg     32340
     cgacggtaaa tctttacaaa gcgcatcatt gaatcgtagt tttcatcaac actatttatc     32400
     actacctatc agagaagtgg agaacacaat gcaaaattca aatggggcga caactgcaaa     32460
     gattgaagtt atgtatcaag caccaaatag catttcagat aaaaaccatc cattggaaca     32520
     tgcaatagat gattcacttg aaacgtattg ggcgcaagca gttaaaacga atgcatctgc     32580
     ttatacggaa ataaaaaaac tatagaaagg aggaaaggga atgcctactc ccatttatat     32640
     tgaacaacat tattcattat ccgtatctga atttgaagga ctatgggaaa tgacatttat     32700
     gcacccatac aatcgacaag agcattttag tatctatcta gttgctccta atagtgatta     32760
     tgaacatgct gagcttgatg atcgcccgat tgtagaagct ggaccaagat taacggaagt     32820
     attaaaacga ttactttata aaatcgaata ctatccttat tcttgggact tcgcgggaaa     32880
     gaaaattgtt tcatatgggt atgattttga aacagacttt acaggtacca gtttgaccta     32940
     tattgattta acggaaatcg cccttaaaga agtaaatgag ttttataatt tcttctctgc     33000
     gttaaaaaca gacgtagtag atgaaacaga aaaggtcagc ggaaaaggtg ttatggccaa     33060
     gctaaaaatc acgttggaca agcctaaaac cgtaaatcat ttgttcattg atttctttac     33120
     agagtatcca attgagttac tttcattgat gtatcaagtt gaccagaatg aagaatcgac     33180
     tacttacgaa attcctcttt caaaagcagt tcaaacaaat ggatcgatct atcttcattt     33240
     ctctcctgta tttgcaaaga cattctattt aatcattaag caagagtctt atacattact     33300
     agaccaatca aagaaggaag aagaagtaat gaaagcagag ttatgggatc aagcttcaac     33360
     aagaagccaa tctatttatg agtctgcagt tggagaatat gtagaccaat tattctcttc     33420
     taaatctggt attcagctgc atcaagaaat cttagatagt taccaaaaca ttaatgtaag     33480
     tcacgcatct atttcatcgg atcctatgaa tttataccgt agtgattttg aacaagcaaa     33540
     aagatcttta gatagccaac aacgatagaa aggaggattt agatggttaa cagttttgaa     33600
     agtgcaagta aaccaaaaac aactttacta caaagtcaaa gtgctacaag tagcacaaca     33660
     cctggaccgc ttcctccaat cgtagaagga attggttcaa gtaaccgtac aaatagttca     33720
     acagaatatg tttaccagta tggaataaag aaccttcaat taaatcattc tttgtatgaa     33780
     caagctggaa tttttgttac aaaaccaatt gaagtagagg gtaatattgt agaggtttca     33840
     ttatctatct ttgaagacca tccgctgttt aatgagctaa atgggatggc aacagatcgg     33900
     gtcacttcta ttgaatacta catctcatta gaagaaaatc cgtcacttaa tgattgggtt     33960
     tcaatccttc ctgaaggtac aaggaatgtg aggtgtgaaa agctattctt ccgtggctca     34020
     agtgcggaac ttcgattcca tgcagacatt agtgatgaag ataatacaag agtataccgc     34080
     aataatattt taatgaatag gagtgactgg tactttacag aaagaggagc tgctattcag     34140
     ttgactgtgc ctcatgataa tagttcaatt tacactattg attatgtacc aaacgcaaac     34200
     ttatttgacc cttggacagt taaggtagga gatcgatttt ctaaaagggt tcgtaaagta     34260
     gagtctttcc caaatggaac tgattataac aatacaatta agctttctaa gtatccatat     34320
     gttgattata aacaagtgaa cagtgaagag agttatgatc cgaatacaag tgattacaga     34380
     ccaattgatg tatttctaac gagcggttca atcgtagtag aggggggaaa gacacaacaa     34440
     gaatttttcc caatctctta ttcaagcaaa aatgaattta caacaaaaaa ccgtacagat     34500
     tataaaacta acaaagatgt atttttaaat aagtacagta ttgttccgga ttctgtttac     34560
     aacacatttg agtataagca agagaagaat aaactcattt tcacagaaag ctttaatcgc     34620
     tcggatcttt attataacga agcaacaaat catggtaatg cgacagtggt tgttcactac     34680
     gattacttag tgacaaactt tcgattaaaa gttatcttgc gtaaaaacgt aggtgatgaa     34740
     ctagtggtaa cgccaatggt tgatagctac caattaaaat ttaaagtcat gaagtaggga     34800
     ggtgcaagaa tgaatgcccc tgttattgaa tctaaaatat tagagaaaca aagagaatat     34860
     cttttggagc aagcgaaatt acgattaagt atttctgcta cacaagaaga agtatctcaa     34920
     ttagcagatg aaatctttta caggtatcaa tcttgcatag gtaagccttt attccaggca     34980
     cgtaaagttg tgtttggaga actacctttt cttgaggatt actatgataa caacaaggaa     35040
     atggagaaag acttaggtat tttattctca gaactaaata ccattgctac atacctggta     35100
     gattatttta attattctca gagtgagaaa gatagaatct tatctatcgt gcgcagtatt     35160
     aatggggtcg tatcagacct tcaaatgtta actgaagaaa caacccctaa cacggtttat     35220
     ttaaaagaat cgtttatgaa ttacgataat gtggattctg ttttaactcc agtagagaac     35280
     agaagcatga ttcatacaca agaaggcgta ttaacactgc gtcgtacaaa tgctttaaat     35340
     agaagcatag gaagtaaagt tcgaactatt caaggtaatg gaattgcagg aacttattat     35400
     ctatctcgta aagttcaatc agattcagag ttcgaaaatt accagtatgt ttcttctcaa     35460
     attaagaatg atgatccgaa agcattaatc gatggaaacg cagatactgt atttgaattt     35520
     gaaatggtaa acatcccaga aagttataag aaacaatcat tctattacga cgttgaatgg     35580
     gcaaagggaa aggaacatgg tgacttacta cgtgtaaaga ttgttgttca attacctaag     35640
     agcgagacaa tcaactggat taatttaaat ccttatcatg ctgcaggtag cccaggtaca     35700
     gctaatgtat attctattcg aacatctaat gacggtattg aataccaagg tcttttcgaa     35760
     aaagaccaat ttgtattaaa ccaagaaatc aataaaacac ctcaaagcta tcgagcagag     35820
     gatttattcg atggtagcga aaactttgct aaaacaaaat tttctggcca aggtgtttgg     35880
     agcttcccat caagagaagc aaaatacatt gaattcgtac tagaacaacc aaattcttat     35940
     aaagaattat taggacaaga agcattctat agaagaaaaa aggattctac ttcatttaca     36000
     cgtattcgca aacaggaggt gccaagtaat attgttgatg aaaaatacgg catccatact     36060
     attaatagcg actatgagat taaaaaggta ttggaagctg ttgagggttg gcgttacgtt     36120
     ataggagttc gagacatcga cattatgagt ttcgaattcg ctgaaatgag tgaatatatt     36180
     agcaaaccat ttctacttga agatggtatt aagaaagtac ttctatatgc aaatgaaaaa     36240
     gttcctgcta tatataaaga gaaggtaagt gaatccaatg attggattca atactttgtt     36300
     tctttcgatg atatagactg gcatagaatt tccccacaac atcagcaacc agtaaacgat     36360
     aagttccctg caaaggtgct ttcagttaat gataacgaat ctgatattga aaatgcgttt     36420
     gctctttaca aacaaaacct tcaattaaaa gaacttccaa agcaagtaag gttaaaaatc     36480
     attatgaaga gaccggagaa aacaacagaa gatgaaatac ctcttcttca tacaacacca     36540
     ctcgttgaag acttcgcttt aaaaattctt acagaacaga aaggggtgta ggggatgtct     36600
     atcaatattc gtcaaaaacg ttttaccgta gcggtaaacc aaatccttca agaagaactg     36660
     agaaagggaa atcttcctac atccaaggag ttcgcttctc gtttaaataa actattaaga     36720
     gatcaagaat taggtgctcc tgagtataaa tttaagctta ttcgtaatgg tgaattagct     36780
     gagtccgatt ttttcaatga agttgttgga aaaattcaaa aagatttgat gattctttac     36840
     gaaaatacaa ttgctgttca taaccagcta aagggaaagt ttcattggtt tgaagtagaa     36900
     aagaatcgat tagagtatga agctagaaga ttagaatcgg aattaaaaga gaaaattttg     36960
     ctatatggga agacaggtta cttagctagt atctttgata catttgatga cctatctaaa     37020
     attgattcag aagacaatgt atctatcgat ataaagaatc atcaaatcac ccttaaaaaa     37080
     caggagaata cctcattttt aattaatcct gctagtgaaa ttaagttcgt tatgccaaaa     37140
     agttctgtaa gtacatttaa gaagattccc atttcaggga agattgaaca agcattaaat     37200
     gcaaatacaa atgaaacatt ccaagaagta tggttgtcta aaacggaagg gccagctgat     37260
     ggatatatag atatcaaatt taatgataaa caggtattga atcgaattga tttaagccta     37320
     catacaatta aaagtgctac tgtgtatatt gaattctcgc tagatgaact gaattatttc     37380
     cacttaccat attatccaga tggtaaacag acagggaata acgtatcttt ttatttcccg     37440
     acaacagaaa tgaagaatat gcgaatttgg attcgcaaac aggaaagtga taaagaaatt     37500
     gtccatcctg aaggttattc atatcagtac ttgtttggag ttaaaaaaat tcaatttttc     37560
     caattaagtt atccagaaag aggagaggtt gttacaaaat ttcttacgcc aaaaacagat     37620
     gagacattct ctattggaaa agtatcattg gttacagaag aagagattcc ggacggtacg     37680
     gatatcgagt actttgtacg agtagatgac agggaagaga gctggaaaca gatttctcct     37740
     gttaacaggg atactgcaca agcacctaac ctaattgatt ttaaatatgt tgttcatgct     37800
     agtccaacaa acttgggcat tcgaaagaat atcggtggcc aagaatctga gattatcgaa     37860
     ctgcaagcaa atggagtcgc attctactca ttaggttcta ttgagaaacg taaaatcgtt     37920
     ccgcgaacag agcgtttgta tatggggaaa gatgcttgga gtgttcagaa gacagtagag     37980
     aattttgggg aaacccatat cccttctctc gatgattgga agaagccatc aaatgatatc     38040
     gttcgaaatg taataccaat ccaggaaggg catcgaggac tgattctaca agatgaacaa     38100
     ttcacacaac atacgcaact gtattatgga atgggtattt tctatgaagg aaaagaacaa     38160
     gtgctttcta caatcccatc atctacagaa ccgattgcca tcttcttaaa tggagaaaag     38220
     ttatttgaag gaatcccttc ttctcaaact aatgtaaact acaaatttaa acagggatgg     38280
     aatgatctaa ctgtgttggt gtatgtacag aatttgaata aggactgtac gattgattta     38340
     ggatttgatc cgattcgtgt aagtactcat tgttattctt caagtcagtt cctggaaaag     38400
     gtatctgtat tcgacttacg atataacaca aagaacaacg attggtctaa gtacgccctt     38460
     tatgagaaag atggaaaggt ttatattgtg gttaatcatt cactaccggg tgtaacatat     38520
     gatttttact atgactatgt ggatgaagta gagcaccgaa atattcaatt gaaaatcgct     38580
     atgaaacaat tctcagtagg gcagtataca acacctgtat tacgtcgata tacattacaa     38640
     tttagttagt gagcagttat caatggggaa agaaatgcta agacatactt gttacaactc     38700
     tcaggataaa ataggtaagt actgtcccaa ttagaaatga caaaacgtat gtgttggtaa     38760
     tttacataac tgtattaaag agaagtacct atctaaagct taaataaatg aaagggatgg     38820
     caaagagatg caaatagaaa agaaatataa accttctttc cataaagcca atgctcgtta     38880
     ccgtggtgtt actgagcttt cccaatatac gaattttgtt cttgaatctg cccacgacct     38940
     tttattatta ggaaacatta cagaaggaaa tgaagcaaca cataaagatg gacacaaaaa     39000
     agaaatgtac aataatttca tttctatcat gacaggtgat cgggaagtag ggaagtcgag     39060
     tttatttacg gcttccacac ttcaaaaaat tgattactca cgaacagttc ctattcctga     39120
     attagatagt tggagtcctt taaatggctg tacaaaaaca gcagtgagtg acgcaattaa     39180
     gctctcttca aatggattgc tagatccagt aggaatgttt agtactcttt atgtagaacc     39240
     aggagacaag ctttatattc gaatgaaggt aagaagtaca ggtggtgctt cagacttttc     39300
     ctttggttcg aacaatatgc gtatgggacc agataagaat ggtgacacaa ggaaggttcc     39360
     tttagcgaaa agtaatgaat ttatcactct cgattacgtg ttacgtttcc aatatgctga     39420
     atcagtatca attaatataa acgttcatga aaaaccgaac gagttaaagg cggaaaatgt     39480
     tgaaataaaa gatcttgaga tatattactt taatgaaaca ccaattcaag cttcatctat     39540
     cgacatggtt attaaaccaa atgttgatga actagaagaa aaaattaatt cgatacgata     39600
     gggaaggtga gtacatgcgc ccgattacat taagaaatcc gaatctaaac aaagggccta     39660
     gctcttctga agagtttaat aaactacgta atgacatcca gactgatatt acaaatttgt     39720
     ttgatattgt taatagtcat gatggcataa tctctgagaa tatggatcat attttacgtg     39780
     aaaattactt cttacaaaac cgtctaaaga agttagaagg acgggtgtat gagctagaaa     39840
     aggattacca aaataacagt gtagacgggg agagtatcct aactcggtcc ttctatcatg     39900
     caagcaatat tatttcctca aatgcaaata atcccattaa tatagataca cttcacggga     39960
     ttgttacccc agttgttgtt agatctcatg ataagattgc ttataagaat gacttaggag     40020
     aatacatatt acctagcaac ctagaagcaa gtgtatttga gtcatcagat gtagagccaa     40080
     ttgatgaaga aacaaaacaa cgcaagttct atgcagtaaa ttctagtggt attactaaag     40140
     catttgatgg agataagaac tcattttggg ttcgtcaatc tgaatctaac gaaaacaaat     40200
     gcgtaacaga agtgtatgga ttaattcatg tgaaaattcc acaaaatatt tctaataaca     40260
     tttatacaaa cacaattact attcatccat ctccggagta ctctatgagc attcttgata     40320
     ttcaatataa gaatcagaat ggagagtgga ggcgtattga aacctaccca attaaaaagg     40380
     taaacaatac agacattcca gaagagattg ttgaatctgg taagttagta ttctcattcc     40440
     caagaagaca agtaacagaa ttacaaatta aagtaaaaca accttactgg tttaagcatg     40500
     ataacaaacg aatttttatg tatggattcc aagacatcgt tgttgaatac cgtgaatatt     40560
     ctcaagatac atcggaattc acaacaaagt tctctttaga aggaacagat cgtcgtttta     40620
     caaatgtaaa cacgccaaag gtaacagtac ccgttggatg tccatcactt aatgattaca     40680
     ctgtaaaaca cgaattgtac tttgatgaag gactaacgga gaagtttgat ttttcaacag     40740
     atattttcca accaattcaa actgtatatg taaaaacact tttaaaaaca gcaggggatc     40800
     aggtaccaat cttacgcgag attgaattac cttaccgaca tgaagaatta gaagtgctat     40860
     aaaaagagaa gggagcataa ccaaaatggt gtgctccctt ctcttttaat ttatcaaatg     40920
     gttcatcgtt ttcatcaaca aaaacaaatt tgtgattttt ccagacacca tcataatact     40980
     tacattcccc agagataaaa ggagggatat aattaccgtg ttcttgatta tatgttactg     41040
     gataattatt tattttataa gtaaaatact acaatcacta tccctgtaat taacgcccct     41100
     ccaaaaaatc ctgctaacat ttttccatta ttaccattaa taatttcttt tagttctttt     41160
     tttgcttttt gtttattttc tccacttgaa aagagataac taaaaaaata ggtaattact     41220
     aagaataatg atgctattat ttctatcatt acttatgtac ctccgtaatt taagatatct     41280
     cataaattat atcagctaga atactctaaa gtaagaaaaa tttatttata attatactgt     41340
     ccttaaatta agttttaaat tatcacgaga ataagcatct gttcctgttt attcttaact     41400
     aaacgaattg tacaattaat gcttcagtat gattgtttgg tattttaaca atacgtttgt     41460
     ttttattctg ttgtatttag taaaagaaaa agacagcctt gggtggctgt ctttttcttt     41520
     tagggaggaa tttaaataat taggtaaggt agataggatt aaacaagttc aaattcacgg     41580
     gagatgtgaa aatacaaact tgcgaggtaa cttacattct taataaaacc ttttcatcat     41640
     gaatatgcaa ccttgtattg tcaaaatatt agaaagaggg gattagagtt atttcctaag     41700
     cctttctaca taatacgtat ttagctggtt tgttatcaga aaaataaaac tattagaaaa     41760
     ccactgagaa aaaaataaag tttatattta gccatcgttc caaaatcttt aatatatagt     41820
     tgcaaatttt tcaccaattt tgatgtttag aaactatata gcccgtcact tacagaggta     41880
     gacgcagttg ctaaaaggct ggggataaaa ttatagaaaa tagagttact gtaaaacgat     41940
     atatcaaagg atccaacgct gaatataata ataataataa tatttacaga aaggggaatt     42000
     ttatataatt ataatttaat ataagataat taaaatgaat taggggaaaa agctttacat     42060
     gccattaatt gaacgcctag cgaatgattc atcaagtaag ataaatgagg aagtacattt     42120
     tatatacaat tatttttgtc gaataagata cacaatcaag acatttgata gagataaagt     42180
     gtgaataatg agaaaggtaa taacttttgg gtgaaactaa tgtacttgaa acgttatgga     42240
     gtgtacaagt attgcagaaa caaagtgatt tgtaatgaat aacgaagagg cttacaaaaa     42300
     gttatatgag aatgtatgtg cgaagggaaa agatagcgtt tatattggag gattcataaa     42360
     ggttcaattt aataaatgta acagaggaat tatattatgt aatctaatac gaaattattt     42420
     aagaaattac tcttattagg tacaacgagt ggaggaatct aagaagaagg gtgaggaaat     42480
     taatgacaaa tatccgcatt ataaagatgt gaatgaagac gcactaacag tatcactaga     42540
     acagtatgat caaattaagg tcggaatttc tgtcgacaaa gtcatagagg tagcaggata     42600
     tcctatattc agcgaaacaa ctaagttatt ctctattttc ggatatctag gtcatggtgg     42660
     agagggttcg atgactataa cgtttgacaa ttatttatat aaggttagct tattttttgt     42720
     tttgggtatt tgctttttta ggttgatggc ggcgtggtgc tactctttta aatatagtaa     42780
     gggatactac aatgagatat tcactagtat ctcattgtag tacccaacat aaattgccaa     42840
     ctaatcaata aactatgcat tttttgtata atttaagcaa aatcactttg actcattaat     42900
     tattatcatt ataaaataat aagaggatat agcttaatag aggttattat aattataagg     42960
     aaaaaattca agttaagact gaaacagtaa gtaaggaaaa caaagctgaa gcaacagaca     43020
     atgcaagcaa tgaagaaacc catgaaggtc tgtctattgt tgaagaaaag aattactaaa     43080
     agaaaaaggg gataagttta aaatgaatat taataaatca tttaagggta tcgcaatagc     43140
     agggttaagt gttagtttca tactagtagg ttgtacatta aatacatatg gacttacaca     43200
     gtcagaatat agaaaagtag ataagtatta tgatgcagat aaaatggtat ctgacctaaa     43260
     gaaattgcac tatagtgatg aacacattga aaaccaacta agaaacgcat tgtctagaat     43320
     tgagtatgaa aagggaagta aggaagacgg atcaagtagt aaagaaagta aatcaaatgt     43380
     atcagacacg gaagatgaaa agaaggtaac ggtatctgaa aaagattacc cttatcgttt     43440
     gactgaacta cacttagaat tccagtatca tttaaaaaaa ctagaaaaga aaactgatga     43500
     attatttaca gaagagggtg tctacataag tgagatagat tccttaatta gtcacattag     43560
     tttggatata aaccgttttg aaaaaatcaa gccacctaaa aattatgaag actaccaatt     43620
     cttaatacaa gaaggggtag aagagattag aaaacaccta ataaaagtag aagatgcagt     43680
     tagacagtat gatgaccgta agtatgatgg tgaatatgat aaggataaag caaaagaaat     43740
     catacaaaac ggtatgattg ggatagatga tggtgtttct aaatgggaga cagtatttaa     43800
     tggaatcaac gagaaatacc ctgatgtaga gcaaaaggta aaggaagaga atcagaaaca     43860
     tgcaaaagag ggtcatcgtg aggatgattt aaatgacaaa gtaagtggtt cagacgttga     43920
     taaatacaaa gcagacatcg tagggaatac aaataagatg gatgaagtta tcagattgat     43980
     acaagatata gggcattcag atataaagga ttatgagtca aagaaaagtg aaatccaact     44040
     gagtctggat gtggcaaaaa cacacgtaag agatatgaaa taccttgaag cacctaaagg     44100
     gttagaggtt gaacaagaaa agataaaaca gtcaatggat aattactggg atgctttgca     44160
     attattttca gaagcattag aagaacaaaa tgatagtaag ttggaacagg cagataacaa     44220
     agcagaacag gctatgaaac tatttaaaaa ggcaactgag agtattaaaa gtaaaacgaa     44280
     ctaatcatga aaatagtcta ttaggtttgg acatactgat actattactc taaaaaaggt     44340
     gcgtgatcag tatggaaaag cgaaatgtat tcaagtggaa gcattatcat catgatatta     44400
     ttttgcaaac agtaagatgg tacctacggt acaacttgag ctttcgtgat ttggtggaaa     44460
     tgatggagga acggggctta tcagttgctc atacaacgat tatgcgttgg gttctgaatt     44520
     agacaaaaga atccgtcgtc atctcaagca agccaatgac tcttggagag tcgatgaaac     44580
     atatatcaaa gtaaaaagtc aatggatgta cctgtatcgt gctgtcgatt cgaaaggaaa     44640
     taccatcgat ttttacctaa gcaaagcaag aaaccacaag gctgcaaggc gattcttcaa     44700
     gaaagctttg cagtcttttc atatttctca gccttgtgtc gtgacagtcg ataagaatcc     44760
     agcttatcct atagcagttg aactgttgaa aaaagaaaaa agcatacctg atggtatgca     44820
     acttagacaa caaaagtact tgaataatat agtagaacaa gatcatcgct ttataaagaa     44880
     gcgtatccgt tctatgctag ggctcaaatc ttttgacaca gctatatcca ttctttctgg     44940
     agtagaagcc atgcatatga ttaaaaaaga acagattaat ttacggaacc agtctatcca     45000
     aaatcagaaa gagttcgtct atcaattgtt tggacttgta gcataagata cgattccgtt     45060
     agggatatat atgctttatt ctcttatact ttatttatgc accagaaccc atttcgatat     45120
     gtgtctatta tacaacaaac gtacattcga taggtagtga agtaacagtt tatgtatgtc     45180
     gaacaattaa gatggcttcc tgccatccct tgtccgaagc caattcatct cccacctact     45240
     cacctcgcat tccttgagga aggagtcttc ttggctaaaa tgataaatac acataaactc     45300
     cttatatctc cagataaact acggaatagc tccatacaaa ctccagatag cgtatataca     45360
     ataacaacta tcaaggaggt taggaaaaat gaattttata aaacgcgcaa ttctcagtat     45420
     gaaaaaaaga ataggaacat cattaatttt gatggcggtc tttctgattg ttacaaactt     45480
     agtgctggca ggattcacaa tccaaaatgc atcaaaaaaa gctgctgatg cagcaagaaa     45540
     aaaactgggt gctgatgtta ctttaggtct tgatttcgat aaattaggaa aacaagcaag     45600
     ggaaactgga gaagcgccta atccgccgca gctcaataca aaagaaacag atcaattagc     45660
     gaagtccaag catgtaaaag actataatta tataacccat aatttcggaa ttgcagatgg     45720
     atttaaatta gtaggagttt cagaaggaga aggaaaagga aatggaaatg ctagagtggc     45780
     aacggcggga ggatcaggtt cgggtacaga aatagatatg aattcttctc ttatgataga     45840
     aggagttcgc aagactttat tacaagaaag ctttaaaaat ggaaaaaata aaatcgttga     45900
     tggaaaaccg attacagaac agatgcaaga tcagaatgta gctttaatgg aaaaacgatt     45960
     agcggaacaa aacaatttga aagtaggaga taaagttaaa gttcaatcag gggataaaaa     46020
     ggaaactctt gaaattgaaa ttatcggtat ttacgaaacg aatgagcaac caatgggtca     46080
     aaatccccct cctatgataa atccagctaa taaactatat atgccttact ctactttaaa     46140
     aaaattagaa gtagatgaag gtatgagtag tattcaagtt gtgtacttat tgaacgaccc     46200
     acaatacatt gatgcattta aaaaagaagc aaaaaaatct gatattgatt ttaattattt     46260
     taagttagat gcacatgatt cattgtacaa acaaatgatt ggtcctatcg aaaatatcgc     46320
     ttctacttct caaatgatta tctatatggt atctattgca ggtgcgatta tcttaggatt     46380
     aatcattatg ttatcgatta aagcacgtcg taaggaaatg gggattttat tgtccattgg     46440
     agagaaaaaa tggaaactga tggcgcagtt cgtagtagaa gtagtatgta ttgctatttt     46500
     agcatttgga ttatccataa caacaggagc taaagtttct caattcgtag gggataactt     46560
     actttcgagt gaaattgcta cagcaagtga agaaacagac acctcacaaa atagtactgt     46620
     aatggtggct ggacctggtg gtagtctaca agaccaaaaa aaggagccaa ttgataaaat     46680
     tgatgtaagt gtaacgggag aggatgtagg aaaaatgggg ggaattggac tagctattgc     46740
     tatattagca acgcttcttc cagcattatc tattctacgc ttaaatccaa aacaaatcct     46800
     tttaaaagat gaataaggag gctcgacatg gagacgattt tacaatttaa aaacttagat     46860
     tattactatg aaagtaacgg aaaaaaagta acgatactag ataatgttaa tttttctttt     46920
     caaaaagggc atttctacac gattttaggg ccatctggat ctggtaaaac cacaactctt     46980
     agcttaggtt gtgggctaga tatacctaaa aatggttatg tactatttaa tggaaaggat     47040
     attcggaaaa ttggcttgga tcgataccgt aatcaaaatg tatccgtaat tttccaatcc     47100
     tataatttga ttacctatat gactgctctt cagaatgtac taacggcaat ggaaattaca     47160
     ggtgtgaagg tacaaaataa aaaagcaaga gcattagaat tattagagaa ggtaggactc     47220
     acagaagtag aagcgaaacg aaatgtcttg caactaagtg gcgggcaaca acagcgtgta     47280
     gcaattgcta gggcactatc ttgcaatgtt gatttactta ttgcggatga accaacagga     47340
     aaccttgatg gagaaacagc aaaagagatt attgagttgt ttcaagagct tgctcatcaa     47400
     gagaataaat gtgtaattgt tgttacgcat tcacaagaag ttgcaaaaaa atcggatcga     47460
     gcagtgtatt taagtaaaaa gaagttagta gtaaacgaaa ttaataatag ctaagaaaaa     47520
     agctactttc gttcttaatt cacataattt tcaaaattaa aatctatgga tgttaatata     47580
     tgttatataa tatatttgtc aaagcattac ccctgtagtt tctatgatga atctgtaaga     47640
     tagtttgttt gtcccgtata ttcacctgaa actaaaaaga acttgtagag attcctacaa     47700
     gttctttttg ttttaaggat taaatgtgga tttgaaataa agttacgatt ttttgaagag     47760
     ggaaagtaaa tgggttctgt tgcaaaagtt tagcttagtt ttaaacactg tgcaacagaa     47820
     catagataag tatactttat tgttttaatt aaactacgat tagttgtact gtatgctgtt     47880
     ccaattcgga atacttctgc tttttcaaca ccagcatacg tattatcttc ggttacctca     47940
     ataatttcac tcaatggaat acaaaccttt gctaattaca atataattag taatttttct     48000
     tctatgtttt tacatcaata cctagcactt taccaaaacc ttaccatagt taaattacaa     48060
     attgattatc tagttatata aattgattaa ttaaaaaaca aactttttgc gctcttaaat     48120
     tcaattttca ggttctttaa gcaacaaagc atccttcgaa aaagggaaga aagatagtac     48180
     tggggcaagt tcaaatgaat aggaattgga gcgattttat cgatttctga caaaagactc     48240
     ctttcttaaa aatgtgaagg tgtaaaacgt caattttaag tgtgggatgc atgtcggctg     48300
     gtgtaagcca aaatgttttt taccatatac ttgtacagat tgatctttga aaactgaaga     48360
     tatgaggttg gttgcagaaa attcgttgca atcgtaaaat tttcaacgtc ctatcgtccc     48420
     gcgcttgccg aaattgcgaa aatcaagcta aagtagggag cgtggtgagg caacgtaaaa     48480
     gacacttcag ttcccaccat aggaactacg gacggatcct gctaagataa ctggtggata     48540
     caccgatgtt cacagaaatc tcccacttca aaaaggccgc aaagtcgtta agtgggagta     48600
     gttcaaaatc ttacagttat atttgagtat tcagcccatt tttcaatttt gctggtgata     48660
     tattgatggc gatggagtta gttctaagaa cctaagaaag ctttagaata ctattatagt     48720
     tgatcaagca catgaactag gcacctaatt atttcagaag atttctcgat ttggtctgca     48780
     tcaaaatctg aaaggttcgc attaagaata tgttttagtt tttcctccct ttctaaatga     48840
     caatttaaac caataggcgt aagccggact ttgacaactc tccggtcgtt atttgaacga     48900
     acacgctcaa cgtagcctgc ttgttgtaat ccattgatta attgagtaat accagcggcg     48960
     gtagtttctg ctcgatcagc taattctttg actgataatt cgccttcttc agctaatact     49020
     ttaagagttc gagcatggac cattgaaact gctcctaatg tacgagtagc tcgccctctt     49080
     aaacgtccat cggctgcagt cagactatat atggcctgac taagttcgtc tattgcattt     49140
     atcttattta tagaatttgt cataatatca ccattttctt attaactaag tacttaatta     49200
     tatggagtta acattaacat atggaaaaga gtagagtcaa attaagtata gatttgctgt     49260
     tcttttccaa gcaatagtat atctacttat tttgaatcct aaataaaacg acttagttta     49320
     tagacttgac aaaagtagat agtatacttc atcatattaa ttaagtactt aatcattaag     49380
     tacttaatta tattgtaaag gatgattatt atgactcaac gttcacaatc tcaaggatgg     49440
     gctttagata tagctcttgc acttggtggg tttgatgctt tgcaccctga agcaaaggca     49500
     actatggaac agttaggaca cgaccacact gattttgata aagtattttc tcaagtaaag     49560
     agtggagcaa tgataccaaa agcatgggcc acggttgctg ctcaagctca agaacgagca     49620
     aaacattatg aacaaaaagg atttacagtt actgcccgtg atttgtatca gcgagctgct     49680
     gttatgtggg gacgtgctca atattcatat tttaatgatg atccacgaaa attagcgttt     49740
     cgagagcgtt gtaatgaatg tgtggcagct atttcgtcac ttggaggggg aacggtacaa     49800
     cgtatagtat tagaatttga aggcaaacag atatatgcac tacttcattt accttcaggt     49860
     gaaattcgta atgcaccagc agtaatatta ggcccaggta tggatatgat taaggaagac     49920
     tatatacaga ttgcgcaacg ctattatacg tctcgtggta tcgtagctct atcaattgaa     49980
     ggaccaggtc aaggtgaatc tgtatcagga ggtctaaaag ttgatttggc taattacgaa     50040
     cgcgccgtta gttgttatat cgattttcta tcaaaacgac ctgaggttga tcccaatcgg     50100
     attggatttt ttggtatcag tatgagtggg tattggggga tgcgcgctgc tgcgagtgat     50160
     aatcgtataa acgctatagc gacctttgaa ggtgtatatg gcgaatttga taccatcttc     50220
     aaccgagcac agccgagttt caaagcaaac tttatgtaca tgtctggcta cactgatgag     50280
     gttgcctttg aaaacgagct gagtagccag atgaacctat ggaaattggc tccaaagatt     50340
     acttgtccag tcttcatggg tataggagaa tttgatgaac taacccgttt ggaagaagca     50400
     ttaagtcttt atgagcttgt agaagcacca aaggagctgc gcgtctacga gaatgaattc     50460
     catccgcttg gtggagtagc tgcagaaatt ttccgttttg gtgcagaatg ggtagaactt     50520
     gcacttgaag ggaactttaa aaatgactat gatgaacgtt attacatgca tcgtgatggc     50580
     ggtgtcactg aggggactgc atttccaact tattggcttg gtgctcagcc ggctgaaatt     50640
     aaagcacgta aaaaatgtaa cacattaaac gcttgtaaga gttaacaaat gtacaccgat     50700
     tcaaaaaaag atctgcagta agtagcagat ccttttttgt tgtgtatcta ttatttaatt     50760
     gctgttttaa ttattttccg gctttaaaag ctgttttgaa aaattaatca aacaaatata     50820
     gataattatt aagagaaatc attatttatc acaataacga ttcaattaat ttcataagtc     50880
     gttgttttgt ctggctcaaa taatttctgt ttttagaaga aattaataat cctataggca     50940
     tttggggatc aaatccttta accttaaatg atatattacc tttgtttaaa atagttccct     51000
     taggaataat acctattgca tttccaaaaa ccatttgtgg aataagatgt aatgcactac     51060
     aattgtaaat tcttttaaaa gataaattat tttctgataa aaaggcattc acagattgat     51120
     aataataaca actattctct ccaattaaaa taggataatt aacgatatcg aatacttcaa     51180
     ttgactcttt gtgtaatatt ggatggtgag ggttattgac aataaattca atttgttcat     51240
     tgtaaagtgg agtgaagttc atattggaac tatttttgtt gtttccgcaa acagcaaaat     51300
     caattttatt ttgttctaat agttgtgata aaagtgctgt attccctaca acaaaatcac     51360
     aatgtatata tggtttctca ttgtctaaat agtttaatat agatggcatt aacttttttg     51420
     caacagattc tgttagtcct attcttactc tccctttttc ctcattactt atgcgctgtg     51480
     cttgagatac tgaataatcc caatgcatta ataagttatc tacctccttt gcaaataaag     51540
     taccttcctc tgttaatcgc gcatcccacc ctcgttcaaa tagaaggaag ccaagttcat     51600
     tctccagctt ttttatatgt gttgttacag ttgattgagc atagtttaat ttttttgctg     51660
     ccagtgaaaa agtaccttct tcgacaatca tcttaaatgt atttaactct tttatttcca     51720
     tcttcacacc ccatcttcat cgattttatt gataattata cgatatattt tcaattatat     51780
     aaatcgaggt aatggaagta aaataaggtc ataagaaagg gagtgaaaat atgccgtttg     51840
     ttaatgttta ttatccagat ggtcaattga ataaagaaga gctaaaaacg gtaagtaata     51900
     gtattcatca ttcattgatt gaacatttta aaatcccaga aaatgattac tttcaattgt     51960
     ttttacctta tcctcctaat caattttatt acgatccaca ttatctctta gaaggagagg     52020
     aaaagagaac agaaaaaata atgcatgttt ctattacatg tgggccagga agaacaataa     52080
     atcagaaaaa gagtttgtat caatccatat cgaaaactat ttctaatcat ttaaacatct     52140
     ctacaacaga tatttttatt acattaaacg agacatctgt tgaaaactgg tcatttggtc     52200
     aaggtatagc acaaatggtt aatataaggg agtggaaaaa tagtgaatga tcgtatcgag     52260
     tccaatatac gaaagaaaat gagagatatg gctcccgatt ttgttgatta tagtgaaaac     52320
     atattattcg aaaaagtatg gagagatcct attttaacat ccagagaaag aagtttatgt     52380
     acactatctg ctctaattag tatcggtaat actgagcaac taccatttca tctacaatta     52440
     gctgaaaaga atggaattaa cgaaacggaa attattgctt tgataacaca tatggccttt     52500
     tacgttggat ggcctaaagc ggctgcaacg ctaaacatga tattgaacaa aaatgagaat     52560
     acggtatcta aataatcaat cttctataaa aaacaaaaat gaaatctgct agataagaaa     52620
     ctagtttgac taatccaaat gcaaatcgca gctaattatg atccagaaaa cttacgtttt     52680
     cgctttataa atcctatttc tcttgcaagt tcttctaaga atacaggtgt aacatatcgt     52740
     tgtaattctt ctgcaaatgg taataattca tcttgaatcg agagattcat aagaaaacat     52800
     catcctttct aatttagctt gtttagaaag gataacgttt tttgatattg gagggtatta     52860
     aaatctcctg agttgatggt tatgtatggt gaccccatag ccaaagaagt aagaagatat     52920
     ttagaagtgc attaaatttt gaggaagtgc ttgtgaaccg tatcataaat aaatgaggtt     52980
     ttgtatgttc gatttttaaa taatacccaa gaaggagtgg gttgcagtta tagtaatact     53040
     ctatttttgt atttctataa tagataattt tttaaaaaaa cagaattatc ttgacagtta     53100
     ttgaatggat tgataaggtt ataaaaaata tttcttatcc agagaggtgg agggactggc     53160
     cttatgaaac ctcagcaaca ggtctgctta agtagacact gtgctaattc cagcgggtga     53220
     taaccctgat agatgagagc ttccgttttt atttgtcagt agcgccctct tttttagagt     53280
     gcgtttttgt tttttctgga tagtaactaa aggagagtag aaatggagaa caaaaatggg     53340
     cgagaatttc aaaggaaaat gcaagcacgt catttagtga tgctatcact tggtggggtg     53400
     attggaactg gcttattctt aagctcgggt tacactattc aacaagctgg cccgtttgga     53460
     acaattctat cttatctgat tggtgcgcta gtggtttatc tagttatgct atgtttagga     53520
     gagctttccg tacatatgcc tgaaacgggc gcatttcata gttatgcagt taaatacatt     53580
     ggaccgggta cagggtatac agtagcctgg ttgtattggt taacttggac tgttgcttta     53640
     ggttctgaat ttacagccgc aggattactt atgaagcgat ggtttccatc aattaatgtt     53700
     tgggtatgga gtgctctttt tgccattttg atctttgtat taaatgtcct gactgttaaa     53760
     tttttcgccg aatccgaatt ttggttttca tcgataaagg ttatagctat tgtgattttt     53820
     attgttttag gagtagcggc aatgctaggg tttcttccga tgactcattc aaaagcagca     53880
     ccattctttt ctaattttac aagtggaggt ttatttcctc atggtgctac ggccattata     53940
     atgaccatgc ttgcggttaa ttttgctttt tcgggaacag aattaatagg cattgcagct     54000
     ggagaaacag cgaacccgga aaaaatgata ccgaaggcca ttcgaactac tctgtggaga     54060
     ttgataatct tttttgtagg aacaattgtt gttttatctg cgttattgcc tatttccgat     54120
     gcaggggtat tagagagccc ttttgttgca gttctagaac gaattggggt gccatattca     54180
     gctgacataa tgaatttcgt tatcttaaca gccattttat ctgcggcaaa ctcaggcctt     54240
     tatgcctctt ctagaatgct ttggtcgctt gctaataaga atacgatatc cccgattttt     54300
     ggaaaaatga cgaagcaagg tattccaatc aacgccgtca ttttcagcat ggtgggtgga     54360
     gccttggctt tgctctcaag tattgtggca ccagatactg tctatatcgt acttgtttcc     54420
     atttccggtc tagcagtagt tgtagtttgg atgagtatta gtgcttccca gttcctattt     54480
     cgcagacaat ttttgaaaga aggaaattct gaaaaggact tgatttatcg cacaccacta     54540
     tatccattag taccaattgc ttcttttatc ctttgtctgg catcgtgtat tggaattgca     54600
     ttcgatccaa cacagagaat tgccttatat tgctgcatac cgtttatttt gttttgctat     54660
     ggaagttatt atctaacaaa aaatcttaaa aagaggggcg tagattatgt cgaacaaaac     54720
     caacccaatt gatgctattt tatcccaaca ttccattatg cttcttgacg gagcattagc     54780
     tacagaattg gaggcgcatg gatgtaattt ggacgatccc ctttggtcgg cacgtgtgtt     54840
     actagaaaat ccggaactaa tttatcaggt tcattcggac tattttcgtg ctggagcgga     54900
     ctgtgccatg acagcaagct atcaagctac tattagtggt ttttccgcac gtggaataca     54960
     agaacaggaa gctttggaat taattaagaa aacggtgtta cttgcaagaa gggcaagaga     55020
     tgatttttgg aaggaaaata cgcaaacgaa taggcctaaa ccattggttg ttgcatcagt     55080
     tgggccgtac ggggcttacc ttgcagatgg ttcagagtat gtaggcaact atggtgtgac     55140
     agataaaaca ttagcagact ttcaccgttc gagaatgtct gcgttaatcg aagcaggtgc     55200
     agatctattg gcatttgaaa cgatcccttc cctgcaagaa gcaagagtat tagaaacatt     55260
     attgcgtgaa tttccagcaa catatgcgtg gctttccttt tcgctaaaaa atgagaaaga     55320
     gattagtgaa ggtatgaaac tcgtggagtg tgcacgagtt tttgagaaaa gtgaacaaat     55380
     tgtagcgata ggcatcaatt gtgcgccagt aaccgttgtg actggtgcaa tccaagagtt     55440
     gagggcaaac accaaaaaac cgattattgt ttatccaaac tctggtgaaa cttataatcc     55500
     agaaacaaaa acatggcatg gtcatgaaca atgtaacgcg ttggatattc aatctgaaga     55560
     atggtaccaa gcaggtgcac gtttaatagg tggatgctgc agaacgacac cttatcacat     55620
     tgaggagata tcgaacaagt ggcgttcttc cgagtttttc tattcgaacg aagcaaaaca     55680
     gtaatgtaat ggatgataat ctaactttgt gtgtattttc atgattttgc ttgttcagga     55740
     atctacagtt acgtctagtg gcacaaaatg tcttttcaga gacacaaatg tggatggtag     55800
     cctcgggaat ccagtggact tttgggtacc ttaggtatgg aaaggaatca gggaaaataa     55860
     aaaccgctag tttaatagat atggtagaca acacgctgaa tcttttaatg aagatgtagt     55920
     tgatccaatt gaaggtgaag gggaccattt attcgtaatt aaagttaacg aagaggttaa     55980
     tttagttatt caaaaaatag ttcaataact atatgaaaat ttgttgtagt agtgaatgtg     56040
     gtcatattgt tgtaaaaaag gatagatgta aacaggtata ctctcctgtt catctatcct     56100
     ttccttttta ccttataaaa tgtgtgacat tatattcaat cgcataaata taggatttca     56160
     ttactatttc cttgactttt aataaaacga tagggtttat ttggtatgcg tattattaag     56220
     agtatgcttc tattttagga atgctttacc ccacaaaatg aaagtacact ttatttccat     56280
     tcttaagttg atgggtatca ccacatgtct atcaagctaa tattttaaag tgtctccgaa     56340
     ataaaaaatt tcttcgtttt gaggaactac caaattctta tgttgataga tgtggggtag     56400
     caccacatgc ccatcaagct aagattttaa agtaccccct aaatggaaat tttgtgttat     56460
     tatagcaccg aagtttattt ttatcgtttt ggagaacaac agattttttt aacttgatag     56520
     cgatgtgatc atgccctttt ttagagtcat actattagta tatccaagat taggagatta     56580
     cttgcaagag tcttggaagt attgcaacgg tgctgtgtta tacttctaaa gtactaacat     56640
     ttcatgtagg acttatagat gtcggtatga catatgaaat gtaaaatcaa tctgttattt     56700
     tgagggttca ggctatcgtt atttaaacta acattcacac taaaagaagt acaaggagga     56760
     aggtatatct attaaaatag tgaggtatac caaattagaa atgaacatta gatttaataa     56820
     aaaagtagta gcattcacgg caggattaac ggtattatct tcaccattgg tatcgtttgc     56880
     agaggaacaa caattagtaa acaataagca acctacaaac gttcaggaac aaagtaaaac     56940
     aacatcagat gaacaggctt taaaaagtat tgaagctagt tttgaagagg tagacggacg     57000
     tggtggaggt actgtcgaca ataagaaagt agatagtctt caacgttcag aaggtattca     57060
     tgaagaaaca ggtacactaa ctgttcctaa caattcaaac agaacaaaac gtagtctgtc     57120
     tcccatatca cctagcacct ctagtacaat aaatggtgtt ccattcactg aatggattgt     57180
     tccagcaggt aacgataata ttcgtcctca aaactatatg agtccaaagt acattacaat     57240
     tcatgagact gataatacaa gtgtaggagc aggtgctaga aaccacgccc aatacctata     57300
     taaccaagca gtaggcaaca cagaccgagc tgcatcgtgg cattttacag tagacgataa     57360
     agagatttat caacatctac cattaaacga gaacggatgg cacgcaggag acggtgatgg     57420
     tccaggtaat agagaatcta ttgcaattga aatcgcagtt aacagtgacg gtaattatag     57480
     taaagcggta gataatgcta agaaacttgt agcttattta atgaaagaaa ctggtgtacc     57540
     gttaaataac attgtaaaac accaaagatg gagtggtaaa atatgtcctg ctaatatgat     57600
     taataatgga caatgggatg cattcgtaaa tggtgttggt gggtattata ataatcttta     57660
     tcaaccaaaa gatgacatta ctggaggttg gtatgaagaa gctatacgag agttaaatag     57720
     aaggggtatt atgatagggg aaggaaacgg agttttcgca cctaatagag cgataacaag     57780
     agccgaattt gctcaattaa tctctaaatc tctaaacctg ccagctggag atgcttcatt     57840
     taaagaccta aacgatgcaa actcaacttt acgagatggt attaaacgtg ctgcaagtgc     57900
     aggtattatt ctaggtagag gtgatggtta ttttgaccca aacacaccta ttacaagaga     57960
     agaatcagca attattgtaa acaaggcttt acagtataaa ggtatatggg gaccagttgt     58020
     aaacctacca ttctcagaca aagaccaaat tagctataaa gaagacgtac aaagattgta     58080
     tggcctaggt attgtaagag gtaagggtga caatcaatac gaccctaaag gaacaacaac     58140
     tcgtggtgaa acagcaacat ttattctaaa tatgctacaa gtaattgaaa atggtagtgt     58200
     tgaaaaggta attggaacgg ctcaaattaa tggtattggg gtaaatgttc gaagcggatc     58260
     aggtacaaac tattctattg ttagaaagac aagtaaaggc gaaaaagtta cagtatatga     58320
     agaaaagaat ggttggctaa gaattggaac aggtcagtgg atttattatg actctagtta     58380
     tatcgactat aacagattat aaaagactaa atagttaaaa gaacaggtca tatttggata     58440
     tataacttaa tctcaggttg tggagaaagt cttcttcaca gcctgttttt gtgtctggcc     58500
     ccctctttac ctaccaatac tgataaaaag aggaaaagga gagattcatt atgatgggtt     58560
     gcatcgaaaa atcaccgtgt atacaattta aacactaatg tttttctaat aattaagtag     58620
     ggatcaccgt acatgcctat ccaactcata ttttgaaata cctcaaaacg aaaaaatggg     58680
     cttttttgtt acaagttagc acaaaatttc gttctggggg tactataaaa ttttagcttg     58740
     atagcgatgg ggtatcacca cattaactta aaaaatttat aacgccccta aaacaaaaaa     58800
     ttgacatttt catctagaaa tgtcaatttt ctcgtttggg ggtatttgct tttcttatct     58860
     tgatagcgat gtggtgctac accatgctgc ccatcaactt aagaatggaa acaaaatgta     58920
     ctttcatttt gtgggggtaa agcattccta aaatataagc atacttttaa tcatacgcat     58980
     accaaataaa ccctaacggg tttcattttt ttagatattt tgaagctttt gcaccagaac     59040
     tagatttaca actcttgata aactactgat tatctccatg tacactccag atttagggct     59100
     tatagtgaaa atattaagtt gggaatatcc aggtgacata aaaggagaaa ggagtgttta     59160
     taatgggaca ctatgataca aaacaaacaa gaaagaacaa aagtagagac ggtaaaaaaa     59220
     ctggttattt ttttattgga ataattggtg caatgatcgg gtcaattact attggcttga     59280
     ccactccata tatagatgag atcaaaggaa gtacaggtca atccgctaaa aataacgagg     59340
     tgaatcaggt tactcctatc tcgcacaaac cagaaggtgt gaatagtctt caaaatatga     59400
     ttgaagatgc aaaagaagtt gtagtaggtg tcattaacta taaacaaaat gcagattcat     59460
     ttaatacgca agaccaatca gaagaagctg gttcgggatc aggggtcata tataaaaaaa     59520
     acggcaataa ggctttcatt gttacaaata atcatgtgat agacggtgcg aataaagtag     59580
     aagtgaaatt gaataacggt aaaaaggttc ccgctaaagt agtagggaca gattcattat     59640
     tagatttagc ggtattagaa attgacggaa ctgatgtaaa aagagtcgca acacttggag     59700
     actcagataa aaatcgtaca ggggaaacgg taatagccat tgggaatcca ttggggctag     59760
     aaggaagtgt aacaaagggg attattagta gcaaagaacg agaaatacct gttagtacac     59820
     ttggaaatca acaagtggat tggcaagcac aggtaattca aacagatgca gctattaatc     59880
     ctgggaatag cggaggagct ttgtttaatg aacaaggtga agtcattgga attaattcga     59940
     gtaaaattgc acaacaagca gttgaaggaa ttggatttgc aatcccaatt aatatagcca     60000
     aaacaaccct agggtttctt gagaaagatg gaacagttaa acgtccaatg atgggtgtac     60060
     agttattaga tgtagagaaa atgacagatt ctgcacgtaa tcaattaaaa ttaccaaaag     60120
     agatatcaaa tggtgcagta ttgggaaata tctcaaacca atcaccagca gaaaaaggag     60180
     gattacagca gcatgatgtt gtgattgcat tggatgaaca aaaaatagaa aacgttgttc     60240
     aattccgcaa gtatttatat gaaaagaaaa aatcggggga tacaattaaa gtgacagttt     60300
     accgcaatgg tgaaaaaata acaaaaatgg tgaaattaac agagcaaaag tagtctgatt     60360
     ttgaacagat cactcctgta aattgattta accttttttg atcatataca cacgaattca     60420
     attctagttc aaactatttt aggctcatct ggaactggta aagtcaaaac ctttagcttg     60480
     gtttgtaggt tggatacatc taatattggg taagtattgt ataagggtat tttaaaaagc     60540
     aataataaac aacctcccca attgttaggg gaggttgttt attgttcaga tattggaata     60600
     ctaacaacaa attgtacacc ttgttctaca ttattaatac agtactctat acctagtgct     60660
     tcaaaaattt gttttacaat atataatcct aagccactcc caccagtatt tcgatttctt     60720
     gacttttcaa ttcgataaaa tggttcaaag acatgttgta tatcattttc tttaatttgt     60780
     acacctgtat tgataatttg aattaagata catttttgtt ttgagtcctg agttagctgt     60840
     atatatacat tctcgctatt cggagaatac ataattgcat tatgaataat atttttacag     60900
     gctttttcta aaagagcccg atctgtatag acagaaaggt tagaatcaat ctgttttatg     60960
     atttgaatgt ctttttgaga agcaaaaaaa ctgagatctt ttgtgattat atccattaac     61020
     tcggagagat ttatttcttt taattgtagt ttaaatgtat gttgttctaa tttagacata     61080
     cttaaaatct cacgaactag attttccatc ttttcgataa tttggtggtt tttctttaag     61140
     tattggtcac gatcttgata aggaccaata ttatatatca tcccctctaa gtatcctttc     61200
     ataatagtga gaggggtttt taattcatgt gatacagttg caaaaaattc tctgcgtttt     61260
     gtttctattt ctctttcttt ttcaatatca ctttttaatt gctgatttgc tttttgtaaa     61320
     tcaaacatag tttgttgtaa attaatggac atatcattca agctattaga tagttcccct     61380
     aattcatcca tagaacgaat ctcaattttt tcggaaaagt ctaagtccgc cattttttgt     61440
     gcccctcgat taatataaat gagtggcttt gtaatgaacc ttgaaaataa ataagcactt     61500
     cctatcccaa taacaactac aataatactg atatagggaa ggaaacgtac caaaactttg     61560
     gaagcctcat caataggttg aaatgttgcg tatactatga cggtttggtt accatcctga     61620
     aatggaatat catatgattt gttcaggcta tttgaacccc ctattcgtgc tgcttgagta     61680
     acacttcctt gaataaatgt ataaggagta gaataaacgc ttactctttc gtaatctgga     61740
     aatctgagta ttgcattatt tttttgcata tactcctcaa aaagcggttg tgcattttga     61800
     aaagtaagat tcttagattt atcaattatt tcttccattc cgttttcaag ctgctctgtt     61860
     ttatattgtt cataaaatgt aggaagaaaa aagtataaag ttaaataaat catgactgca     61920
     aaggctaaca aaatgaggga tgtagtcata aaaagtttat aagtaattcg cttcattttc     61980
     atgattttta cgatcctatt catcgatttt ataaccaatg ccttttattg ttttaatgta     62040
     tgggatatct aatttttttc gtatgttttt catatgtgta tcaattattc gtgattctcc     62100
     aatataatcg tatccccaaa ctttttctac gatgctttct cttgggagta ctcttttctc     62160
     attttgaagt agtagttgca gaatttcgaa ttctttcgtt gttaaggaga tttcaacttc     62220
     atttacatat actttatagg cgtcgacatc gacacgcaat tctttaaaga cgaaatgatt     62280
     atctaagctt ttatcattgc ttcttcttag tactgcttcg actcgtctaa tcaaaacatg     62340
     aaaagagaat ggttttgtaa tataatcatc gattccaaga tcaaatcctt tcatttgatc     62400
     ttgttcttct tctaacgcag tcagcataat aactggcaca tttgattgac ttcgaatcat     62460
     tttcgcaact tcaaatccgt taaggtttgg catcatcaca tccaaaagaa tcaaatcaaa     62520
     ggattgctta ttaaattgta tcattccttc taatccatct gatgcaactt caactgtata     62580
     ctgttgtgtc aataaaaatt gtttaattaa ttcctgaatt tcttggtcgt cttctattac     62640
     aagaatatga tggttgatca ttatatcacc tctagttgcc attataactt tactatctgg     62700
     agtttgtatg gagaagtact agtaaacaat ttaaagactt cacaggaaaa ctatatatat     62760
     ttcaaattgg ctccagattc aagagatata atacctacat aacctataag aaagaaggag     62820
     gtaagcaaaa tgtcacttga aacagacata attctttctt tatttgatat aaaactgtgg     62880
     atggcccatc attcggaaaa tagtcgctta aaaataaaaa aacaaaaatt aaaatcagaa     62940
     ccgtacctca ataagtcttc aagtgttaat aaaagaaaac tataaaagct gagggaataa     63000
     agattcaaca ccaatgatta tcaataattc aaatgctaat gattataata aaaaagaacc     63060
     ttcaataggt tcttttttat aattggtaaa tatgttatca acaatagatg gtaataaaga     63120
     tagaaattca gacacttttt attaattggc taagttttct taggaagaaa tctttttctc     63180
     attactgatc gctagatata acaggacata tcatttatta atttgggtgg gtgatttagc     63240
     tttttgagtt taccacgcta aaatgtaaat tttgcttagg gacaaaatgt taaagttcta     63300
     cattctgaat taacagaaaa tttaggtggt aaaaatccca ttgaatcttt tatcaagtaa     63360
     ctcatatttc tttggcctta ttttcatggt attaccgaac gtttatatgt ctctaaggga     63420
     aagaaatact attaccatct attgtttgat taagatggta acacgaaaat aaaacgttta     63480
     caacaaaaaa ataaagaaaa gatatgaaaa ttcgactttt ttcgacaaaa tgattgagtg     63540
     agaaaaaatc taaattaagt aaatcttata tgtagagaga ttctttatct cataaataac     63600
     agttataaca tatgtaaatg ttctataagt aattaaaacg tcgaagataa aattatattg     63660
     tgacaattat aaacaaaaca tacttaataa ttcatactta cactaacaga tcaattcata     63720
     ataagttaaa tacgctatat ttaatagagt ataatatgga atattcaact ataatattcc     63780
     atattatata taattataaa tcatttaaca tattagttgc gggaaatttt gacataagat     63840
     attttaaata ttaagcacag aaacatttta aagaaaaaga gctattttaa aatgtaccct     63900
     aaaaacgttt ttcctaaaaa gtagtaagaa tttttaaatt gtttctgtgc ctaattagat     63960
     gaaaataata taataaattg tttaaaaaag ataaaagcaa gttactttta cggagaaata     64020
     tacattccat accattagaa ttatgtcaga tcgtagcata caaattacat tcttctatct     64080
     tacaaactgc acaactacca ttataggtaa cttgtcttag ttttaacatc acattcatca     64140
     ttattttgtc caataagatt aatatggtta gaaaaacgtg ccgccatcta ctatgaaaat     64200
     attagcaatt aggaagaatt atttataaag taatatagaa ataaaattat ccggttgttt     64260
     ataagtgaat ttttaatatt tttggcgttt ttcaaagggc tttcacttat atttcatatc     64320
     atgaggacaa ttgttgtgtt gtttgaaggg aagggtatag gtgttaacag ttcatttgta     64380
     tataaaaaat aaacaacctg ttgagtgtat aataaaatat tctttaaaat aatttatgaa     64440
     tacacacaag tgatgttgag ttatttattc aaagtagaac ctttaataat ctataaattg     64500
     ttatataaag aaataagaat agaggtattc attatgaaat ttataaaagg gatatttgtt     64560
     tctacgattg cacttacggc ctttacagga ttagagctaa ttaaatttca tgaaaatccc     64620
     aatgtagtgt atgcagattc gaaaggtcct gtaaaaaata taagtcaatc tgaggcagat     64680
     attaaagaag aagatcaaat tattgtaaag tttaaaagtg aagtgaattt cccgtataag     64740
     gatggacttg aaaaacaaat aaaaaacgaa gatagcgatc tggaattagt aaaaatcttt     64800
     tctgaatttc cacagctaac attaaaacgt ttatttacat ctgtggaccc aaaagagatt     64860
     gaaaacatcg ataaacatac gagggaaact gaaaataatt catcttctaa tttactagat     64920
     tattatattg tagaagtgcc taataaagta acagctgaaa cattgatgga caagtttaag     64980
     aaatcttatc ttgttgaaga agtatatatg caagaaaaac caactctttt accagaagta     65040
     caattaccta ctgtatcgct taacccttac gacgatccaa gatttttaaa ccagggatat     65100
     cttaaggaag caccatatgg gattaatgca tcttatgcat ggagcattaa aggtggagat     65160
     ggaaaaggaa ctacttttgt agatatggag tatgggtggt tattagacca tgaagattta     65220
     gtaaatcaaa aagttgagct tatatctggt agaaatatag atcaacacgt tgggcacgga     65280
     acatccgttc ttgggattgt ttctgctgaa gataataagg ttggtaacat aggaattgca     65340
     tcgaaggcta aggttaaagt agtatcccaa ataagaggtg atgggtcgta taatacggct     65400
     gatgcgataa taaatgctgt acataatttg caagctgggg atattttatt attagaggca     65460
     caagcttctt atgatggata tggagataaa tatttacctg ttgaagtaca gccagatatc     65520
     tttgatgcaa tacgagctgg aacggataaa ggaattattg tgatagaagc tggggcaaat     65580
     ggttctaatg accttgatca atttagagat cggaatggaa aacaggtatt aaatcgcaat     65640
     agtccggact ttaaagattc aggagctata atgattggag ccgcatcgtc aactgttcct     65700
     cataaacgtt tatggttttc aaattatggt agtagaattg atgtttatgg ttggggagaa     65760
     aacgtagata caactcgtgc tgagcctaat aggattacta aaaatctcta tacaacaggc     65820
     tttagtggta catctagtgc ttctccaatt atcgctggag cagcgacttc aatacaaggt     65880
     gtggctaaag aacatttagg tcgtccatat aaaccagctg aattaagaaa tatacttagt     65940
     aatccaaata caggtaccaa atctcaaaat ccgttaacag ataaaatcgg tgttttgcca     66000
     gatttaaagt caatcctgtc aaatttggga tatagtccag atatatcaaa taatgtttta     66060
     gagggaaacc aatttgtatg gtcaatgaaa ggaataggag attttgagtt tgcaaaattg     66120
     gattttaata agacaaaaga agaaatgcaa attcaattaa aagcaggtgt accacatcat     66180
     tactttgata gtacatatgc gagtgtgaaa gtccaaaatt catctggaaa agtggtatat     66240
     aataaagata tttatggaaa caggcaacaa aatgctgaaa cacaaaaaat ttcgatgaaa     66300
     gtcggagact atattgagtt tacacattta gagggtggaa accgggcgac tcttataaat     66360
     gtggataaaa atatacagga gagctttggt aagaagatag tgtatcaagt tacagttaat     66420
     ggtcttaaga aagttgatca aattattaac cctagcccag atacggaagc tcctacacgg     66480
     cctgaaggat tacaagcagc caacattact gcaaatagcg tagagttaaa atggaattca     66540
     tcaacagata acgtaggtgt gaaagaatat caagtattac gtgacgggaa attcattcaa     66600
     atggtacagg gaaccacatt tactgatagt aaactgactg ctaacataga atacaaatat     66660
     actgtgaagg ctatagatgc agctggaaat cagtctattc aaagtagtgt tcttagtata     66720
     aaaacaaaag agcaaaatac ctcttatgaa aaatgggatc cgaggaaagc atatacaaaa     66780
     ggggatagag tagagtatca agggaaaatc tatgaagctg ttcaaagtta ccaaggaaat     66840
     ggagattcga attggatatt ctcgttatcc ttatggaaaa caatttcaat aagttgatga     66900
     tatcgtctat ttgagagaat aattatttca taactagcta aataattttt atctcataag     66960
     aagaaggcgc cttttaggtg cctttttctt atgaactata ttatccctta atagtgaaat     67020
     ttcttgattt aagtagctct ttaaggtatt gagtggaagg tattttaaaa tgctaaatag     67080
     tatcaatatc aacatttata atgtaagttt ttttccgaaa tatcatattt tggaaaaaaa     67140
     cttacattat agtagtaata tttaggattt tacaataaca aactggatat tccataaaat     67200
     gtgataaaat ggaataaatt aaatgttatt acatgagagc aaaggaatta ctctaaaaat     67260
     aaagatacat ttttattttt aaactgtgta gaaaattaat tttcagccag tatgttagtt     67320
     gggattttta atattgctag aaacagaaat tttatagatt tggaagaaga ttcatttgat     67380
     acagggcttg ataataaaag ggcaagcaca ctaatgtcta tttgacttct tactactacc     67440
     ttaagaataa gtagaattca accctgcatg acaatcttta tatacataaa aaagatctat     67500
     gacctgaaca tgtcagtaaa ctgctcgata aattacttaa atctgaaagt aacacaagta     67560
     aagatttttt atctttctcc gacagaacgt taagtcgaga gtaattcaag ttttattatc     67620
     acgttacaaa atactataaa ccaaagtagt atgtggaagt aaatatttac cactaattac     67680
     acgaaagaaa attatgaaaa tgttttaaaa attaacggcg aatatttaaa gattaatagg     67740
     aggaatttta aatgaaaaca tttggaaaaa tattgttaac agggacttta gctcttggtg     67800
     gattaacagt aatgaacgtg gaaacaccta aagctcaagc agagggagcg agcgaatttt     67860
     gccgatatat ttgtggtcct aaagaaacat tgaacaattt tacaattcaa ctttcagata     67920
     cggaatacag aatgggacaa aatattatcc tacgcgcaac aaatgataac gcatatgatg     67980
     taacatacaa agcaactgta gaaaaacaat atgctactgg ctggggttat gttgaaactg     68040
     actttaatta tcaatcaatg ttgccagctg gaacaaatga agatttcaat gtttggactt     68100
     ttgacggtaa cagcgcaggt aatttgaatg aggcaggaac atatcgcatg aaaattgaag     68160
     taacacatgc tgatgggaaa actgacacag tttacactgc gccaattaca ttattagcac     68220
     aataataatg taattggcag gaatttaaag tgtagttttg atagtgaagc tatcgatttt     68280
     ataaaatgct ggattgatct tagtagtaaa tgttcctttt ataaaaagat gttaccaaag     68340
     ttgattaatc ttatttacct tataagaatt ataaggtatg ataaatgtag gtgcaaagat     68400
     gcactatttg aaaaagagtg taagacaaaa aaggaatcta taaaagattt cttttttttt     68460
     tgcgtgtagg ttcgcttcat aaaaaagaac agctagcaaa agctaactgc tccaatcatg     68520
     gaaatgagat tgtatagagt attgacggaa tatttatttt aaatttaatt tctttaaagt     68580
     aaacattcca gttgatataa tggctgcacc aactacagaa cctaaccagt ctctccaacc     68640
     taaggcatta aaaggtgtat ctgttaagcc tataattaag aagatagcaa acgtcaatac     68700
     accgaatgct aagcatcccc aaaatgtttg taaagatttt atcatcttct ttcgaaaatt     68760
     tatcctataa tatcattatt gaaaaaaata gatggaacga aggggaaacg tattagcgag     68820
     tgctaatgag gttctttctc cgacattgct tgctaaagaa aaattaatag ggtatagaga     68880
     caaagagcct aataatgcat tatataacgc agctatcaat atcaaaaatg aagcaatacg     68940
     cctattagcg ttagcataaa tagcaataaa ataacctttg gaacaaggga gttagctcgg     69000
     ctgtcttagg acgaattcgt tagctatcaa aagtaacgac taaccgagaa gcccccactt     69060
     caaacagtcc gttaggacgt taagtggcgg gtagttcacg aacttatgga gaagaaaaat     69120
     attaaaagaa atataggcgg ataatggaat aagcattttt attttatttt ttatagagca     69180
     taaacaagtt attacaatta atttaattta gaaagagcaa atttagctgt aaaattcatt     69240
     tttttcatga acgaagaatt tgcacctgct tggaattgta ctgaaatatt accatctttt     69300
     tgtgctgtaa atacgcggcc atatggcgaa ttagcattgt atgtgccaat tacttggtta     69360
     tctgcgtcaa agactgtata agagattggg aatcctgaat ttgttataaa gacagtaagt     69420
     tcttcaccct ttttaaggtt aaaagattcc ttttgagaca cttcataaga actcatagag     69480
     taatattttg taatctcttg aatttctaaa ttcgtagatg ctgcactcgc ttttgttgct     69540
     tctacccctg gtaaattcat acctgaaagt actgcaattc ctaatgcgcc tgctaaaatg     69600
     acttttttca taacgttaaa tcctccttta atatttttga aatttgaaag gtaaatgaaa     69660
     atataaccta ctgaaaccat tatagttaca acgataacta ttatcaatac gaaatactat     69720
     gcaattttgc atacatgaag tacagcaaaa ggccaatcaa tttaaatttt gaattattct     69780
     taaaagagga agtacatatt tttaaggttc tccgtaggaa tgtagttaat ttttgctcct     69840
     tatgggaaaa tgcatagttg aaatttaata acaatgtaag ataggtgaga gaaaaagcct     69900
     tagatgaggc gtaataaagg cagcttttaa ggtaaaacaa aattaaatga atagggatta     69960
     atacgaataa atggcacttt aagaagagaa aatagaagaa ggcatgtata tgtatcttta     70020
     tgaatctcat ggtgtttttt gagaagcatg ttttttactt aagaacatta aaagatgagt     70080
     agtttttaat agatttttaa ggggaaaata taagaaaaag gaaggtgtaa tccttccttt     70140
     tattatccag tatgtccatg tgaatatttg ataatattta ccgtactttg agtacctgtt     70200
     gaagaactcg atccaaaagt tactgtgaca acaattaaga taccaagtaa gctaaccgct     70260
     aattttctca ttttaatgct ccttttatat agtttttttc actggctttg ctagcttcat     70320
     aaaagtaata gcttgctttt acatgattat tttctttgta aaattgggtt gctaattttt     70380
     cagtatattc atttatatat tcatatagtt cttcgcgttc aaaataggaa attccttcta     70440
     agatagcttt ttctacatca attgcacaac tatttaggtt catttttttc aaaatattaa     70500
     agtgatgtat ataactttcg atacctaact gagtggaaag ttgtagccct ttttcgatta     70560
     gctcttgagc tatttgattt tctcctaatt tataatgttc tcttgcctca ataaataaag     70620
     ctttataatc actggctagc ttttgattaa cctcagataa atatcgtaat gctaactcag     70680
     agaggttttg tgtagcatac ataaatccta ggttatgacg gacaattaaa atattgtatt     70740
     ctaaattttc tttctggaat gtatccatcg ctgaaatata atgttcctct gctaattccc     70800
     attctcttaa atgagtacat gccagcccgt ataagttatt gcaaaaggca acttttaatt     70860
     catatcccat gtgttttgaa aaaatatctt tagctttcat aacatgatta atacatagga     70920
     ttgatttatg tgtatggcag tagaaaacag ccaattcata atgaaattca gcgtattcga     70980
     tttcgtcagg tattgtcgat aataaacttt cagctttatc aaaatgtatt cttgcaagac     71040
     tatgattacc cataacattt gagtggattg ctttaaagaa gtgataatag tatgaaagga     71100
     agtcatccgt aggagtctcg taagcatcac tttttttaaa actatcttta gaaatactca     71160
     aactatcaat tagatattgg tgtctaaaat ctagaagtga gtagtataat agtatggttt     71220
     gattttcttc tatatcgtgg attttgtttt caatttcttg cttaagtaag tgagcggcgt     71280
     ctacatgcct agctctaatt tcttgatacc attcatttaa taaatgagtt atttgttcgt     71340
     tcccctttat ttgaacattc attgttcagt ctcatcctct ccatagatac tatacagtaa     71400
     ttagtatcat agcagagttt tactctatta aaatctacca aacagtattt ttcaacacaa     71460
     gacggaatat tctattaatt tatttgttta tttgaattaa tttcgactta aatagtattt     71520
     attattgtta ttttcaaaaa ataatcactt gtttaagcta taaagcagat atgaaatata     71580
     ttttctcaac aggataaaag gtattcatct ataagtacta tgtataagga taataggaaa     71640
     atagaaataa ataataaagg ggaatgtgaa atgatagcat taaaaaatga tcgaaatgta     71700
     aaagaaattt cggaagagaa cgtagattta ttaaaggtta tggcgcatcc agtacgatta     71760
     caaattgtaa atgaattaat gcatcataaa aaatgcaatg ttacacagtt aacggaaata     71820
     ttaagactcc ctcaatccac tgtttcacag catttatcaa aattgagaag aaccgtactc     71880
     cgtacagaaa gaagaggatt agaggtgcat tattatattg ataatgctaa agctcgtcag     71940
     attgtaggaa ttttgggttt gtaggttaat aatatgcaaa aaagtttcct gttataaagc     72000
     aggtgacttt tttatattta tatatagtaa ttttattttt gtgaggatta ctgtgtaaat     72060
     aagaaaatat tgctcataga atttctgtac atttgaaagg agtgtaatga gataaggtct     72120
     acttatttat tttcgataga gcttataatt atgtttatgt tattaaattt aaaaaaagaa     72180
     ttgacttctg ttttagttgt aactattata gttacataaa ggttgtaact taattggtta     72240
     caattcattc tgctttatgt aaaaatacgg ttagtatatt tatttaagga aggtggccca     72300
     cacattgtcg ctcagtctag aaagtcacta aaagattaaa ggaaatgcat attccaaact     72360
     atagtatttt ctgctttggg gcaataatgt gtagcgttat cttttgttaa aaatcttagt     72420
     tgattttttt gaaagggtta gttttgggga aatatagtaa ggtagctcat aaaagaacaa     72480
     gatataaaaa agatgtactt atataaacca aaaagttagc tgagaatttt aagtgatagc     72540
     tggactggtt aataaaaata aaggtaggag atttaaatga agacgaaaca agataatctt     72600
     atatacgtat gggacgcata ttgtggatgg tgctatggat tttcagaaag tattaaagga     72660
     ttttacaaag aacacactga agtgccgtta acagttttat gtggaggatt atttttagat     72720
     gatttaccaa taaaaaattt ctcatatata gaagagggga ataaaagaat taatcaactt     72780
     acaggtgcag aatttggtcc ttcatatcaa aaattggtgg aagaagggac ttttaaaatg     72840
     aattcgaaag atgctgcaat tggcttttcc gctttacgtt cattagcgcc agaccgtttg     72900
     ttagaattca cttcggctat gcaaaaagcg ttttattatg aggggaaaag tctaagtgac     72960
     cctgaaacat atcgtaagat tgcaattgag catggtgtgg atcctgaaca agtaatagag     73020
     cgtttaaatg ctcaagaaac aattgtagat gtacaaaatg atttcaataa ggttcgacag     73080
     cttggtgtta atagttatcc ttcattactt ttacaaaagg ataatcaaat tatccctatt     73140
     ggtggcgggg taatgacgcc agataaaatc gaagcacgtt tcaaaaattt atattaaaaa     73200
     actttaagtt aaagtatata acatttaacg ttttaaaaaa gactagaagt ggatggactt     73260
     aaatctttct gataacagtt atagtttcta tttgttatta aagaaggtcc aattatgatt     73320
     ttactataga tcacagtagc aaacatgtta gcttacgcca accgacatac atctcctatc     73380
     tatttgctgg tgcgattaac tatgcagggg aattgaggag gggctttctg tcggaacaag     73440
     ataaaaatgt gttatctatt caataacttt aacaaaagga gaataacatt ctatgtttaa     73500
     aacaatcgat acaaatctaa atgatgtaaa attgacggtg tttagttcgg atgaaaaaag     73560
     ttttatggta actgcaacct tagttgagaa agcaggacat gcatttttaa taaactcaaa     73620
     atttactcaa tctgattcga aagaaattgt ggattatctg aaaaacaata acttatccct     73680
     agataaaatc tttattatac atggggatcc tgattattac tttgggttag aaagtattaa     73740
     agctgcttac ccaggagcca tagcgtatgc aacagagtct actgttgaac atattgttca     73800
     ttctgtatta gggaaattaa aagtttggaa agatgtacta ggagaaaatg caccaaacaa     73860
     tgtggtatta cctcaagtta ttaaagagaa aacaattgat tttcaaggtt taacatttga     73920
     acttgtaggc ttagatgatt acagaactag cttatttaat aaagagctaa aattattgat     73980
     tggaggcatt gatgtattta acgaaatcca tgtgttctta gcagatacta gctcaaaagc     74040
     agcaatggag gcatggattg agaacttgaa agtattacaa gcgttaaatg ctgacattat     74100
     tgtaccaagc catggatcaa tcgaaaaatc cttagataat caagcgatta ttgcaactat     74160
     ggattatcta agaactgcaa ttcaagcttc tgaggaaagt aaaacttcaa aagattttgt     74220
     agcaaaactt gaaacagcat atccaggcta tgctaataaa ggtgtattgg aattaagtgc     74280
     aaaagttgta acaaaagaaa tgccatgggg ttaatgctat gaataaatat caaaaactat     74340
     tacatgaaac gtatgtattg actggtgaag ggaaaatgga tgctttcaaa gcgtatttaa     74400
     atgagaatgt atcttggaca gaagctgctg ggtttccata tgcgggcact tatataggtc     74460
     ctgatgaagt agtgaaaaat gtacatgaac gtcttggaac tgaatgggat aactatagcg     74520
     ctaaagatga aatttatgct tttaataaca atactgttat cgtgtatgga aaatatagtg     74580
     gaacatataa agtaacaggg aaatcattca tagcagattt ttgtcatctt tatgagtttg     74640
     atgagaacga taaggttaag aagtttattc aaattgtgga cagtgcaact gttaatgagg     74700
     tattaagtta gagttaccag tttcaaatat gcctcgtata aggagtattg ttaggataga     74760
     tggattttcc taacaatatt tcttacatca cattctggga aagatttttc ctttattaag     74820
     cgtgttatcg aaggtgaatt ataaaattaa aagaggtaga tatatatgaa attagagaaa     74880
     aatttaataa taataattat ttctgtgttt attttaggaa ttgtgtcgac tttgacattt     74940
     caatccttca ttggtaatgc caaaggtaac tcaataaaga gcgagaatgt tgcaccagta     75000
     tcgaaagatg atgtggcaga aaaagaaaag aataaaaaga tggtagttga tttctataat     75060
     gaagttttta acaaacataa tatcgatatc atccctaaat atgtaagtga agattataag     75120
     caacataatc cttttgtggc tgatggacga aaagctttca tggatttctt taaggaggat     75180
     tttgttaaaa accctaactc ctctgcagaa attaaacgtg tagtagctga aggagataca     75240
     gttgctcttc atgtacattc tcgtgctaac tctcaagata agggagttgc tatagtggat     75300
     atatttcgta taaaggatgg taagattgtc gaacactggg atgtaattca agagatttca     75360
     aatgaaacag ctaataataa tactatgttt tagataggag atatatctaa ttattattta     75420
     attgatagag atgtatagaa tttagaaatt tagagaagtt atgtatatat gattaaaatg     75480
     aaggggtgtc ctagtagata tggtactagg acatcttttt ttgcttgaac tagatttgtt     75540
     taaattaaag gtttgttatt agattattaa aatgaaattg tatgtttata aaagtcttgt     75600
     ttctttaatt tttggctctg ttaatgttga atgttgataa aaagtattaa atatgggaag     75660
     acaccttaga gttggtgctt cccttagttg ttgattattc atattcaaat ctaaaatagg     75720
     tattttctaa gcccattctt tgctttaatg ttttacccaa agcataatta ttcggcaatt     75780
     ctttttcaat gacacaaata atataacctg cttttcctgt tgttaaatta gttagttgta     75840
     agtagttatc gttgtcgtag atataagaaa taatgtattc gtagaaatca ttttctttgt     75900
     cttctctatt cataccaaca ttgtacaacc taactcttgc ccctgcccaa atttcctcct     75960
     catcattaac attacttaaa gatatccatt tcgagttatc caatatttca cccttttctt     76020
     aattcgttcg tttatacact gaattttgac agacgcaaac tatcataagt atcagtcatt     76080
     tcaaatacaa atgatgtgag taagaactct ttaatgttgt gttttgtgct ttcgttactt     76140
     tttctatcta taaacaagaa ccacgcaagg tagttgtcta aatattttgt agccacacct     76200
     ttaaaacggt ctatccattg tttcatacga gaatggagac catttacatt ctggatatgg     76260
     tacaagcctt taataacgtg cttaccatcg tttgatttaa ttctgtaatg ctctattcct     76320
     ttttcttttg catacgtttt gtaggctctc caagcatctg taacaagtac attatccgat     76380
     gttaatttag aaccaatcat actatcaact tttgttttca caacacgccc catacaagca     76440
     atcttggaga cagtcgcttt ggtacggtct ctggcaacaa gaacacaaac ttgttcgtgg     76500
     ctgatacctc tgtgtttaga ttttccacca cgcctacgag gtttgcgttc tgaaatacca     76560
     cgttgaccct tttgagagta taggaaatag gtctcgtcaa cttcaacgat accttcaaat     76620
     ttctcaaaat ccaattgttt taacgcactt aacaatttat gtctccaata aaaaagtgta     76680
     acccatgtaa cccccacgat ttcagcggac tttcgcaagg aatatccttt aaacatacaa     76740
     tcaacaaatg taatccattc gtttcctttt cgagtacggt aaagaacagt attcgttgta     76800
     tcagtgaatg tcttactaca acatttacaa cgatagcgtt ggcgattatt gtgtttaccg     76860
     aaacgaacaa cgtgttcgga tgcacaatga ggacattcaa acccttcctt gaaacgagtt     76920
     tctctcattt cattgattag acgaccaccg acagaggaag aaggttcaac atagcgtttt     76980
     acccattgaa acacttgctc tttctctgtg tgtgacaaat tgccaatatg tttcaataga     77040
     ttactgaacg ctttgctcaa ccttaacacc tctcgaatgt ttgttcttat acaattatac     77100
     gaagatttcg gataggtttc aaatatcaac atttaccttt aacaaagcca aaaattaaaa     77160
     caaggtccct taatcatgtt aaagggacct tgctcacgca aatgatctgt aaatcaattt     77220
     atctttgata tacagatcat ttgtatgata atttttgtaa ataattgcta aacagtgaac     77280
     ttacataaat gcttttagaa gttcttgaat taatgggatt gctccaccta taaattttaa     77340
     aactgccatt gcgatttcca tattattctc tcctcttttt tcgtattaag atgtgataaa     77400
     tctttataat cttattatag taagcgctta caattataac aatgaatttt tgtatgcaat     77460
     attgcatatt tatacattag atctctatta ttcattttct aatggtacta tagcgaggtg     77520
     agagtcttta agggttctcc ttaataggag gaaatatgga aagagtgcag gcgatttata     77580
     gtaatcaaaa atttaagagt tgggttaaac aggtattagc tgtaggagga gtaatagggt     77640
     gctgctattt ggtgttatat gttttctgtt tcttagttat catgtaaata ttatacaact     77700
     aaactagtag agtcttgcct agagaggtaa ggctctttta ttgtagtacc tggagatggg     77760
     caaacaatat acaatacttc ttaggtttgt cagattactt tgtatcgtgc cttgtttctc     77820
     tatattctag aacactaact cctatcattg agagttaata aacttctatt taaagtttcc     77880
     atttatattg aaaacagaat tctattgata aaaaatatgt ttttactaga tacatattaa     77940
     aaagacaagc ataaattata ttagatttta gcaaaatctt tttgccttgg aaaaggattt     78000
     aaatcttact tatagatttg atcccttttt atataccata atccttatat tactacgtaa     78060
     atataataca gtaataatga tttaaaagca agaatattag taggggtacg ttcacacatc     78120
     catcaactta agattttaaa tttttaagat tatgtagtga ttttttagaa atgtaagttt     78180
     agaaagattt tttgggaatt ttacataaaa gggtaatgtt tttatcatta tatataaatt     78240
     gtagggaagt gtttaaatat gaacatgaaa acatttgaaa tgcgtgaaaa acgattagca     78300
     gaactactag gtgcaaaagt attatgggag tttataagtg ctgtcacaga ggaaattgaa     78360
     aagcaggaat tagaatctac acctggttta ttagaagatc tattcataca tgtgaaagag     78420
     acaattcaaa ttcagaatat gaatcaaggc ataacaaaag cccctgtaaa aacagaggct     78480
     gatggtatag ataaagatac attatttatg gaagcatatg tagaattaat caatcataaa     78540
     tttgttattt ctgaattagt tgtagagctt tcatctgttc taaaagaatt aaattgtttt     78600
     gttcaatcat ctttgccact gcttcaaaat aagcttgatt ctcaagaatc tcaatctgct     78660
     tctctttagg gaacgtttga aggatttcct tcatttcttt acactcgtat atattattgt     78720
     ctgcttcttc gattaattta ttgcgacgat ttgtgtattc aagtgcacct taagtcgcta     78780
     atgcgcgtgt atctagtcct aggatttcca tgcattcatc tcctttccct ctacaataat     78840
     tcgatagggg aaaggagatt cctttaatga tttggtagag tttttatata gttatataac     78900
     atgctattta ttagcaggaa tacaatagaa ttagacttaa aagagctgct taaaaggaag     78960
     aaaggggaat ccagtaattc tcactctttt ttattaaatg ctaaatatga cacgtttgtt     79020
     tccttttatc atgaatttca catgggattc tttaaggaag attagatagc tatagggtat     79080
     gtaatatgaa tagataaacg aaatgaaaga aaatggtaac catcagtatt ataggggata     79140
     ttaaggggtt ctcaagtaat atgtcttaaa gtgtttaaga gtgggaatct atgtaacact     79200
     cgttacttaa aaaataaaag attagacatt aaaataggta aaagtattta agttacttgt     79260
     atagatgaaa taatggagcg aatgaaatta aaacatgatg aaacatgttg aaataaatag     79320
     aaggggatct ttaggtaggt taagcagaga aataaggcat gctgagaaag tggctattga     79380
     attcgaagaa gttaaagtgt gaaaggtgtc acttatgtta gaatatctat tactaattta     79440
     ctctatataa aaaaagcagc tgcacaaaaa tacagctagc cttcttcaca aatttatatg     79500
     gccttgatga cgaattggga ttgaggtata tatagtaatt gagctgctaa ggaagttgtt     79560
     gtgttagcaa atgggtatgc ttccttataa ggaaaattac tatacactat ttcattcatt     79620
     tccaaggtcg taaacagttt tttaaggatt ttttgagaga ttttatttgt acaagcagca     79680
     ataaaatcaa aatctttttt acttatttct tgaatggcat gtgaaataag gctggtgact     79740
     atcccacttc ccatccaatc tggatgacaa gcgcccatat ctagatagac caatttttct     79800
     ttatctaaat gagaaaactc aatagattct gtctctaatg tatctaaaag ttgaaaaata     79860
     ggttccattt gtgggcatag ttcagtcgct ttatctgtat ctattagtgg ctgggttact     79920
     ttttttgtta aaagaactcc aacaatttga aaattttcta ttgctacaaa tgacatggct     79980
     tgagatacag cttgtttcat catttcttcg cacattttgt gaaaagaagc aaaaggaatt     80040
     tgtaaactgc ttacaagagg ttcattattc acaaaagaat gtgcaagtaa atgtgctgca     80100
     tctttcacgt gatgtgtatc tagtagctct atattcatat gtttttcctc tttcctgata     80160
     tagtggatag taattaaaag gattaaaaat tttatttaat ttagttaagt ttaactatta     80220
     aagcgctaac aaaaatggtt attaaacata tgaataaatc tgtttagtag caatcgaaat     80280
     atgttcataa agaaattcta cgatctcatc tatacattca acagttgtat atggagagat     80340
     agaaaagaat tttaatgtag aaatcggatt tctatcataa ttgtttatta catctactac     80400
     acaagaacga gttgtatcac caaaaaatac ttgatcgcga ttttttccta ggtaattaaa     80460
     tagttctata tttaatcggt ttgtaccctc aatctcttcc tttgttgcaa ggcctattcg     80520
     ttctttttcc caattttctt ggccatctcc attcatatag aaacggaaag ttgtaattgg     80580
     tccatatgta aaatcatttg tgattgcgac ttgagggagg gccttgcgca acctttctct     80640
     aaataataga tttacacgaa tataatttgc tagtaatttt tgatatcctt caacaccaaa     80700
     ggctaaaaga ttgatataca tcggaatagc actaccagct cgtgaacatt ctaaggtata     80760
     gccagtatga taacttccat atgacctatt gcctagataa ggtgtgtcat cttgttcaat     80820
     atccatcagt tgtaaatcag tatgattttt tacgattaat atacttgaag cataaggtgt     80880
     ttgtcctaat ttatgaaaat caaaacatac actatcagca agtgccatgt attgcatttt     80940
     atcttgtacg tattgtaaag cattttttaa gctaggttca aatgaaagtg gattttcttc     81000
     gaaactataa ttattaaaga aactatagaa tccgcccatt gcagaatcag catggatata     81060
     aataggtttt aatttatatt ttttctgtat tgtttcagcg ctctctttaa ttttttttat     81120
     atcatcaatg gtaaatgtat ctgttgaccc catagtagct agaatataaa gagggatacc     81180
     gtcattttta ataacttgta tcattttatt ctctaaatct tctatatcca tagagtttgt     81240
     ataaggatca gttttcactt ttattaagtg atttgtccca atgccagttg cttcagctga     81300
     ctttaataaa ctataatgtg cattttcaga agcaaagcaa tatacatttt gtggagcgcc     81360
     atgttctttt gctgatggga attgtttaga aattgctaag cgcaggctag aaaacacgca     81420
     tccttgtcca ccccatgttg tatagccgcc gctattatgt ggattataac ctattagttt     81480
     tgaaagcatg gatacaactt ttacttctgc ttcagctgcc cctggaccat atacatccca     81540
     aacaccatta ccatttaaaa gggccatggt tattacacct aatagtgaag gtatacttgg     81600
     tagtggtaca gcgttagaca agtaatattt atttggataa ggatgtccat tcataaattg     81660
     ttttagctct tctataacct cagacatagt gattccagct agtggaatat gactttggtg     81720
     aattaagcca ttgtagtatc cttctgattt ttcctcacat ttacctaaag tagctcgctc     81780
     ttcatttttt aattggtcaa gatttttaat tattttctgc atagattcta ataaaagttg     81840
     ttgtttttct tcatttccgt caacgctcgg aaatagtttt aaaatatctt gcatgcagtc     81900
     acttctcctt gtgaaaaact ggatttttat tttacttggt taaacataag ggtataataa     81960
     tttgtaattg cccttttgaa tacttagaaa tgaggagcta tttagaaaaa aatgtaattc     82020
     catagaagat tatatgaact atggaattta aagtaaagaa aaattttttg attaatttta     82080
     aaaaaagtaa ttgtgagata atggagtttc taaaaatata tctgaattaa ttgtttattt     82140
     aatttatatg ttgttctaac atgtattcaa ctagtgtagt agatatttta atataatgta     82200
     gaactattat aaggtagttg aatataagtg ctcaactacc ttataaacta tagatattgt     82260
     tgggaaaaga gaaaaaatag ggtggaagtg ttaaagaaat gttctggtgg agaagaagta     82320
     atggtatgga tttggtagct aaatcagttt gatttttatg ggagaataac gagctgatca     82380
     aagcttttta atgaattcaa tttcattatt taatgataat ggacgagtta agtgtgaaga     82440
     attttcttca acctgagtag aattttttgc accaggaatc gcaactgaaa cggctgggtg     82500
     gcttaaaaca taacgtaagg caatttgagc tagacttcga tttgatcgta caagtgaacc     82560
     taatttctct actttgttta atctatcttt aaaccacttc tcttttggcc aatcttttct     82620
     taaatcatcg tctggaaatt gagtttcatg attaaatttc cccgttaaaa ttcccatttt     82680
     tagtggacct cttatcacag cacctaaatt atgtttttca atataaggaa ggatatcttt     82740
     ttcaggctct ttatttaaaa tactgtaatc gaattgcaca acatctaaat catcattctg     82800
     attaaagtgt ttaatataat ctaaatcatt agtagaaacg ccaacagctc tcactttgcc     82860
     agattttttt aaggtttgga aagcttgtag aaaggcttct gtttcttcag gtttatctca     82920
     ccaaatatga caaaagtaca catctatata atcagtttta agccgtagta aactagcctc     82980
     aaacgcatca ataatctttt gaggatctcc aaaaactgct ggttgatttt ggtcataatg     83040
     atgaccgatt aatccaccct ttgtagaaag aatgatatcc tgcctgcgat tatttatagc     83100
     ttttgcaacg agtgtttcaa tatgacctag tccataaaca tcagcagtgt caataaaatt     83160
     aacccctagg tcaattgttt tattgattgc atcaatggat tcattatctt ttactgcgcc     83220
     ccattcatct ccaccaatcg cccaagaacc gaatcctatc tcagaaacta ttaatccggt     83280
     gttgcctaat aatctatatt ccattatgta cggactcctc cttttcagtt tatattatta     83340
     gaaatatata tagtgacctg ttggaatatc cttgaattta ttttcggggt ataaattaga     83400
     gtatatattt taataaatat atatgagatt actttataaa aagtaattgg aattattagt     83460
     aaaatgattt tttatgctta aattgaataa aagtatgaac tttcacggta taaatatgaa     83520
     tattattcat aattttaata actatgcaat aagtgaaata aacgttgaat ttagtcgaaa     83580
     aaaatacatt tacaaatcgt agaatatgta catatagttg taactgtaaa tattatccgt     83640
     tttgaaatat ttataaaagg agaaattcat atgaaggaaa tacaaaagca atatgaaatt     83700
     gtagaagaat tggatgcaac agtagggcaa gaagcattat ggatagctca tcaaatggaa     83760
     ttagaaaatg gaatgaacaa tgaagctacc ataataaagc taaaaggaaa tcttcaaata     83820
     gatactttta agaaagcgct tactttaata gtgcaatctc atccggcgct gcgtacacta     83880
     tttattaaaa gggacgaaaa aattaaacaa ttcattcaaa agagtataga ttttgatata     83940
     ccaattaagg atttaactgc ttttaaaaac acagaacaaa aatttatttt aaaaaaattc     84000
     ttagactcta tagtgaatga gaaatttaat ttagaagaag ggcctttgtt taaattccac     84060
     atcattaaat tgtgtgaaga tgaatttatt ttacatatga tttttcatca cattatttat     84120
     gatggatgta gtttaggaat ttttatccaa caattgtctc atacgtattg tgaattactt     84180
     caagaaaata cgggtttagt attagaatct ccttataaga gccttataga atttgaggaa     84240
     ggttttattg acagtgcaat atatagagaa ggatcatcct attggaaaga ttatttacaa     84300
     ggtgaattac ctcctacaga gtttcctgct actattaata aaatgaatga accgatatat     84360
     acgaatgaaa atataagtaa gaatattgat gccgatctat tttatcaaat acaatgtttt     84420
     gctaaaagaa ataacataag tgtctatcgg gttatgttaa gtacttattg tgccttgctt     84480
     catcaaatga caaacgctga agaaattatt gtaggtattc caattaatac tagaccacac     84540
     acggaagaag ggaatgcttt tggttatttt gttaatacat tacctatacg tataacaata     84600
     gaaaaggggg atacatttaa gggaatactt aacaaggtga ataaatctgt tcatttggct     84660
     attaagtata aacataatcc atattcacat atagtaaaag attcaaatct aaataataat     84720
     acacatcata atatgatata ttcaacagca tttaatacgg taaggatacc tcaattgaaa     84780
     attctagata ttgagtccac agttttaaca gattgtaaaa gagtaaatcc ttttaacatg     84840
     acctggagaa taatgagata tgaaggggaa acagagaata aaattgaggt tgactataat     84900
     tcagcgttat ataaagcaga gagtattagt gatttagttg aaagatatat atatttgtta     84960
     caagaactaa tgaagaatgt aaatgagctt atccattcat tggatttact tttaaaaaag     85020
     gatcatcgtt tatacaaaga tataaactca aatactcttg catatcctaa ttcaaaaaca     85080
     ctagatcaat taatcgatct acaagcatta aaatcgccaa atcaaatagc gatttcaatg     85140
     ggggataaat cgattaccta ttatgacttg cagcaaaggt caaatcaaat tgcgaattat     85200
     ttacgtgaaa atgatataaa aaagggacag cgtgtaagta ttactatggt gagagagatt     85260
     gatacaattg tgtggattct aggcatacta aaatcaggtg gagtttatgt accaatcgat     85320
     ccaaagtttc ctgaaaaaag aatagaatat atattaaaag atagtgaaag tcaaatgatt     85380
     attacaaaga aagaattcag gggattaatt gaaagttttg cgattcatac aatttatcta     85440
     gaggattttc attacgctaa ttctatagaa aatattgtac ctacacatac catagaagat     85500
     acagcgtata ttatctacac gtcaggttcg acaggtttac caaaaggagt aggtgtacca     85560
     cataaaggag taattaattt atcatattca ttaatgaatc aatttaattt agacaaaaat     85620
     gatgtatttt tacaatttgc aacgatgatt tttgatgcct ccattatgga aatatttccg     85680
     attttgttat gcggagggag aatgcattta atttctgaaa tggaaaaacg ttctgcagaa     85740
     gaatttataa atgtaattaa caagaatggt attacatatg ttcttttacc aactgcattt     85800
     tttaaattaa tagctgatat gccaaaagaa atgttactta cattaaattc tttaaaatgt     85860
     gtatttgtgg gaggggaaac catacctgct gaatcagttc gtaaatggca aagtaaatta     85920
     ggattaaaga ttccagttct taacgcatat ggtcctactg aagctactgt atgtacaacc     85980
     atttatgaag taaatcatga gataaaagaa gaaaattcta atatcccaat aggtaaacca     86040
     attgctaata gtaaagtttt cgtggtcagt ccgttcaaca cgatatgtcc gtcaggagta     86100
     gtaggtgagt tattcattgg tggtgatggg gttgccaaag gatatataaa tcaaaaggaa     86160
     aaaacagaag aggcatttat ttctttcggg gaatcctata atcgcgataa aaaaatgtat     86220
     cgtactgggg atttagtacg tcttttacca agtggtaaga ttgatagaaa aaaattagaa     86280
     ttacaaatcc catctttact tgaaaatatg aagaatcaat atgtaccacc aataagtgaa     86340
     acagaaaaaa ggttggtaaa aacatggtca gagattttaa atttagggaa atatagaatc     86400
     agcagagatg atgacttttt taaacttggg ggacattcat taattgctgt gcaagtgtta     86460
     aatcaaattc aaaaagagtt tcatttgaaa atagaaatta gagatatttt tgagcataca     86520
     acaattgcta gtctatctgc ttacattgat aaattaatgg aagtaaatac ggatagagaa     86580
     gaacatgata tgcaagtatt aaaggttgca gataaggaat gttataagtt atccagtgct     86640
     caaaaaagaa tctggttttt aaataagtat aacgctatta atagagtata tgatacacaa     86700
     ctacacataa atattgagcc aagtttaaaa aagaatattt tacaagacgc cataagattt     86760
     ttagttgaac gacacgagat gctacgaaca gtgtttattg aaaaaaacgg ggagcctaga     86820
     caggtcatat taaaatcaat atctattgac cttattcacg atgatattga acacataact     86880
     aaaaaggaac aacaagaata tatacgtaga acaataaatc aaacggatca tacaccattt     86940
     gatttggaaa atggaccact tttccggatt agaattttta atcttgataa gaaaagatcc     87000
     tatatatata tcaatttaca ccatattatt accgatgagt ggagtgtaag gaatttatta     87060
     gatgaattaa tgaaggtata taatgccttt gctaatcgaa gaaatcctta tttaccaact     87120
     atttccaatc gatatgtgga ttatgttgag tgggaacaca agcagctaaa attaggccgg     87180
     tgggatacag aaaaatctta ttggatgacc gagcttgcgg cgcctcttcc catactaaat     87240
     cttccgttag attttagtag ggatcgtcaa agtacaaata aaggtaaagt ctttgaaatg     87300
     aagttagata ataaaatgaa agagtctttg aaacaagtat gtgaacaaga gaatgtgtct     87360
     atgtatatgc tatttttggc agtatatata caattgttac actatctaac ggatcaaaaa     87420
     gatattattg taggtacacc ggttgccgga aggaattatc aggaatttga acaaatacaa     87480
     ggattttttg taaatacttt agctattaga acacaattaa atgatgtgaa aaatttaaaa     87540
     caactagtac aagtcgttaa agaaaaatgt ttgaattctt tccaaaacca atcgtaccca     87600
     tttgataaag taattgagca aataaatcct gatagaagtt ttggaaataa ccctatcttt     87660
     tctacaatgt ttagttatca gaaagatatt ttgcaacagc atgatgagca caagcttcaa     87720
     ttgttaacta ataaacaaga tgttagtaag tttgacattt ctctatctgt tgaagaaggc     87780
     ttggattatg taggtatttc atttgagtat gatattaatt tattcaagga agaatcaatt     87840
     aataggttta ctcaaaattt acttaatata ctggacgcat ttattcatca acgaacagta     87900
     gcatatgaaa ctctttcatt cctatcacag gaagaagtat ctctatatag aaaggtaaat     87960
     catacagaaa gaccatatcc ttattttcaa aatatacagg agcaattcta taagcaagta     88020
     gatagacaat caaatcggat tgctatagct acagaaacag agtctttaac atatagacaa     88080
     ttaaatatgg attctaatca agtagcgcaa catttactcg aaaagggtat aaaaacaggt     88140
     gacaaagtag ccatattttt agatagaagt attaatagca ttgtctctat gattggaata     88200
     ttaaaagctg gtgctgccta tataccaatc gatgtaaaat accccgagga tagaattaat     88260
     tatatagtaa gtgacagcga ggcatgtaga attataacga ataacaaata caaaagtcat     88320
     ttgaattcaa gtaattataa cgtttcaata atagaggata tatatcgtac gacaataaat     88380
     gatgatgtta aaattttaaa taaaccagat gacttggcat atgtaattta tacatcagga     88440
     tcaacaggca aaccaaaagg tacattatta actcataaag gagtattaaa tttagctgaa     88500
     tggagaaatg aagtatttca tatttcccca aatgataaag taacacagtt ttattcccat     88560
     agttttgatt cttctgtatc ggaaattttt tctaccttgt taaatggggc ggaactatat     88620
     ttattaagtg atgaacagcg ctattcaact gtagcatatg ctcaggctat ccaagaaata     88680
     caagcaactc tttctgacgt accaacagta ttttttaatg aattatcgac ttcattaact     88740
     aaactggata gtgagaagat acgttcttta agatttatga taatgggagg ggaagctgca     88800
     tcaacaaatg ctattaggag ttggcaaaat acttttaaaa accaagtaca actggtaaat     88860
     gagtatggcc ctactgaagc aactgtttca gcaatgtatt acttcatacc aatattagaa     88920
     gatgagaata gtcttttagg aaatataccg attggtattc caatttctaa tacaaaggtt     88980
     catatattga actcgtatat gcaacattgt ccggtagggg gcatgggtga attatatatt     89040
     gagagtttag gattggccca agggtattgg aagcaggagg agaaaacaaa tcaggcattt     89100
     atttcaagtc cattttcaga agataatagt aaaagggtat accgaacagg tgatttagca     89160
     aagtggttac caaatggaaa tatagaattt atgggaagaa aagataagca ggttaaaatt     89220
     agagggcata gaattgaatt aggggaaata gaagatgcac tattacaatt tgaggggata     89280
     agtcaggctg tgataacaca aacgaaagat ggaatgctat tgcaagctta ctataaaaca     89340
     gtggacggta tagaaataga gaaaaataag ttagcaatac atttatcaaa tgtattgcca     89400
     gaatatatga ttcctaaata ttactctcat gtgttagaaa taccaataac ggctaatggg     89460
     aaaattgatt tcgaaaaact tccagaaata gattttgata atgagcaaaa ggatgattgt     89520
     atacttaagc ctcaaactaa agtgcaaaaa aacattgcaa aagtatggtc tgaagtttta     89580
     aacataaagt ctattggttt aaaagatgat ttctttaatt tgggtggaca ttctttaaaa     89640
     gttatgccgg cattagttaa attaaaaccg ttatacccta acttgaaaat tcaagatttc     89700
     tttaagtata gaacaataga aaatttagcc tatcatattg aagagatgga agatatgtcg     89760
     ttaaagaatg agaaaaatat taatgtagca tgtattgaaa atgaaacgaa aacgaatccg     89820
     gtttataaaa gaactaaatt agaagaatgt gagttagata tggtgaatta tccaaaagca     89880
     gttttcctta caggagcaac aggatattta ggcgcacata ttttagaaca attattacag     89940
     ttgccatcta cgactattta ctgtttagta agaaaaaatg agaatcaagt aattgatgaa     90000
     aagttaaaag aaagaatgag attttatttt ggtaaagaaa ttcttcaaaa gttggaggag     90060
     agagtagaat taattgaagg agatttatct ttgataaatc taggtcttga tccaaagaaa     90120
     gtggatcatt taaagagtaa cgtagagtca ataatacatt gtggtggaga agttagacac     90180
     tatggagaac gtgagcattt tcaaaaggta aatgttcagt ctacaaaata cttattggaa     90240
     ttagctaaga atacaaatgc acgctttcat tatatatcga ctttaagtgt ggtaggacag     90300
     gctgaaagcg atccaaaaga atttaaattc tttgagtcta attttgatag agggcaaaat     90360
     ttagataatg tatacttaga aagtaagttt caaggcgaga aaatggtcag agaggcaatg     90420
     gaaaaaggag ttcgtgctac tatataccgt gtgggaaatt tagtgggtaa ctctaaaacg     90480
     ggtaaatttc aattcaatat taatgaaaac gctttttata gattattgaa aggtatatgc     90540
     ttatctaaca tagcacctga aatcaatacg tatgtagatt taacacctgt ggactatgga     90600
     agtttagcca ttactgaact atcttataag gccaacacag taaataaaac catgcatatt     90660
     tgtaatccaa ctcagcttaa atgggaccaa tttattaata gtttacaagt ttttggatac     90720
     gatttaatgt taatgaggca agaaaagtat atagagaagt tttttaatac taatctaact     90780
     actgatgaac agaaagcttt agagctcata atgcctttat tagaatctgt agaagagcta     90840
     tcagtagcta taccatcttg tttgtatacg caaggatatt tgaagaatgt acattgctta     90900
     gaaccaaatc aagagtatat caatttgtta ttaaattatg ccatgagtat agagttttta     90960
     ccaaccatta aagaaccaat attgttatag aatatactat caattttgaa cagattggtc     91020
     tataaatatg aagttttgaa tgttcgttta cttctcctta acgtttggaa aattaaaaag     91080
     aacttgtagt tttatctaca agttcttttc gattaaaagg tttatacatt tagttggttg     91140
     gataatattt caattcttca tattactaac agaagaaatt aactaaaaca aataattctt     91200
     ttcaataaga gaaaaaatac agttttatat taagaccaaa cccattgatc atcagttaat     91260
     gtttgagaat cattaacttt ttccggtggc catttttacg tagattgata ttaatgctca     91320
     ggataaattc ttctacatgc catgcgacct aattctggag aagaagcaat cattgcggca     91380
     gaagccacgg cagtcatccc agaacttcca acagcagcag aggctccaat ggttgcaata     91440
     gtaattaaat atatcaaatt aattttgtat taaacttttt tggtgaagcc ttagaaaaca     91500
     aaagaaattg agttaataaa tcccttttta tggtgaaatt aacttgaatg atatcttctg     91560
     taaatctgat tatacgaaaa tcgatactta atttcatgcg gggatgagag agagagggac     91620
     aaaatgaaat tagcaattca aactaaaaat ttaacaaagt cttttgcaaa tcaatccatt     91680
     gtaagggata taaacttatc tgttccagaa ggaagtttat atgcttttat tggaccaaat     91740
     ggtgcaggga aaacaacaac aatgcgaatg ttattaggat taattccatc agatgaggga     91800
     acgatattgt ttgataataa agatataaaa gaatggaaag aagaattatt tgaaaatgtg     91860
     ggttgtttta ttgattcacc tacttattat cctaatctaa cagcatatga aaatttagcc     91920
     tatgtacaaa aaatgattaa taaatcttta gatgaaatag atagagtatt aaaaactaca     91980
     ggaatatata aagcaaaaga taaaaaagtt aaagattttt ctttaggaat gaaacaaagg     92040
     ctaggtattt cctttgctat tcttaataac cctaaaatac taattcttga cgagccaaca     92100
     aatggattag atccagaggg agtacatgag ataaggcgtt tattacttca tttggtaaaa     92160
     aatgagggga agactatatt tatttctagt cataatttag ctgaaattga aatgatagca     92220
     gatcacatag cattactaca taagggtagc ttactctatg aagggaaatt agacagtatt     92280
     attacttctg gagaatatat cattcatgtt aatactacta cttctacaga aagaatttta     92340
     agtaatgaag gtatacctta tagtattgaa aaagaagggg tattcagaat aacaatagat     92400
     caagatagtg ttcctagttt aaccagaata ttaattagaa atgatataga tatttttgaa     92460
     gttagcccta aaaagccaac attagaggaa gtttttttat ctttcactaa acaaaaggag     92520
     ttattataat aatgcaattt atctttaaaa gtgtaaatag tgagatgaga aaaattggtg     92580
     ggagaaaatt attattaatc tctttgtttt tttcgttatt atcaagcttt ttgtgtataa     92640
     gttattttat ttttaataag aatcatcccg acatgtttca atctacaaat cttatagcaa     92700
     ttacagtaaa ttttaataca ctaacgttaa gtattttctc tgcttgtatg tggtatttta     92760
     tcatttcttc ggaaaataaa tatggtactt gggccattat ttatacacag cccatttcga     92820
     aacttaaatt attggtaact aaaaatttaa tgtttatact gttctatttg gtctttaata     92880
     ttttgaattt tttggttatg ggtatctata cttttataaa tggatatgaa atatcaatac     92940
     tttatttttt aaaaatgttg atactttgta cgattttatc tctagcaata ccatattctc     93000
     aattgctttt tcatttaatt ataaaaaagg gaattcttgc ggcatccttg tcagttgttt     93060
     ggcttttttt ctttataaca tatggattat tccctttaat atttacaaag acatttccaa     93120
     tcttttattc attgaatata gtaagtgacg tagcgtttaa agaaacaatt attttattat     93180
     atcttgcaat ttcttcaata tatattttag gaattatgtt attgtctgtg agttttaaat     93240
     attatacata tgaataataa agggtgaaac aagtgggtat tttaggtgaa tataaaaaaa     93300
     gtcttcataa tggattgtat atcctgttac tagtatttct gttgattcca attagttttc     93360
     aagttttact aactgtatcg tctcaattaa aagatggcgt tttcatgcat atagcgattc     93420
     tgagcctttt ttgtaggtta tttttaccta ttgcgatagg tctattagtg tcattttctt     93480
     ttgtaaacga attcagaaga aaaggatata tgtctgctat ttatcacggg atcactttaa     93540
     aaactatatt aagtaataag tttttatttt gcttaataat tacttttggt tatttactat     93600
     gtgctttaat cataacgagt atacctatag tattaacggt tgataatctc gggactgttt     93660
     atcaaagttt aagtttttct atacttttta tggtaattag ctctttaatt attgtgaatc     93720
     tacatttttt aataaatata atattttata aaatcccgtt actttcatta ttagtagggg     93780
     ttataggtgg acttggtagc ttttttatct ctcatacaaa ctattggata ctattccctt     93840
     ggtcatatcc aattatgagt ctttatattg atagcattga aacaaaacaa ttgtatatta     93900
     ttctctttgt atatctatta tcattactaa gttgtatatt gatgttgtct actttatata     93960
     ataaaaaatc aatgagatgg aattaaggtt acaatgagga gtgtagcatt agtaataata     94020
     aaacatgttg tagttactac aatatggatc tcgatacgtt aagccaatta ataagacatg     94080
     cggatcaaat gttattgaat tcgaagaagc taaagtatga tagatgtcac ttatggtcac     94140
     tcgaatatct attactaatt tactctattt aaaaaaagta gctgcacaaa agcgcagcta     94200
     ctttttttca tacaaacatt attatgcaaa taaaaacctt aacgtaaact tgcgcttaat     94260
     ggtacttgag aataaacttt gaaattacta ccataagtac cgtgttgaga aaatgaggaa     94320
     gaaattgagc tgttccaact tttgtaggta gatccagatg tatctgctct tagaagtacg     94380
     tttgaaaagc tagcttggct aaaagaatta cttccagtat cttcaacgcc ctgaaccatt     94440
     tttactggtt catattgaga aaacgtacca tatacaggtt gatttacata tttaggactt     94500
     ccatttacat acatagtaac cgtaccattt ccgttattaa ctagtttaag gtttactcga     94560
     tcaccatctt taattgatgt atcatactgt gtgttccaat acttactgtt ttgacctgat     94620
     tcattatatc ctgaattaag aaatacttta tatccacttg atgtttttga aataccaccc     94680
     tcaactttag atgctccaat acctaaatac caattcacat atccatcctt aacaacaact     94740
     gattttggta gatttatatc agctgcaatc ccggtatagt tactatttgt aacacttttt     94800
     acagcacctt ctgtagctgc aaaacttgta gttgcaaaca ttgatagagc aattagaagt     94860
     gaaccaacta gatatatcat ttttctctta cttttcctta atacttgttt cattttaggt     94920
     cccccttaat ttttattatt aaattgcatg gaaagttggc caactaacca cgacttacaa     94980
     atcaaagata cattaggttt catttaatgt atatattttc ctgttataag tcattgaaat     95040
     gtcaaataaa ttgaatattt catatttatc aatataaggg gagttgacag aataaaatag     95100
     tccttctatt tgaatttagg aaggttttgt aattaatatt attaaaatct ataaactggt     95160
     tgggtataat acgcaatacc attcatttgt gagagataga aatggaatta atgcagggga     95220
     ttttcaaaag gggatatcag aaatttttag aaatggaata acaacaaatg aaataaatta     95280
     aaggctgttg taaaggcatc tatgtatgag aaggtagtag gaatgagaag taaactttgt     95340
     agttactttg ccttggatga aagaagattt aataattgtt taatagggtt cgtttcctag     95400
     ttaatacgta gttcctgggg ggaggggaga atgcctaaaa tagagaatag atttgtttta     95460
     accaatcctt ttcaaaataa aaatagtaac gcgaatagtc cgaaacacat ttgtttcgga     95520
     ctagggattc acaatttctc tcattttgat taaacaattt tgtggattaa aagttggata     95580
     ttttgactat ttaagcagga caaatgatat tacgttaatc aatagatact tcaacagaga     95640
     cactcggtat tgtgggtgat ggtgtatctc caccattaaa ggaagaaggt tgtgatacat     95700
     gtaaactaat catgctacat gctaatgcac ttactactac catacttaat acaatttttt     95760
     ttattttttt cattacttta acgctccttt tctcaaatga ttcttattgg cattattgct     95820
     aatgtagaaa tatctgctcg ccttaacatg attatctgcc tggtaaaatt ggagtgctaa     95880
     aatctctgca tgttctttta cacaatccca catgccctct ttttcaaaat aagaaattgc     95940
     attagtaact actttttcta gtttaattct aggcagttct gtgattagtt catttaaaac     96000
     tgcgaaacgg tgcttatatt cctcatttcc ggattcattt gtatatttca ttccctgttc     96060
     gatatatgat tttgctgttt caacgccttc taatttataa tatgctcttg ctaagacaaa     96120
     taatgcttta aaatggttcg gtattttatt tataatttca gaactctgtc ggatcgccaa     96180
     tggatataaa tcttgaatat tatataacca gcccaaattg taacgtactc ttaataataa     96240
     atgttcttta tcatgcttct taaaaacatc aataaccgta ttgagacatt cttcagctct     96300
     ttcaaactct cttagatcta tacaagctaa accatataca ttgtcgcata aagcaatatt     96360
     gatttcatat cctacatgat tcaggtatat ttctttcgct tttactacat gttgaatcgc     96420
     ttcaaatggt tgataagact gataaaagta agttgaaatt ctatacttaa actcggcttt     96480
     ttctacttca tcaggtatat caattaaaag ttcttccgcc ttttcaaaat gtgttctcgc     96540
     ttcagtataa tttgctataa ttgtagagtg gattgcctta aagaaatgat agtagtaagc     96600
     taaaaatgaa aattcatctt tgatattagg gagctcttct attttattaa aagaatcttt     96660
     agtaatactc attccatcta ccaagacctt atatctaaaa ttcagtagtg aataatagaa     96720
     tgataaatat tggtctgttt ctattccttt taaattttct tgtactttta gatatgtttg     96780
     ttttgcttct tttacatgat atgaacggat ttcttcatac cattcattta atattttcat     96840
     caattgctca ttgctttttt cttgaacagt cataatatcc cccttttctc cgtataggct     96900
     tattctgata ataacaggaa ttagatactt taaatttcac tatgagtttt tttcataaat     96960
     atacagaata ttctgaatca atcgagtgtc catactttat ttaatgcgac aaaatataag     97020
     aaagtatgag tttcgtcgat ggatttttta gatgtttaaa ccgttcctac tgaatttttc     97080
     ttataggagg tggcgtagaa ttatgacaga aacggagatg gtatacaccg ctagtgtatt     97140
     gagaaatata tagcgatatt aaacttcaag ggattccacg aagataaata gaagtatacc     97200
     tatatctatt tataatgaaa aaggggcgtt ggttagtatg ataagttttg ggattaattt     97260
     acgcactatc attagttata cacaagagag taggaatcgt aataatataa agattataag     97320
     tcagttagga ataaagttgt ttgatatata cggagaaccg ttaccagtat cagatgttaa     97380
     tcgagagtta gtgacggctt taaaacgtca agacataaat aagcagcgat atataataag     97440
     tcatttagaa ggataaaaaa actgatatta tggggcgttt ctttacagga ggcgttttta     97500
     ttttgcgtag aaatgaggat gtagcctttg cttcaaatag aaaaatgata aaatactgca     97560
     aaaatagtaa aggagaagga tggcgaatga aaggaatcgt tattttaggc aaggagagag     97620
     ggacttaata ctatttgttt gacagaaaaa gattcattta caggaaagca ccgacaagtg     97680
     aagagaagag gcatcataat tcattgtagg tcgttttttc tggtttgaaa tatattattt     97740
     gtgacaatta aatcgtacat tgatattgca atttttatgt ggacaggcat tacctgacca     97800
     caattgtcgt actaaatgcg agtacgtaca cgtatgttga acaaaactta acatgtacag     97860
     agataataag gttgtttaat ttacaataaa gtcgtttaaa ataaggtttt ttaaaaaacg     97920
     ccagtcatgt tattcaacaa tcgggccata taacggaatg gaatgttgtg aaaatttaaa     97980
     atgtttgaaa taattattat taagttaaag gacagcgatt gtagaaaaag gtgatacgat     98040
     tttctcttac ttaagaattg tggaagggta aaaaatccga gtaattatat tccgaaaggt     98100
     gtgtttaata tactatcaac taacgttttt acttataaat ctaaggacgg aaaaacagta     98160
     acaattagag aagctaaaga acaggatgca gaaagaatgt taaattgtgc ttcaagagct     98220
     ttaataaacg ctccatacat gctaagtacg gttgaggatg taaagcagat gagtgttgat     98280
     gctattcaaa aaacgttaaa agcttattat gaaaatccaa attttgtaca gtttattgct     98340
     gaagtggata gtaagttagt cggtgcaata gattttaaga acggaaacaa agaaaaaatt     98400
     agtcatcaag ggttttttgc gatgaccata ctacctgaat atcgaaatta tggtattgga     98460
     agagctcttc tagaaacgtt aatcaattgg gctaaaaata actgtaagat tgaaaaagtt     98520
     tgtcttgagg taatggaaga taatttaggt gcaatcaagt tatataagaa tcaaggcttt     98580
     tttgaagagg gtagaaaagc aaagggtgta aaattggatg gaggctatca agatttaata     98640
     ttaatggctt tattcgtttg aaattgaaca ttattcaaga acagggtgct atttttgcac     98700
     cagaaccgta tcacgtgtat ggaatcatta atatcaaaaa agccatcacg caatgatgat     98760
     tgcatgatgg cttttgttgt tttcttattt ctttgtctca ttgacccatg tagcgatgtc     98820
     cttgatgaca tacgcaggaa cattggaagg gacttcgtat tcactagggt gacttaattc     98880
     cccgtcgccc tccgtgaaga agtgattcaa tttcggatat tctttgaaat gaacattact     98940
     gcggcttgaa agcccttctt gccatttcgt aaactcgtct tttactgtta cttgataatc     99000
     acgtgagcct tgcaaaatca gtaatggttc ttttcgtgat ttcgcttcct caactggacg     99060
     ccaacgagtc acatcataca tgaaatgtgg agaaagataa ttataaccag ctggtgggtg     99120
     atctggatca aaagtagggt cctcaatgta agcgaattgt ttttttattt catcaatata     99180
     ttccttaggt gctccgaggt actgatactg atcaaggagc atgtcagtaa acggacgtgc     99240
     aggtggtgcc attaaaatac ttcctcttac aagtgatgaa ggtgctttgc ttagtatgcg     99300
     cggcatggtg ccagcacctt ggctatgtcc gagaatgaaa atgttatctg ggtcaatgcc     99360
     ttcctgctgc gctgctgatt ttgctgcata tatggcatca tctgtagtat ctcggtctaa     99420
     cgttacaggt tctgcactca ttttaaaacc gtgttctaag gaacgtttct cgtaacgtaa     99480
     cactgcgata ccgcttgatg aaagaccagc tgcaaggtct ctaaagattt tagctcccat     99540
     aaatgtactg tcacgatctt gcggaccaga accgtgaaca agaacaacaa caggtacttt     99600
     ttcgccaggt ttatgttttg gaaccgttaa tgtggctggt aacgggtatg tagcatttcc     99660
     aatgacgatt tctcgttctt ggtaggaatc aggttggtca tagctaggat gcgggatggt     99720
     ataagatttc tctggcgccg tccttacgtc aacctcatca actttgccgc caggcgtgaa     99780
     tttaaggagt agtggaatag tagttccttc gatagctcct ggaatttcaa ccgtttgatg     99840
     gaccaagttt cgttctttta taacaggtgt tcccatgctt gtaattctgc tcccgccact     99900
     ttgtatccac cagctttgta atatgtttgc cgtaaacttg gattgaaaag ctacagacgt     99960
     caactggagt gcctctgcat atttaccttg ttggagatat gcaaaaaata aagacgtacg    100020
     ctccgttaat gagacttgtt tcttttctgc agtttgtgtc ccttgtgtat ccccatgaat    100080
     agctgttgta agcggaaaag aagaaacacc taaagaaaag agtagggtaa aagaaagtgc    100140
     tgatttttgt aacttctttt ttttcatcct ggttaacccc caaaatgtaa tggtatgaaa    100200
     tgggtatggt aattggtgga atgtttccct attggggttt cgttacatgt aagggggaat    100260
     cctgcataca tatcataaaa agcccgtttg aaagagtgga ggagttaagc aatggattta    100320
     tacataaatc gttgctaaat catagaaatc gatcgttttt ccaacaatga ttccaatccc    100380
     gttatgatgt aggggaagaa aaacaagaag agagggaggc atacgatgaa gaaattttta    100440
     tggttcattt ctacattgtg catgtttgat tggtaacagg gcgtagtagc aaagatgaca    100500
     ctggaatttc cattacccca taccgaaaaa aaagggtata ggtatacttt cctgtttaaa    100560
     atgttgttcg tataggaagc gaataagctt cctatacgaa caacattaca tattaataat    100620
     ttagagggtt ttaaaaataa agaggtggtt tttaaatgta taatgattca atatattttc    100680
     cttatataaa ttatgatcaa tgcttcgatc gtcaattccc tggtcctcag attccaggta    100740
     tacctggaat gccaggtttt ccgggtgtac caagttttcc aggacagcaa agttcacaag    100800
     ctccaacatc tcctccccca tcatttattc ctcaacaatc aactgcttca ccatttgctg    100860
     ttgatccagg agcaatttca ttatgtttat ttcgaaatac ttatatatgg cttagtaatg    100920
     gtgaacagtt ttggtatttc ccgatttttg taggaccaag gtctgttgct ggttttagat    100980
     ggaacggtag gttttgggtt atttttggaa ttgatacgag aaggattatt tcatttacat    101040
     gtttttaaaa attatagagt aacgataggg gtttaattat ataaacaaaa gaggtatttg    101100
     aatgaaaaaa tttcaatcat ttgatggtac aataactatg attaacgatt ttgtaacagg    101160
     ttcaaacgaa gatataggat gtaataaatt aatgtccgta gataatggtt atgggaatct    101220
     aataaatttt gtagtgaaac caaatacgta ttttatcgac tatgcaacgg tagtagtagg    101280
     agataaagta actgggtttt acgatgccaa cgctcctgct cctcttattt tcccaccaca    101340
     atttcaagcg attgttatgg caaaatatac accgcatcaa aatgtaaaag tagactattt    101400
     taatgaacag ttggagagta gtgatggaaa attaaaatta aatatttctc cttctactca    101460
     aattttatta acaaatggtc aattctttac aggtaatctt gtaaatcgaa atttaatagc    101520
     tatttatagt tttacaacaa tgagtatacc agctcaaact acaccatata aaatcattgt    101580
     tttgtgtcaa aagtgatttc tattctaaag ggtctctcgg tttatcaaac tacaatccat    101640
     tgtagaatca aaaattttag ccatcttatt gaccaggatc ataggcatgt caagagacgt    101700
     tttgctaaat ctgcaggatt tcaaaatctt cgtcatgctt cacgtacgat aaaaggtatc    101760
     gagaccattc atgccctata taaacaaagg cgaagtcttc aaagagactc cgccttttca    101820
     acgtacaata gtattccttt ctaaatatga agataaaagt atcttaaata catcaatatc    101880
     atgaagatac aggaacctaa tatgtaatat tgcatattaa tgaatttata tgagtatata    101940
     taacatgaaa atcactataa cgaacatgca ggtttccttt tttatttgtt atttttatca    102000
     gtaaagtaga ccacatatca gcttcagata cttgttttat gatacaagta atcaaacaaa    102060
     aggagggcca tacaacataa ttacaccatt attaacaggg cactctttta agtacaggag    102120
     attattagcg ggtggagaaa atgttgaaga tatacagaca gataaacata ttccatatga    102180
     aaaaaatgaa ttgcagcaaa ctctagaaaa gtacgattcg aaggagtttg agttataaaa    102240
     agaaaataga taaattgaca agagaaaagc actttgtgta tatcacaggt gttttttatt    102300
     ttcattttga tatagggctt gaattaaatt cccatgtttt tttgcggcca tccaatacta    102360
     catatgtaca tattcattat tgaaattagt aataataaaa tgtattattg aaaagcacta    102420
     tttataattc aagtaatcaa ggctatgtat ccataataat ttgaacattc agaaattata    102480
     atattatcat aaaaatgagg tgaggttaat agaaacagta catattaaat ggtatggatt    102540
     gtatagttta aatgattttt ataatagaga agaagctttt aagaagggaa tatttgcaat    102600
     ctctagagta tatgctaaga atgaaacatt gatctatata ggaaaaacca aaagaagctt    102660
     tatacaaaag ataagggaac ttaataaaga ttggattttt gatgaaagcg aattaaagat    102720
     tacattagga ataatagagt ctcctagtgg tgaaagttac tctgaaaaaa aggtaaaaga    102780
     gataaaatcc cttttgattt tacgacatac cccagtagaa aacaacactt ctttattgta    102840
     ccatagaggg cagtttaatt tgaaaattat aaataaggga agaaggggct taattgttaa    102900
     aaagatttct acaggagatc taatgtggac gtaattggaa tcacctttga ataaaattga    102960
     aggtttctta cgaacagatg cttatcaatt tttaatgtat taaaatattt ttgaataaca    103020
     tatgtcagat gcttgaaaca acacaaattt tattatgata tgaaatcttg tatgggaatt    103080
     gtaattcatt tccattgttt aatgaaaata ttaagaatta taagaataat gcataaagat    103140
     tagaagagaa aataaactcg gaggtttaaa aaatgggaca aggaagcagg tttcaagaaa    103200
     aacaacaaaa tcgtcgtaaa aaggtgattt ttaatattgc atttactttg gtattagtga    103260
     cagttggtat agtgacatac cagttgtttt ccccttctga tacatcaaag aaagcaattg    103320
     ctcaagaaaa gaaagcaaca aagatagaag agaagaaaca taaagagaaa gaagcagcgc    103380
     agttagaaga gaagaaacgt gaagtgaaag aagcagcgca gttagaagag aaggaacgtg    103440
     aggagagaga agcagcactg ttagaagaga agaaacgtga agagagagaa gcagcactgt    103500
     tagaagagaa acaaaaagca gaaaaatcgg taaaaacgag cgaaaatgaa aataaagagg    103560
     gagaaaaaac ggcatctcaa gaaaagggtt ctcaaactaa tccttcttgg aagccaattg    103620
     gtacagagca aggagcaaaa cctgcaatgc aatttaaaga aggaacagca gattggagtg    103680
     agatgaaaaa agcaatttct tatgctgttg atgttccaga gagccaattg attttcgatt    103740
     ttattgggaa taatggtaat aataaagcct acggtaatgt acgggataag caaagtaata    103800
     aaaaatataa ggttgatatt gattgggtag agaatcaggg ttggaaacca gcatctgttc    103860
     aagtggtaaa ataaataagg gaaatgtaaa tgttcccctc tctcgttgtg ggggactaag    103920
     ctattattgt ccagataaga taaacctggt tctatatgat gtttgaagta attatatatt    103980
     taaaagtttg cttttgtgaa agttcaaaat cttgattatc cgcattacgg aattttacgg    104040
     cgatgcgttt caaatttact tatacttgta caagtgaatt gatagatgta aaagcttttg    104100
     gtttcgcatc attgaacatt tgaatgaact gttgattaga ggcaccaatc cattgaaaac    104160
     acaaatgatc aatttcatta cataaattat tatgtataga ttctaatgtg attctggtat    104220
     tacttgcacg attagcagct tcttctagca tttcaggtgt tactttgatt tgaatcattt    104280
     ttttcaacct ttcccaatta aaattgtggg acaggaagaa aaatataaat atctaatgta    104340
     gagataaatg tagccaatgt atatgtgaaa taacaaaaga aaccggctct gtaatttaag    104400
     tcggtttttc tttatttatt ccgtattaag cggaatcacc tggtcaaatc ggttcaactg    104460
     gagcaaattg cccatgaagt accgtattcg cctgctgaat cacaccggaa aagttaatgt    104520
     cccagttgtt tatgattact ggtgagtaag gttcttgtgg tatcacaagg ttctctttat    104580
     cgagcaatca gagaaaattt gaagaaacac agaggtgaca aacttctgtg tttttatttt    104640
     gtgatttatg acagcaatcc tatcaatact ccaaaaaagc agtaaattga actactcacc    104700
     acttaacgtc ctaacggact gtttgaagtg ggagattcct aagtacggaa acctagcggt    104760
     aggctatctc catagtccct actgttaaga gacgaatcgc ttcgtttcta agattcagtc    104820
     ctgcgtaaat atctctatcg tgatgtgtgc cacaagaagg acaatcccat tcacgaagat    104880
     ttggattttt aacgtcttta ttttggtaac cacaatttga acatagctga ctagaagcaa    104940
     atgtttttga gacaactaca acttgcttcc tgtaccattt tgctttgtat tccaacttat    105000
     ttcgaaattg tgaccaagat acttcactga ttgctttggc aagtttcccg tttttcagca    105060
     tattacttac ttgtagattc tcaatatcaa ttacttcgtg gtttttgatg atttcggtag    105120
     agattttatc caagtaatct tttcttgcat tagtaatatg ttcatggact cgtgccactt    105180
     tcacacgtta tttattccag ttcgaagaac ctttcgctct tctggaaagg atgcgttgtg    105240
     cttccgctaa tttttttcta atgtacgaaa gaatttaggt tttttgtatg tagttccatt    105300
     tgcaagaata gcaaaatcct ttaatcccat atcaatccca acagaagatc ctgttttcgg    105360
     taattctttt acttcggttc gggtgcaaaa actttgaagt agatgaaaat ggtctatcaa    105420
     acttggaaat actgatagta ctactctata aaaggtgtgt aatcagtatg gaaaaggaga    105480
     atttatttaa gtggaaacat tatcagccag acatcatctt gttaactata cgttggtacc    105540
     tacggtacaa cttaagcttt cgtgatttgg tggaaatggt ggaggaacga gggttattcc    105600
     tggctcatac aactattatg cgatgggtac atcaatatgg accatgaatt cgacgtcatc    105660
     tcaaacaaac gaattcatgg agagtggacg aaacatatat aaaagtaaaa ggacaatgga    105720
     tgtatttata tcgtgctgtt gattctgaag gaaacacgat tgacttttat ttgagtaaat    105780
     ctagaaatca taaggctgca aagcgattct tcaagaaagc cttgcggtct tttcatgtct    105840
     caaagcttcg tatcatcacg gttgataaga accctgctta tccaattgct atcgaacagt    105900
     tgaagaaaga aaaaaggata ccaataggca ccaaaatcca aaggataaaa tatttaaata    105960
     acatagtaga ataagattat cgttttatta aaaaatgtat acgctctata ttgagtggtg    106020
     ttgaagccat gcatatggtc aaaaaagaac aaattgattt gcaggaccag tctgtccaaa    106080
     atcagaatat ttttatcaac caggtgtttg gattaactgc ttaacaggtg attccgttag    106140
     gaatccttga ttctttttta tttatcatct ttttgcacca gaaccataaa aattcagcat    106200
     aagtacttat attcaggcca aaataattgt ttacttatga aataactatg tgatttttcg    106260
     tttttttttg ttgtgataca tttatttgat aataatatac tttaaaaagt ttacttgaag    106320
     aaaagagctt tgaaggggac ttaataaatg gggaaggagc caattttgta gatttaggtg    106380
     atcatttttt cgtattcatc acttcacgtt ctttgaggag ggagtcttct tggctaaaat    106440
     gataaagaag aaaagtaaag taaaatgatc gtggagaatg agaaagtact aagcgaataa    106500
     tacttcttca taatgattaa agaatggatg ttaatatata ccgttttaaa gatatgaatc    106560
     attacattaa aatcctctta aaaagaatgt atgatggtaa tgtaatacaa acagcaaggg    106620
     ggaacttaaa atgaatttaa ataaattaat agttagttgt ggagtaattt cagcattaac    106680
     atttggcgtg ttaggtaata atgcttatgc tgaagaggta caaaaatcaa atgatgcaat    106740
     caatgtaatt gaacatgttc ctacagacct attattaact caaacactgg attatactgg    106800
     agaggctgta acttcttttg tatataaggg gagtacagat ttaagctttt ttataaaaaa    106860
     taatggtcaa aataaaatgg gatatagcgt aaaaggtcca aataaggagc ccatcgttgg    106920
     tggttatata aaaccgggtg aacaaaaaat taatgttaca aatgtgcgga atgctttatc    106980
     tccattaccg gtgggaacat ataaaattta cgtttcaaat gatgatggat ctacaggaca    107040
     attccaagtt gcggtaaact ctttggatta aatttttaaa agctgtttta taaaaaaact    107100
     acaccctcct ctaattttta gggcgcatct aaccgttgga ggtgtagtta atcgtttgat    107160
     attaagtggg taaggctgct ttttattgaa taaaatgggc atttcaaaga agtggattta    107220
     attttcgctt actaggagag actataacga ttcgagaatt atccataaaa gaaaaaacga    107280
     gcactcttat tcatagcgaa agggtgctcg ttttcctact aatacacaga aggagatatg    107340
     cttccaacca cttataaata cgatagagag aggagaggaa ataaaatgaa tatagtgaac    107400
     ttacgtccta aacagcgttc taagtatcgt attatgctag gaacatggta ttactctaca    107460
     aagaggtaca tccagtggtt agcagacgga aaaacatacg caaaaacttt acaacaagaa    107520
     aagttaccct gtacagcgat tcagcaccga acgatactac ttcgtaagct caaggatgta    107580
     gatatgtggt atcaacagaa taaagttgtt aatttaaaga ttgccattaa acagctagat    107640
     ggtatcgtca ttagaccggg agaaacattc tcttactggc gtttaatagg taagcctact    107700
     aggagaaaag ggtatgtaga aggtatgata ctacactatg gatcttttca agcaggcatt    107760
     ggaggagggc tttgtcagct ttcaaattta atatattgga tgaccttaca tacaccactg    107820
     acagtaacag agcgatatcg tcatagcttt gatgtctttc ctgattccaa gcggacccag    107880
     ccgtttggaa gcggagcgac ttgttcctat aactatttgg acttacaaat taaaaatgaa    107940
     acggaccaat cgtatcaact tcacctttat atcacagaga aacatttagt tggtgaatgg    108000
     agaacagcct atccgcagct ttatcaatat gaagtttatg aaaaagaaca ctcaatccaa    108060
     tctgcatact ggggtggtta tatacgacat aatgttattc aacgtagagt atatagccaa    108120
     cagaaacagt ttgtagaaga tcaatatgta acggagaatc acgctataat gatgtacgaa    108180
     ccattattag cttgtaataa cgaggaaagt ggagattaat atagcacacc agtagtttat    108240
     ccgattctgg agcaaaaaat aatgtcattg tgtacactga aattatgcat aaaaagtacg    108300
     tcactctttc ccgttaatat aaaagaatag taacgtactt ttaactttaa aaatagccta    108360
     aatgcttaag ttgatggcga tgtggcggta ccccttatag gcaaaacaaa ctaatttaat    108420
     acaaacaata gggatcaata tcttgaactg ctaggacact tttattctat aaggggcacg    108480
     gcaaagatta ctgctttttg ggaccacccg tcattttagg ttaacagaac tggaattccg    108540
     ttaacttttt gaggtgattt taacaacatt tgtttacaga acacatataa acggtgataa    108600
     aaataaggtt aaggaacata tttaaagggc ttctctttac atatttcaac tctatatact    108660
     tttaaatcac ggttttatca tatcgtctta aaggttttta taaatggccc gaaaaagaaa    108720
     gaattgttgc cgtgggactc atccgaacga ttcagcgatt tcatgcacgt taccaaacgg    108780
     atctacgaaa gcagcatatc gcccttgagt aggtttatca tgcaaaaatt gaataccctt    108840
     ttccttcagc tccttataag tttgctcaac agatacgacc tcaaacacca aaactgttct    108900
     agcctcgttt gaataatctc caatttcttt ggtcttttca cacttaaaag ctataagctg    108960
     acagccgtca agggcaaata caagcttatt ttcttgctct aacaatgttt ttaaacccag    109020
     caattcagaa taaaaccatc tcgcctttgt catgtcattg acgaaaatca ttatatgtcc    109080
     tagtttcata aggctatgcc gcccctttac ttttttaagg ataccatttt ttatggttca    109140
     tgcagaatct ttgctaatga ttatttgaag tattcgcgaa ttgattaaca tatcctgccc    109200
     gttagtttaa taaatggcga aaagtgaacg atttaattat aacgtgcttg accaatattg    109260
     taacattatg gaatgtgaat aagggaaccc gacattcctg gaaatttcac gtgaattata    109320
     atgggattca gcctagatac gtgtaaaact aggtcatagt aatacattat ttagcaaacg    109380
     ttgtttatcg gtgatattcg taaccaaaaa aatagagagt gagattcata aacttgagta    109440
     tcacttagtt gaattctggt gcaaaaaatc tcttaaactt ggccatactg atactatcaa    109500
     tctagaaaag ggatggtgtt cagtgtgaat aggcaaaatt cgttcaaatg gaagcactat    109560
     cagcctgata ttattttgct aacagtaaga tggtacctac ggtacaatct aagttttcgt    109620
     gatttagtgg aaatgatgga ggagcgaggt ttgtccattg ctcacactac catcatgcga    109680
     tgggtacatc aatatagccc tgagttagac aaacgagttc gacgctattt aaagaaaacc    109740
     aaggattctt ggagaggcga tgagacatat gtaaaagtca aagggaaatg gatgtacttg    109800
     tatcgtgctg tggattctga aggaaatacc atcgattttt atctgagcaa gaatagaaat    109860
     gctaaatcag ccaagcgctt cttgaagaaa gccttggctt cctgtcattc cgtaacacct    109920
     cgagtgatta cagtcgataa gaacctagca tatcctgttg ctatcaaagc attacatgaa    109980
     gaaaaaagca tgccgatagg tgtgaagttg aggcaaattc ggtatttaaa taacattgtg    110040
     gaacaggatc accgctttat caagaaacgc atacgtacta tgttaagttt aaagtccttt    110100
     cggactgcca aatggattct tgctgggatt gaagccatgc atatgatgaa aaaagacaaa    110160
     cctctcaaga gaagtctgtc caaaatcaag tgaacctcat tcatcaacta ttcggtattc    110220
     cagcataaaa gcggattcag ttaggaatct ctttacttct ttatatcttc aaaaaatatt    110280
     tgcaccagaa ccagtaatag atgtatgaaa gatttttttt atacttatga aagacttttg    110340
     taacacttat gagagagaaa tgaaagatat attagatatg atgaagttgt tcttaatagt    110400
     aggtgttcta acttacctaa aaatcaagga ggaaaaataa aaatgaagaa attgaagccc    110460
     gcacttagtg tattaggtag tgtatcgatg gcactgacct tagcatatcc tgctttagca    110520
     gacataaaac agccgaatgc aggaagcaca attgaaatgt tcaaagagga tgcaaatgca    110580
     aaagaaggaa aagatcttat ctatggaact gatggaaaaa agggaaagat gtctactgaa    110640
     aaaattgaaa tacaaaataa cgattgggat caagatggta tttctaacga cttagaaata    110700
     agaggctata aaattgagtt caatcgacaa accgggaaaa atgaagcaca ggcatgggat    110760
     ccagagcgag acaaagataa attaaaattt attacaaatc ctatgagcgc gaattcggat    110820
     ggagatcctt ttacagatgc atatgaagtt cagtattatg gcagtaactc tgatactgag    110880
     tttaatccaa tggttgcaaa tataccgaat ttgcaggttg gtataaaacg tattggggtt    110940
     actcctcttg cggctattac ggattcaaac ggtgggtcca ttgataaagg ttgggaaaaa    111000
     agtgtatcga cacaacattc gtttggtgta ggagcaggtg tcgaaggtgg tgtggaaggt    111060
     tccgcagccg gtcctgttcc ttctgggaag gcctcattaa atgtaagcta tggatactcg    111120
     aaaacatcaa cagataccga aagatattct tctaatatag attggtctac cgcaaaaact    111180
     gttgattcag caaaagcagc aaaagtgagc ttacagttag aatataaaaa tacagggacg    111240
     gcgtctgctc aaaatgtttc tcctcatttt aacattcgtt taggggacaa gattatcagt    111300
     acagtaaagg caacacaaga tcgttataaa gcaaatcagt taagtacaga aaaaggtgga    111360
     agaaatacaa cagaagtatt gatagacagt gtagataatc aagcagatgt aaatatttac    111420
     ttgtcgttag atgaattgaa agctgttgaa caaggtgcaa ttctttctgt tgaagtacta    111480
     cctacgagta caatggaatt gtatattgag aaagatggag aatttatgaa tttaggagat    111540
     tcaggaaaat ttgaatctcg tgtaaatgct tcgactacaa tactagagac tgatatcggg    111600
     aacaaaccga agtttagaat gtatgcacca gaaggtgttg gtagtgatac aaatttaacg    111660
     tttaacgagg ttctgaagca tgttaaagta gattctacaa agataaatga atttatagat    111720
     aatagcagag gagatcaagt tatcgttgcg aaagagaatc tagaaaatgc taaaaaatct    111780
     tatgtttcga aaggcgcaaa agtcggtgtt ttcacaaaaa ttcagcaacc ggaattgtca    111840
     tatagtgctt atgatccatt tacgaaaaag ttttatgcag cagtcgtacc tggcttattc    111900
     ggagcgagta atgaagtctc tgtttctttt gaaaataaaa aatccaaaca aacacaacaa    111960
     gtaacattat tgagaaaagg aaacgtatat gagtctaaag aagctgtaag tttgaatgat    112020
     ttcaatccat cacaaaaagt tacatttgaa atcaatgatg cacaaaagaa acttccgata    112080
     caaaaaatct ctacagttgt tacgtataat aaagaatatg aaaattattt gacccatcga    112140
     ttcagcgacg aacttattgt agaaggaact ccttatacta tgaaggctag tggaaatcct    112200
     gtgcttagtt ataaaggaaa tgataaatgg caatatcttg cgtatgctgg gaattacact    112260
     caaccagtta atgtaattat tgaaagaaaa gggcagccta aacctggaca accaatcaaa    112320
     aaaggtgaag atatacatat taaagttcaa aatagtgctt attcaggcta tgaatattta    112380
     aaacttcaaa atggttatat ccattttgac caaaaacaaa atgcaagtac ttttaaattt    112440
     aatcatatac atagcccagg cagccttgat taccagagag aatggaacct acaatctgat    112500
     ggtaacaata tagggttaga taagggtgga tctggttatg tgacatatgg taatgatgtg    112560
     catactggtt cgtctttaaa tagatggagt ttcgacaaag ctaagtaaaa gggaacggtt    112620
     ttgttgcaaa gttataaaaa acaccggtaa taaactgcac ctaaaaagtt agacatacga    112680
     atgtaggttg attttgaaat tgtcaatatt tactggacac taatttagtt aaatattggt    112740
     tttgtttctg taaagtggac atttctaaga agacgaagct atcagtgtgt ttcgatatag    112800
     aatcggggca cactgatttg tttttttcta ggatttttta ttattgtaga actatatatc    112860
     ggaatgactt tttatcagat tgtaagcttt tatatattat gttgtatttt tatataatga    112920
     atatgcggtt tatgatgcag agtatcgtct tatatagacc ttttcaagat acaatcttat    112980
     gattatagag attttgggaa acagttacat cataaagtag attctgacag gataaatata    113040
     taatcttcgt aaaaaatccg attttaattt tctgtttgta tgactagata aataccacga    113100
     ttaagattat ttatctagtc atgtaaataa ctcaatgtta aaattatcat ctggattata    113160
     tagtttttag ggtttttggt cattaagaga tagaagtttg agattctgat ttagtgatac    113220
     aatcagttgt tatatcttca tatccaaatt tttttcaaaa cgagtggtta aaaaccacca    113280
     tcttaagatg gtatcaactt tagccttata agtttatttt tttgtttgtt gtaacgaatt    113340
     ttcgtcggct tttagccaag cgtgatgccc ctacttaagt agggggggac atatttatta    113400
     gatgaaagca tataagagaa atttttgtat ttttggtgaa aagaagagag gttaatatat    113460
     gaaaaaaatt ttaatcgtag aagatgaaga aaatattcga gaagtctgca aacggtattt    113520
     agaaagagaa gaatatgaag tatataccgc tgtaaatggt acagaaggtt gggatgtatt    113580
     tcttactcat caaccagatt taattatttt agatttgatg atgccgaaaa aagatggatg    113640
     ggaactatgc ggggaaattc gtcaacaatc aaatgtccct attattatgt taactgctaa    113700
     aggggaggaa agggatcgaa ttttaggctt aacaatggga gcagatgatt atttaacaaa    113760
     gccattttcc cctcgtgaat tagtattaag ggttcaaatt atactaagaa gaggcaacca    113820
     ggtagcgata caagcaaaag aatccctatc ggaagtgata gaatttccag atttaaaaat    113880
     atatccaaag acaagatgtg tacttgtttg tgaaaatgaa gtggagttaa cggtgaaaga    113940
     gtttgaggta ctttatgtca tggcaaaaca tccaaaacaa gtattttctc gctcgcagct    114000
     tcttgaatta atttgggatt ttggacatga aggggcatca aacacagtta ctgtgctagt    114060
     gagtcgtttg cgtgaaaagc tcgagaagca tacgataaag aatcattgga ttcatacagt    114120
     ttggggtata ggatatcgct ttgagccaaa tggaagaaat gaatcatgag attacgtatt    114180
     caattgttac tcatgaattt attaagtacc agtatcctgg taattgctat atggtatagt    114240
     gagacgaaaa tgttacttga accggaacaa acacggttat taacagtaat tgcggttgta    114300
     ggactgatta tttcaacgtt tatttactgg ttaatgacac gccctatcat gaggtctatc    114360
     aaaaatttaa tgacattaac gaagcaattt agtgatagac aattcgaaac aatgtatata    114420
     attggaaaag aaccacggga gtttaaagaa ttagcaacat cgtttcaaca gatggcaaaa    114480
     aaattagaag aagggtttac tcagttagaa gaaggggaaa aagcccgcaa ggagctaatt    114540
     acgaatattt cacacgactt acgaacgcct atggctagca tacaattgat gatagaagcg    114600
     ttacaagata acctgattga agatcctgaa atgagaaagc aatacttagc gacgatctta    114660
     aaagaaatag aaagattaag tggattaatc aatgacctat ttgaactttc aaagttagag    114720
     tttgaacaag tagattttta tccaagtttc acacatatag ataaagttct attagatgta    114780
     ttagagtcac attctgtctt attagaagac aaacagattg atttacaatt gcaggttcct    114840
     gatagattac ctcgactatt aattatgccg tgtaaaatag caagggttat aggtaattta    114900
     ttagataatg ctattcgata ttcccctgtc tctggaacaa ttgagttgat tgtagaggaa    114960
     aataagcaaa atcaacaagt ccagttcatt ctgcgtgatg aaggagaagg aatttctcca    115020
     aatgaccaac tacgcgtatt tgaacgattt tttaggacag atcaatcaag aagttcacaa    115080
     tctggagggt ccggtcttgg actagccatt gcaaaatcat tgattgaaat gcacaaaggg    115140
     gaaattggtg tgagggatcg cgcagatggt aagcagggaa gtgaattttg gtttactctt    115200
     cccatcacat cagaaaaaaa taagaccgct gaaagacttt tgtaacattt acgttataaa    115260
     aatgaaagat cttcttgtta acatactact aaacagtatg ttacaggagg tttttttact    115320
     ttatgaaaag aaaatatgta tggcttatag gtggttccat aattctcgtg ttaattttat    115380
     ggtctttgtt ccgaccggag aaattattta ttgataagaa agtgaatgaa acattgccac    115440
     agacggaaat gcaatcaatg aaaacaaaac aagttcagga tcaagttcaa gttataagtg    115500
     caggtcagtt tcaaaacggt gtccatgaaa caactggaac agcaacaatc catcaattag    115560
     cggatggaaa acgcatttta cgactttcta atttttcaac atctaacggg ccagatgtgc    115620
     gagtagtatt agttcctaca gatcgtttga aaaataatga agatgttaaa aatcatcagt    115680
     atattgaatt aggaaaatta aagggaaaca aaggcaacca aaactatgaa attcctgaag    115740
     ggatagatgt aagtacatat ggttcagttt ctgtttggtg taagagattt aatgaaaact    115800
     ttggtgctgc ttattttaaa aagtaagcac gaaggttctt ttgcaaagtt tcttgacaga    115860
     taaaaagttg gtatgattgc agatggattt tatgcaatcg ttagtaattg ttgtaattca    115920
     ttgtacgttt ttgcaccaga atccataaga aaatgaaaaa ttcccgtctg tttttattcg    115980
     ccaaacacta ttagaattcg aagcattagt tgcagatgtg attgaacgat atcacggcgg    116040
     tacaactgtt gtaacaatag cattgggaga ttatggtgta gattttgaaa atcgtttaaa    116100
     tggtgattta taccttggct aagtgaagtg atatgtctta caaagccatc gcacttgtac    116160
     acagtaatat tgcaaaacgt ggatatgccg tttcaaccgg tggtttttcg aaaaacgcca    116220
     aacggtatgc gaaagaatta attgtagagc taattgatgg atctcgacta gctgaaattt    116280
     acatggaatt cattgaaggt catctcataa ctcaatatgt agtgagtctt cctaataatt    116340
     aacttggcag gttaattatt agatatacat tcattagagt gaaaaatcta tgaagggaat    116400
     agtacatctt ctatatatca tatctttgta gagaaaataa tactttgtct aatactggca    116460
     ttacgtgggg aatgtgtgtt tttagggggg ggatatatgg agaggaaaaa taaatggtac    116520
     ggattaaact ctaatgtaaa tctatctgca agttcatttg atcctaactt ggtagggcct    116580
     acattgccac cgatttcacc aatttctgta ccaaccggtc caacgggaga aacaggtata    116640
     acaggcccaa caggcccaac cggtccaacc ggtccaacgg gagtaacggg tataacaggc    116700
     ccaaccggtc caacgggagc aacaggtata acaggcccaa ccggtccaac gggagaaacg    116760
     ggtataacag gcccaactgg accaggtcca actgtgagtc ttaaatttct ttatgtagca    116820
     aattttaatg aaaatacggt agaaatttat gatattttca atccaatatt tccagtacgt    116880
     attggagagt ttaatggtgg gaatttagct aatcctgctg gattagctat tacaggaacc    116940
     actctttatg taacaaataa tggagataac acggtagaaa tttatgatat tttgaatccg    117000
     atagctccag tacatgttgg agagtttaat ggtggaaatt taagtgaacc tgatgggtta    117060
     gctattacag gaaccactct ttatgtagca aactttaatg ataatacggt agaaatttat    117120
     gatattttga atccgatagc tccagtacgt gttggagagt ttaatgcagg aaatttaagt    117180
     agtcctgctg gattaatcat tttttcgtta ttcggttagt aaattctatt acagcgacat    117240
     aactattgat aatcatagct atatttattt aaacaaaagt tccttcaaat cttttgaagg    117300
     aacttttgtt tcatgtttta gaggtgggta acaacttgga aaccttgata tgacaacgtt    117360
     tttaaggctt tttattttgt ggaaaatgta ctttggaata gaaaaaaaca gatgtatttt    117420
     tagtgaaaaa tcatcgtgat attttaagtg aatcctttat gaataaagag aagagatccc    117480
     ctgtagaaac catcattaaa aacttcttgt taagttatca agttgttatc acagatgtac    117540
     cttcggatca gttattaaac atggtatgtg acgatatttt gggatctggg attatagagc    117600
     ctttgcaaga ggataaggac gtaaccgata tttatataaa tggcacaaaa gagattattt    117660
     acgaaaaaat tggagaggga gaatgtactt tcccttaccg atttgaaacg gaagaagaag    117720
     tgaaagcttt aacttataag atggtaaaca gtacttcaga atccttaaat acagctaaag    117780
     cctatgtaga agaagccttt tatccaaatg gtacaggtac tagtggatac aaagtatttg    117840
     atacaagatt aggagggaat cgagtcttat atccctatac ggtaagagaa agttctattg    117900
     ctgtttttaa gtgattaaac gttccaaata atgattatat ttccgcaacc tttaaagcga    117960
     agttacaagg attggggaga attagtttct atggtgatgg aagctgggaa acaggaagag    118020
     aatttgatta ttataacgct actgttttaa aagatgtgcc aagcggttca aaagaattag    118080
     agattagtaa tatatctttg tttccggaaa gggaaccagg caccaacata ccaagtgata    118140
     gaaaacacat tacttcagat ataaacaaag atgtgtatca agattctccc atgatagata    118200
     aggtgatacc ttaccagggt ggttctagac aggggaagtg gattcctaac aaaatctatt    118260
     gccctttttt caaatttgat tatatttgca ccagaaccta aaggtttatg tataaaatta    118320
     ttttatgaaa ctagataacg tgataaaatt ctagtcgctg tgtatctaat cataaaaagt    118380
     aagtttattt gttaatgagt tttgtaatct ttttgtaatc tttatatttt ggaaatagtt    118440
     catacttttt agagggaatg aaattaatag gtttttatag taaaagtatt tgcagaattt    118500
     tcagatgaat atagggggtg actgcgaatg cccgaaccat taaagaaaaa tagtcgctat    118560
     atggttggat tggacagtct aaggggccta gccatactag gtgttatttt gtatcatatc    118620
     aattttaatt ggatgcccgg tggattttta ggtgtcactg tattttttgt actttccggt    118680
     tatttaatta cagatattct ggctatagaa tggaaaaata ataagagaat tgatttgaag    118740
     aaattctggc tcagtagggc aaggagatta cttcctggaa tgcttatcat gctcatcgtc    118800
     accttagcat ggattacaat ttttcatagt tctttacttg taaaaatgcg aggagactca    118860
     ctagctgctt tattatattt tagtaattgg tggtatattt atcataaatt atcttatttt    118920
     gatagcttta gtcagctttc cccgctaaat cacttttggt cgttagctgt tgaggaacaa    118980
     ttttatgtgg tctggccatt tgtcattagt ttggggtttt attacataaa aaaacaatca    119040
     cgcatgatct tatttatttg tctaggagcg attgcttccg ctttagcaat ggcaatccta    119100
     tatgagccag gcactgaccc gagtagaatt tattacggta ctgatacacg ggctttttct    119160
     ttactaattg gagcggcact tgccttaatt tggccaagca gtaggcttgc gagtaaaatt    119220
     attccgcaag cacgtcttat tcttgatatc attgggggag ttgctcttat catcattctc    119280
     actatgtttt ggaagacgaa tcaatatgag ccgtttctat accgtggggg aatggttctt    119340
     ttatcaattg ctactgcctt gttagtcgct aacctcgctc atccagctag cagaatcgca    119400
     caatttttga gatttagacc actgcgttgg atgggcgtac gatcatatgg gatatatctt    119460
     ttgcattatc cgattattac attgacgact ccgaaggtaa atactgggga gttttcgttt    119520
     acaagagcca ttcttcaatt tcttcttatt ataattgttg cacaaatttc gtggaagttt    119580
     attgaaaatc caatccgaaa aggcgcattg aagaatattc ggattaagaa cttgaaaata    119640
     agaaacttaa ctttaagtgg taagttagtt ttaatatgtg cagtattcat ttcttcgata    119700
     gctacttttg gattaacaac agctagtaaa gcaaaggaga atactcaaaa agataaggtg    119760
     gaagcagtgc aagaagaaca ggctaaacat ccagttgcag tttgggaaaa accagccgat    119820
     gaaccacctc agaataaaga agaacaaaaa gaagagaacc ccgcacagcc taaagatcct    119880
     ctaacagtta cagctgtagg ggactcaatc atgattgata ttgctccgta tttaaaaaat    119940
     acttttccta atattaggat tgatgcgaaa ataggacggc aaatgtcaca ggcaatccct    120000
     gctgtggaac agctaaagaa tgaggggaat ttaggaagta atgtcattat tggattaggt    120060
     acaaatggag cctttaccaa ggagcaatta gcatcattaa tagaagtaat cgggaatgaa    120120
     cgtaaaatta tattaatcaa tacgagggta ccacgtccgt gggaatcgtt ggtgaatgag    120180
     aagctaaaag aagcagcatc atcttacaaa aatgtggtgt tagttgattg gtattcagca    120240
     agtgctggaa ataaggcgta ctttgaacca gatggcgtac atttaacgaa aataggtgca    120300
     gaagcttatg ctgctcttgt agcaaaagaa gtgaatcaat agggggttcg gaaacgactc    120360
     tggtgcaaag atttacaaac ataaacttga ctcaaggcac atggattgaa tttaaattag    120420
     caatgcatgt ataggaaaag gtgaagggac atattggtcc ctttaccttt tttatttttt    120480
     ataaaaagat ttcaaaaccc ttagtttttg gaaataaagt aatcatacct aaacttgtac    120540
     ttgttgtact tgtaaaactt ttaaagtaag atctagtaca attttttcgc gaagagtatc    120600
     aaatggctcg tttaaatctg ttggacaagg ggaaaagtct aattcgaaaa attgagcgct    120660
     gactaattcg caatatggtt gttcgttata aaaaactgta ttttcgaaga aatatttgtc    120720
     taaacgtggt aaatcaccgt ttttcggatt aataaaatga gatgtagtgt ctgaggaaga    120780
     agctactata gcaagagata gaaaatcagc tgctgttaaa tctgcaaaac cagaaaatgg    120840
     aacatttgca atgcggtcat atagaactcc attacaatca tcacttgcat attcaatatt    120900
     tttacgaata tatccttgta caaataattt agctcttgta acttggcggt aatttgtacc    120960
     tggtattgga gtaaatgcta caggaactaa cttacattgt gttaaaaata cgttttttaa    121020
     gatacgttta atttcaactg ctggaggatc taatgaaata tcagattcta caacaatttg    121080
     aattgttctt tctgctaata caactggtat ttttacaatc ggtgctcctg gagtaagaat    121140
     tggtgttgca gctgcatcac ttaatggtgt ttgagtttgt ccgtctacct gacaaggtac    121200
     attaattgga cattgttcgc tcatattatc taatctccat tttgaaatta ctttagattt    121260
     ttaaaactgt tcaatgtcaa tatattcatt tcttttattt atgtatgtgc ttgtatacta    121320
     gtttttaaat tttacttatt gaagtttatt aataaactac agacaataat ctatgagtat    121380
     cagtacctta ttaatagtag atgcttttat gaggtatatt cgtcttataa taagattata    121440
     aaaatagtaa tatgagtttt gtatttttga gtctttcgat ttctttattt atattgtttt    121500
     gaatgtatac ctttgtttaa aattttgagg atatcagggt aatttggttg aagtcaatat    121560
     ttatgaggat ttgaatgtaa actactgaat aatagtgtag gaataagaaa atatttaaat    121620
     aatacagcat ggatgacaag aatgtacgtt cgtttcgtgc tttctgggga aatttttttt    121680
     cttaatttaa ctaaaaattg atatattcgg aaaaaatcac aaactacaaa gaggatgcag    121740
     ggggaattta tgatgacgaa agagcaatga gttagggaag cggtgaaatg gggtttgaaa    121800
     catggggttc cgattaaagc agaagatatt tttaaaatat atctagatga atcttataag    121860
     gaaaatcaaa tacataaaaa agaagactgt cacgttaagt agtcttcttt gattagccat    121920
     tctttttatt ttgcatataa gtaacataca tctctaactg ttcccaagct ttttttctct    121980
     catcttctgg gttacataaa agcgtgaaag tcatcgtgaa gtaccattat ataactctag    122040
     ataaatgagg gaagccctgc agaggatgca gggcagtact aagatcatcg agttgtcgat    122100
     tctataagaa cttcttggaa tgtacaaagt gtaacacata attcatacaa actttatata    122160
     tagatgttac ggaattatga acaaagggga atggaaaatg aataaagatg aattgaattt    122220
     gggtagtttc ggtcaaaagt taataatcac tgggctagcg agattagttg aagaaaaagg    122280
     ctatacgcct catgaagctt tcgattgttg gaaacgatta aaagaaatac gttccatgct    122340
     cttttagaaa tcccaaaaga gtcgagagaa aacacaaaac cctagcaggg gagctagggc    122400
     aggggaaggg atattaagaa ttgttgattc aataaataac gaatgacttc ttcgaatgag    122460
     cttagtgtaa cacaggaact catgtatatg tgttacggaa ttatgaacaa taggacaagt    122520
     cttcgcttgt tgatatattc aggaatctaa tggtaccccc cacctagcaa atgggttcct    122580
     ggatattccg atgtgcgaaa tatcaaaaca aaataaaaaa ccgccctacc cctaggacgg    122640
     tttggagaaa atacatgtaa ttacgctaat tacatgtatt ttctcctaag aacaaggagg    122700
     agttagaata tgacagactt tttacctaaa caagtggctc atgcggttga agaattaaaa    122760
     aagatgtctg agaacaggac aagcttaaaa agttagatat tgattatgta attacagttt    122820
     taacaggtca agcgtatgga agaatgccat tctaggtggg aaataaacta tgagacttta    122880
     cgacttaaca aataactata acgaattaca aatgatgatt gaggatggtg taggtccatc    122940
     agcattagaa ggtggattac aagctattga agaaaacatt taagataaag cgcaaaacct    123000
     tgctctactg attcgcaacc ttgaagcaga tacagaagct atcaagtgag aagaaaagcg    123060
     attagcagaa cgtaggagag cggtagaaaa caattgtaag agcttaaaag attacctcta    123120
     tcagaaaatg actttattag aagtaaagcg tatcaaagga acaatcgtaa cagttggtat    123180
     tcagaagaac ccagcaagct tagatatcgc actagatgct gtagttccac cggaatacat    123240
     ggttccacaa ccagcaaagg ttgataagaa atcattactt gcagctgtta aagaggaaat    123300
     gcagtgggat ggaattacat tacgtcagag tgaaggcgtg agaataggat gagtgataaa    123360
     acacttttcc aacaattata cgacataaat gtgaatgaca aattagagaa aaaggctaac    123420
     ttatcatatc tcacttaggc atgtgcgtgg gctgaagtta agaagataga tcccaatgtc    123480
     tctgccgaaa ttcatgaatt tccattacca aatgtggaag ggataaaggt tccatattta    123540
     caaacaccaa ctggttattt tgttaaagtg agcgtgacta ttaaaggaca aaccgaaaga    123600
     ggtacacgta tcgcccaagg tgtcatagcg ccagtgaaaa cagcgagttt tgttgaagtg    123660
     ggcggccaaa gaggagaaaa cggattcgga tctataggag tgaagtaaga ccaaatttaa    123720
     attttgttaa gaaaggagga atgagagatg aaatacaaac atggattaaa ccaatatcga    123780
     attaatcatg taagagacta cacaaggtat acggcagaaa tggtcgctaa ctactagaaa    123840
     tatagctcct atcaaaatta gagattcaaa taaaatcaaa aattggtttt tctttggctt    123900
     ttttaattct ttaattaagc ccaatactgc acttataccg aaaacaatat ataggcagat    123960
     tattatggtt tctgacattt ttaacactcc taatatatag atatttccat tatatatcaa    124020
     aagttaaatt catgtaagat tttaacaaaa tccttattta aataaaagga accccgattg    124080
     tctgcggggc tcctaagggt aatcgtcaag taatgacgta ctcgactagt taacgatatc    124140
     atgaattttt tggtaaatat actggtaaat gtgtccaaat agatagggca tcattttgaa    124200
     caaaaacgct gctttaatct caaacaaaag agcagcttgt taacaaaaga aaaagaccgc    124260
     tattcaggaa ttgaacagct tgtagatatt atgtggaagt tttggaattt tattcagata    124320
     aattaaaaaa gcagctagca aaagctaact gctctccaaa tagaatgaag tgtgtattta    124380
     tattatggtc tagctgccca tatttctatt tcaattttaa tttctggtaa tcctaattct    124440
     gaaatatatc caattgtcat tgctgggtat tcagtattaa ataattgttc ccattcaaaa    124500
     tccatgtgtt cccaatcaat tttttctgtt gcccatacat tcacttttat aatgttagcg    124560
     gcagttaatt cttcagactc taaaacttta cttatatttt taaaagtatt actgatttgt    124620
     tcattcatac tctctgggaa ttggccgtcc tgatttatcc cgatctgtcc tgatgataca    124680
     aataattctg cgtttctagg gattttagta atatgcgtat agtttcctac tggttctggc    124740
     atatttgttg ggttttttct ggtaattatt ccgtttctca tatgttccac ctcatcataa    124800
     aaaaataact gcggtttctt ctatatcatt tttagacaca cttcaccctt taaaaatgat    124860
     tttagaaaaa aacagcagtc gagtacccat atccatttga taaaaatttc attgattttt    124920
     tcttcatgat tttggtactc tcctctcttt aaaacgataa agtgaaatac ttatcttaaa    124980
     taatacgtga ataatacctc aatagcaata agggtttaaa ggaaggggga ttgatagtaa    125040
     gttgtttaat taaaattgta acaaaataat ccttttgtgg taaagggcga tgaaattgga    125100
     taaacaggaa cagataatgc ccattaaaga gtggataaga gaaatacaaa agagcagcca    125160
     gcaaaagcta actgcccatc tccaaggggg aacaaggaga aaaatctaat gtcatctata    125220
     ttgttgacgg aatattgagt tttattcaag ggagattata ttttacaaat tagattataa    125280
     tggtcgatat tctccatatt gaccagaaaa gagccaaaaa ttctattgaa attccaagtg    125340
     tttttttcct agtcttttga aattctttta ttaaataacc aatagcacta attgctataa    125400
     ggatgaaaag aatgagttct agtgtaactg gcatttgatc tactcctaat ctcttatttt    125460
     aatttattat ataacgatta taagatattt tttgtggtta gtggtgaaaa attaaacaaa    125520
     accatctctt tacgaaaaaa ggtcctgttg tctccaacag aacctctcct aaaatggcaa    125580
     agagtaactc ttaccttact ctttgttcat atactacagg agtgttaatg aaaatccaag    125640
     gctctttata ttgagaaata aagaagaatc attctaaaga atcttatctt tgtcataaat    125700
     aaaagagcag ttagcaaaag ccaactgctc ggttctccaa gggggaacaa ggagaaaatc    125760
     taatgtcata tacagtgttg acggaatatt gagttttatt caggggattt actaattatg    125820
     taggttacat gagaagccct attaacatcc aggctgcccc gattagaatt aaagtttcaa    125880
     atgtaatcca aaattttctt ttttctggtt tttgaaattc tttaattaca gagaatacgg    125940
     cactgattcc tacaagagtg aatagaacaa ttcgaattgt atcagtcatg tgtatcacca    126000
     cctaagattt gaatagttta attatatatt aattaccatt ttgtagaaac ttaataaaat    126060
     aatccttcta atagaaagag aggaataaca atgggacaag gaaaccgtgg aatggctttt    126120
     gaaaagctta ttaatctagt gaatgaaatg tatcaaagag gtggagtggc gcttataaac    126180
     aagcgtccga ctcctgtgaa ggtgttaaag agtaaaggtg gccgtgtact aaatggattc    126240
     tatgaagcta agagtacagt agactatgac ggggtgtata agggacgagc tatcgcattt    126300
     gaagcgaagt ctacagagaa ccctacacga tttgatttaa agaacattgc acagcatcaa    126360
     ttagattact tggagaaagc ggagaagatg ggagcgattt gtttcttcct tattgagttt    126420
     agtaagggca agtcagtatt tgtgatacca ctggcagtta ttcaatctta cgtaaggatg    126480
     tcgcaacagc caaaaggcaa gaagtcgata ccaagagcag actttgatat ttatgggtac    126540
     ttagtagaac aaacagaacg agcaccagtt gattacttac aatacgttga tgaagcagta    126600
     tctccagtta tgtttgatgg catgattcaa tttgatcagg accataaaaa ggtagcgaat    126660
     aacattgaag cagcaaaaga gaaaatgaac aacaaaaaac acaaattact aaaagcttaa    126720
     tggataacgg aaccatgcag agttgatggt gggggctaat cgctatgcat gtttctctta    126780
     ttcaacaata agatattaaa atttcacgta cctgatgtgc atgtaaaaac caaaattcga    126840
     aataggggga ttccttcatg gaacaattaa ctttattacc agcaatcgat gacaagaaag    126900
     tgcaaaagga agtagtcagc atcttaaagg aataccgcgc attaaagatg cgattcaata    126960
     atgaagtgga acaagaaggg atcagtctgt ttccagagtt acgaaattcg aaaacgatga    127020
     gtcaatttaa agtaagacag attgagaaag tactagatga tattttagat gatgatgaaa    127080
     gaagtattat ttcaatgaag ttcttaacta ataaatctgt aaaggattca tttgtacaga    127140
     atgaactgat gataagtaac tcttactttt atgcgaagaa gaaaagtgct attaaactgg    127200
     ttgctacagc acttgggatt atttaaaaat ggcagagaaa atgcatagtt tttgcgtatt    127260
     ttttgaggtt gaaataaacg gtaagctatt cctataaaca gttctttgaa aagagaatac    127320
     gttttgggga tagcgttccc attataataa cgttactcgg tgacgcggag gctagagggg    127380
     ataagagttt cccgaaatta tttatatttt acttctcatt gagtgtataa acgtaccgcc    127440
     tttcgtttgt aggctcatag gtagtaaaac cacacctgtc atgtggattt cttgatttct    127500
     atgttaaaac tggatcgttt tacaaatgga atgatggttc gttcgattga atgaactata    127560
     tgttataaaa gaagtgtcaa ttgatttata aggagttgct cacgacaata actaatgtaa    127620
     gtcaaggttc ttcttttaaa caattaaacg agcagagagc ttccgctctt tgtttgagcc    127680
     aatacagcgg gttccccctc gtcttatgtg ttggttcaaa caaggcgtag gaagaaacat    127740
     atgcgtctgg atataaatcc tttataattc gatactggtg aaaatgacat taagtagccg    127800
     aagtattgag ccgactctac ggagtataaa cgaggagatt cttagtcttc tcccagtcac    127860
     cgacacaggg cgtgtagcca tactattgat gaggtgattt ggagaaggtt gagagttatc    127920
     ttaaccttgg aagaagaact ttttccattt gtttttttat ttctctctat tagatatatg    127980
     aactatggga gttttttaaa acataaattt tgaattacct aataaaaata tatataatta    128040
     tattgatgtt aatatattaa ctagttaaaa atggggaaag aaaaatgaag attaaatttg    128100
     atgtggttaa gaatgaaaat tttgatttca ctttattaga aacaagattg ctgaaaactt    128160
     ttaaagaagt ggatagtgaa gcaataattg aaaaggttga agataaaatt tttgaaaaaa    128220
     atgatatgca aacccattta gtggagatta ctattaatgt tacaggaaag aatatcggat    128280
     atagatcagt ttcagctagt atatttattg ttctagaaag tttatcaata aagctattca    128340
     atattagtat acattaagca tccaaaacgg gtgctttttt atttgttata tagaaattac    128400
     acattaaatg tatttaaaga ctgttttagg tataatgtga attgataatc atacaatgat    128460
     acagaacggt tttccaacca gttaccccat tagttttaca agagagcact taacttgggg    128520
     gagtgctctc tttcgtttgc acataaggag gctcccgtca tacaatatca ggtcaatata    128580
     aatacgccgt tactcactta aagagctcta taaataggta tagagctttt ttattgcaca    128640
     taaagtacct ttaaacatac tatattgagt cggggctatt ccacaaactc cttttcagag    128700
     ggagcatgta ttccgcaata gagctgcgcc atgtgaagag gaaaagcatt actatttatt    128760
     tcatactcag aatatttcaa gggcacttta cgttgctctt ttttaattga ataaaatgga    128820
     cattaaataa ggtttataac atgtatattg gatcgactgt tttaggcgct gccgtgatct    128880
     gggtggcgtc ttgtttgttg ttaagggatg ataaggggat tatttaaggt ttatttggta    128940
     cttgcacgac tccatactta ttaatctatc ttacataaat gtaaggttag tgtaatctaa    129000
     ctcgatttta ctaagataaa agtacagcta tacttacagt agagattaat taataaggag    129060
     cggacagtat gaagaaaata tttgctttat ttgctatttt aacggtattt gctgtttttt    129120
     catttggttg cgatataagg agcttaaagc tctatgggaa agataaatat tatgtacaaa    129180
     ttaaaggtga aggcgaaata aaagacaaaa cacgtgttta cactttacca gcttatgatg    129240
     aggagggagc agaaaagaaa attagcttta ctagtcacaa agcggaaaac gataaaaaac    129300
     ttaaagaaga tgcattttta cgtctttatg ttagtgaaga taacgataaa tctgtagatg    129360
     taaaatctta tgaagaagtc aaaaaagaag atttgcctga gaaagttaag aagaaactta    129420
     acgtaaaata gcattatata aggaaaaagt agattaactc ttaatatgta gagaatctac    129480
     tttttttatt ttacctagcg tgattttgat tcgttgccta tgtttcaatt aacaaaacaa    129540
     acgaacacaa cgaacaaaaa tagagatagt taacaaagtg aagtttatgc aggaaataac    129600
     ggtggtttaa gggtgaaaac agcgtaaaat caacgatgta taaaaggtgt tgtaaatgaa    129660
     agttctcgaa agtgtcgcaa acgttgatat gacggcatat ttcccaaaaa ccttgtttac    129720
     ataagagata ttatagatat ttgaaaaaaa ggagtaaaat ccgtctcaaa atgaaaagaa    129780
     ttcttatctt attgagacgg aagggaaaat tgcgaagtta tattttaaaa tctgtattag    129840
     aattaaaaat cactgtatgt tcacataaac aaagtacaat aaagaatact ttttacagaa    129900
     ctataggaaa cattctcttt caatataaaa acaattaagt tttgggtaaa gcacaaccta    129960
     tttagtctta aatggttaaa gttacccgta ttgcattgaa atttttttaa catgtattta    130020
     tatgctagct ataccctata agcagccatg taatcaatat taaaatgtat tggtgaattt    130080
     atctgcaact aaaagatatt catactgatg aaaggtgcat gatgcatttt gttggatgaa    130140
     cataaaagaa ttataaacag ggggaaaata aacaccttgc aacttcgcac gaaataccaa    130200
     ttttacgaac aataagacag ataaataaaa atctaataca gtatttaagg atttcgagct    130260
     caattgcatg aatctcagta tattggcatg tgtatatata attcatattt tatataggaa    130320
     tcattaaata ctgagctatt cattgaaaat attcatagta aattaccttt taatatatag    130380
     aattttttct tatgttgatc taatttgctc ctcataatca tgattaaatt aactaagtca    130440
     tgttagataa cgaattttaa actgtcttca tatattgatt tttgtatgaa tttatatata    130500
     aaaattgttt tattttacat acatttatat gtagtttttg cactggtttt tatggtgtta    130560
     tacaagttta tcacttagct agctgtaatt ttcatttgac caactacact ataccattca    130620
     gttttgagta tattttagta tttcataatt taattatgta aataagttcg tgtaaaaatt    130680
     gaatttaacg cgaacttgtg ttcgtgtatt ttttctgtta tagtatatat gaggtgattt    130740
     ttatggatta cagcaagcaa cgtcaaaaat cagtacatcg taagaaatta tacgagaatt    130800
     taaatgaaat gcccttttac atagaagaat ttgtggagta caaagaattg catgatgcct    130860
     ctccctccac cctactgaat tatgtatatg attttagagt tttctttaat tggctattat    130920
     ctgaacaaat tattgaattt aagcccatta aagacatatc cttctctgat ttggagaatt    130980
     taaagaaaaa agatgttgag aactttatga ggtttttaaa actacaacaa aatatgcaga    131040
     attcctctgt taacagaaaa atttcagcct taaagtcttt atttaagtac cttacctccc    131100
     tatcagagaa tgatgatgga gaatgttatt tttatagaaa tgtaatggct aaaattgaaa    131160
     tacataaaga taaggaaaca ttaaatgccc gtgcaaaacg tatgagatct aaaatatttc    131220
     ataatgatga tgatcaagag tttttgaatt acattaagta cgaacatgaa aaatctttaa    131280
     caaaacatca gttgttctat ttcctaagag ataaagatcg tgatgtagct attctttccc    131340
     tctttcttgg tagtggtatt cgtgtaagtg aattggccga tcttcgtatg gaagatataa    131400
     acttaaaaga aaggctaatt gatgtaatac gaaaaggaaa caaagaagat tctgtatgga    131460
     ttaccccaat tgcattgaat gatcttgaaa agtatatgga aattagagat aaaaaatatg    131520
     ctccagggaa agaattaaaa aatgtatttt tatcgaagta taaacatact gcacagcctc    131580
     tttcggttag ggctattcaa gatatagtag aaaaatatac taaggccttt ggtaaaagaa    131640
     tgtctcctca taaattaaga catacattgg caaataagtt atatatggaa gaaaaagact    131700
     cgttacaagt gatgcagcaa cttgggcata ctagccaaga tacggcctta ttatacacac    131760
     agcttggaga aacaactatt aaagatagct taggtagaat aggaaagaat aaataataaa    131820
     agttcagcaa tgtaaaattg ctgaactttt attatttccc ctaacttgct aggggaaata    131880
     tttaaatgcc atgtattaat cgtttcacct ttgattttat tatgtaaaaa atacatagtt    131940
     tgaattctac tttaattggt atataaaaac catctcttga tagatataaa taaatatttt    132000
     agattcctac aattgttatt tacgttaaat acaattttaa tgtacatttc atttaggatt    132060
     taaaattttg tctagtaaat aggaatataa atatagacca ttatgaaaga atcaattttc    132120
     taaaccatct ttctaaatct tcttcattct gttcaaaatt tttttcaaaa tcactattta    132180
     atataatctt tagcaatagt tctctaattg cattatctaa ctctatagca agttcgaggg    132240
     catctgcata tcttttttct gacatagact gtccatggat tacagtggaa cgaatggcat    132300
     aagacttttt cactaacgag aagtaatact ctctttgttc caattgttca gacattagtt    132360
     tagcaaaccg ttctgaaatt ttatgtgtaa tctcgtcacg accagttgta aataaacact    132420
     ctaaaattgt acaatatttc attattttca caggaacatc cgtttcatgc cttgcagcct    132480
     gaagaaaata aaaagctcgt ggtactctta atgacttaac tttatatagg ccatcagcta    132540
     tctgattccc aatattaggg ttaatttccg gatgtaaaag tttataatat tgaatagcct    132600
     catttatttc ctctatagta aacatagtat cattaattaa tccatttgat ttagaggata    132660
     aaaatgcagt attactactt gtaacagaat aaacattctt atttgtacca gttactataa    132720
     atcctgtttc tatatttaca ctatgatctt taactagcca taatgctacc ataaatatat    132780
     caatttttct taaaaaagag ttaatgtaat aataatttgc ttcaccctta atactatgac    132840
     tcttaaaagt ttcttgaagc tgcttcaatc ctccgctttg atacatatat atactatttt    132900
     gtaaagattc aaattcaaga aagccgattg catgagtaaa tgcttcatta ttaaaaaatc    132960
     gattaaatgt cgccaaacta ttagataatc tcatattctg atcatcaatt aatttccctt    133020
     tatttagagt ggcagtaaca ttaatattat agatttttgc aatcatttta taatccaaaa    133080
     ttataatacc tccaacaaac tgtatatttt aattatatta tatagcattt gttgaatctg    133140
     ctcaattcta agttaaaatt gtatttaatg taaagttaga caaatttaga caaaatagtg    133200
     cattgattat aaaatccaat gtactgtttt gaagtttgag gtgaaaaaat tgagcaatcg    133260
     agaaaaacaa gtgtatcaag cacgtgtaga acgtcataaa gaaaaaatgc cttggtatat    133320
     cattgaatat attgaagaga aaacgaacct ctcccctgct actttgtatg gatacttaat    133380
     tgaatatgaa atgtttttac aatggttaat ctcctctcgt cttgccgtcg cagatggaga    133440
     agttgttacg aaaatacatg aggtaccaat tgacacattg gaacatcttc ctcttaaaca    133500
     agtaaaaaga tttaaaagtt atttagagag acaaggtaat aaaacaaagg cagttattcg    133560
     aacattttca gctctaaaat cattatttta ctacctaacg agcaacactg aagatgataa    133620
     tggagaatgt tacttttata gaaatgttat ggccaaaatg gaaattcata aggaaaaaat    133680
     tgacgctgca gcaagagcaa aagaaatttc tgaagttatt ttccacaata atgatgacat    133740
     taaatttatg cgctttttat ctaatgaata tgagcaaatg ctgcaagaaa atgctcctgg    133800
     taagttaaga ttctttaaac gcgatagaga gcgtgatatt gctattctaa gtttaatctt    133860
     aggtacaggc cttcgggtct cagaagcggc tagtttaact atttctagtg ttaattttcg    133920
     tactcgttat attaaagtcg tacgcaaagg agataaaaaa tcagctattt tagcaacaca    133980
     aacagccctt gatgatgttc aagaatatct taaagtacgt gctgttcgtt acaagtgtcc    134040
     tgaagatgaa gacattctat ttgtaacgaa ttataaaggc tcatacgcgc aaatttctgt    134100
     taatgcaata caaaagttta cagagaaata tactagagca tttgacgaaa aaaagagccc    134160
     tcacaagtta cgtcatacat atgcgactaa tcattataat gaaaataaag atttggttct    134220
     gttagcaaat caaatggggc ataattcgat ggaaactacc tctctttata cgaatattga    134280
     tgatactaaa cgtcgagctg caattgagcg tttagaacaa cgtcaattag aagaaaatga    134340
     tgaaattgat acatgacatg aactatccct ctaagggata agaatttaat atgttaatct    134400
     atcttatagt aaaaaagcca ttgtatttta aaaaagatac agtggctttt ttactataga    134460
     tagagtgaag tgtatatttt ctgttcgtta aataggaatt taacgaacag ttgaagagat    134520
     gaagatgcta tcccctccta ctgtaaaagg acataaaaaa tgaaatgtat ctgtagataa    134580
     ttcagcattt tacactgtaa aataagttcc tactttcagg tctgtttaca ttaataatta    134640
     ttggatttta ctaaatacat ataaatatgt gtctaattat caactgcaat gaacattatc    134700
     aatagtaata tttaggtaat tatgttagca tttattacga tagatctttt ataaacttaa    134760
     agtaacacaa atgattcagg aggtgctttt cttggataaa aaagtgaaaa gagatttgat    134820
     aaaaattata tccataaccg ctgtaggttt gattcttgta ttattaatcc catatctttt    134880
     taattattat ctctaattac tctgttttta caaaaaaact aattttaact tgcagaaaat    134940
     tagtttacct atcaataaca acattcttac atttatgacc tctttatatt ttaaatttaa    135000
     ttttaatgaa atattttcca ctcatcagtt tacttaatca aacctgctaa tcaaacctgc    135060
     taatcaaaca ccctaattat tctcaaaaac cccctctaga tttgaagcta gagggggttt    135120
     ttaaaaaatt ataaattttt taatggaacc ctaacaaatt aacttggtgg aattttatcg    135180
     agattcataa tcttttagca acttttctac gctcgcctta tcttgataac cgacaacagt    135240
     ttttacaact tctccctttt taaaatagat aagagttgga actgatttaa ctcctaattt    135300
     attaaggtga ttaattaatt tttcttcgtt ttcttttctt gcttcatcag tattatagta    135360
     ataaacttgt ttattatttt ctttaataac ctctttcaaa acaggagaaa atctatcgca    135420
     atcatcacaa gttggtcggc caatatatac ccaaacgttt tctttttctt ttataagctc    135480
     ctcaaacttt tgagtgctta tagggttaaa agagcttgaa gaatttgctg aagactttgt    135540
     tgatcccata taaaaaatta acatgattat tacgaaacaa agtatgatca ttgataaagc    135600
     aattgatata tttttcttag tataaatagc cttaccctcc cattcgatag aatctgtaca    135660
     ttaaagaacc tctaactgta ccaatactaa tactattaat tactgtaaaa taatctggat    135720
     aagtggcgat gaaagcacca gcaattaaat atgtaattac tgtacttact ctaaacttac    135780
     aacttattaa aacaagctat aacaccagcg atagaacccg cacccatagt agcaacggca    135840
     gcaatacaag ctgctactgc acccatacta tactgtggag catctacatt aatcgcttgt    135900
     gcatttatac gatctaatga ttttttcact tcactgttac ttttataatc cacatcagtt    135960
     acttgatttt gtactaattc tccatctgag taagaagtaa ttacaaattt attgttctca    136020
     ctctttgtaa ttaaagtctc tgaataatta gaaattttat cttgcgaatc aaagattaca    136080
     gttaaattac ttatcaagtt atattggtct cctacaatcg gaatagtaat agatttatag    136140
     ctcttattat cctgtgaaat atctaaatac tttgcgttat caaaatccaa ctgagcatct    136200
     gaatgattca gaactacttt cccactagaa atagaatttt ccgcagtgat ttttatatct    136260
     tgaattcttt gagaatcctg tattaccttt gtagtgtttg caagatcatt cattttttta    136320
     aaggtcgatt tcatatcttt attttgatta acacttacat ttttactaac tgactcagta    136380
     tttggtgatg caaacgttga actaccagac catccgaaaa atagtgttga agccattgcg    136440
     actgcagcaa atttcttcat taaactcaca taaatctctc cctttatttc gtatttattc    136500
     gctagtattt ttatgacaag cattaattat attggcgtta gttctacaaa tttattagct    136560
     ccaataatat gtaatactgt tttttgtgtg gttgtttttc caacaactac tggctgaatc    136620
     ccttccttag ttttcaaata tccactgtcg ccttcttccc aatttggctt tgaagattca    136680
     catcgaatac ttctagcctc ttcaaaggtt gcgcttgatt ttttaaacgc ctgtggttca    136740
     ccatttgcgt ctagatgccc cgctaacatg acatctatgg tcttccttta atagctgtaa    136800
     caatcccttt caagccctct tctgtttcta caattaaccc tgggaaactt gtttccatag    136860
     ttaatgcatc tgcgtcatta atagaatact taatgtgagg gaaaagattt tttgatactt    136920
     gctcaatgaa tgttttcttt gcattcgcaa gcagttcttc ctttttatct cctgttacaa    136980
     caaaagtagt tggtgctaat gataaagtta ctgatttcaa agtaatcacc cttgttttat    137040
     agtagttttc acatggtaaa tattacgatt ttataaggct agtataacaa agtggtattt    137100
     gggtgttttt gcccatcccc cgaatgatgg gcaaaaacac ccaaaaggaa tttataaagg    137160
     tcatagtgat ttaataaacg ttttgtcaca tatttataag cgtgataaac cttgagtttg    137220
     taaggataca tttgttgcga aatacatata aaaaacagca tttcaattaa attatgatac    137280
     gattataaaa agggagggaa cgatatgcac actttacaag aagatatgta tgaacaattg    137340
     aaagagaaaa aaggggaagt tacggtattt ttaaagaatg gcgttccagt acgtgggcag    137400
     atccttgcaa cagataaatt caccgtccta atgatggttc atggtaaaca acaactagtc    137460
     tataaacaag ccatttctac aattgctatg taaaaaaatg agcacctcta aatttagagg    137520
     tgctctcgtc taataaatgt gtctaaacgt acaattttct tttttggata tggtgaggcc    137580
     taatatactt agtaatcaat acctcatgtt tgaaagattt ttgtttatat gcaaacaggg    137640
     tgataactac ttttgtacat ttcataagat tttttattcc taattttcat tcactggaat    137700
     aaattcaacc ttatccaagt aaaaaccact tcctgcactg aagtttatgc cgtttatact    137760
     agacgaaata gttactactt tttctacata ttgaaaggaa ttatatttga aagaatcccc    137820
     ttttttcatt gttgcttgat agggcgtttg atatttagct ggtccaatac cagaggtaaa    137880
     agtcatttta agtaaatcat ctgaatcagc ggcatagcga attctcaaac gataattttt    137940
     gttgtgtgca tcacgaggtg gagttaatgg aatatttccc atgctcttag atccttttat    138000
     taaaccccct cctgaatatc caggaccttg tataacttca gaagtgaaat aaccactagc    138060
     tttagtagct gagattactg taatcttatc ctcataaatt atatttttag gggctacact    138120
     atgatgtgtc caaccaaata caggtattgt ccctcctttc tcatttttat gattccaata    138180
     taaatcaaaa gattcaacat aacttaatct atgactaagt aattcctctt ctgagtcaat    138240
     tattttttgt gattgattcg taaccctaat atctttttta tattccttct tccgaggtgt    138300
     attgttatca agataatgaa actcaacttg gtttaccccc accaaactat tatcgtatct    138360
     ccctatataa ttgcataaaa ccctatgaat atcataatct tcaaaagtaa atgtatcttc    138420
     ttcactagta atttcaccac taattgttgt ttctcttacg tatttttcac caattaacgc    138480
     tttctctaac tgatgtccta cccaataatt ataatactca tatttcccat tttgtctttt    138540
     ccttgtatac atcttaagat cttttagcca agtaaaccga ctaggcttta ggattaagtt    138600
     ttctaaatct tgaaatgtag gttggcgata tgcttttgtc atttcatacc aagacataac    138660
     atccttgaaa ttacctttgt agggcaaata actccccact ggatctgtat aaatttcccg    138720
     tgtaagttct gcatgtattg gcattggata catatgtaca tcatacttag gaagtaaagc    138780
     aacgatatct aaaactgcca ctgtcatttc tcttcggaaa cgattgtagt caatccaatc    138840
     cttagcagtt gaacttttaa gtttatttaa gccagtatga taccattcca cacaatggtc    138900
     agaatatttt tctatgcact ctaagtgttc tttataaaaa agatcaattt catgttgagg    138960
     cattccccaa tcttttccga aaatctggct atctcttaat aaaagtaaat gaagatttgc    139020
     agcttgtgta tataccggta ataatgaaac ttcataatct ttaattgcaa aggaaggcat    139080
     tgcctgttta aattgggaat ctgcaacaac caatctctgt tgtactaata atcttgtttg    139140
     tgaattccga gaattatttt gccatgattc aagtgcatcc acatatgact tcattacatt    139200
     ttgcaatcct tccaattctg ctaatgcttt acttcttgcg tattctgtta atttctgatc    139260
     aatgagtact tccactcgat ccatcagctc tttccatgga tcttgtcctg gcgttgatcc    139320
     ccataaaaaa ccaaataatt tactatataa tttaacaaca gtccctaaca tcggaacacc    139380
     taaagcactc agtatagcac tagtaatatt agctgtagta tcaactagac ctggggcact    139440
     aataaacaca tcatgattca gagaatctct atttccctct gacacactca aacaatcatt    139500
     agaatcccta tgttgtaatg gattactttg atcgtttgct aaagtttttt ttacagagtt    139560
     ggttaataaa gattggtcag atgaagtgcc tattacatta gggttagttt tattattcga    139620
     attcatattt tttcctcctc tatattcaat gttaggtatt ttatacatct tttaactaga    139680
     aaaagtttat ttacaaagcg tttggatgta tagtgtagag tttgattccg ttcgaaatct    139740
     acagttcttt ttcatatatc tgtactagaa catcttttct tatggttcaa taatattaaa    139800
     atgacgatac tctgataatt gagtgatata ggacataaag ttcaccagtg catctattac    139860
     ttttggatca tctgaaatac tttcagcaat ttcttttgct ttttctggtg tactacctgc    139920
     tgtaagtgat aataattgtt gtcgtgtcat agttactgta ggtaattctg acgatgacgt    139980
     atccttaaaa tataatacgg ttccctgata gagttttaaa atgtattctc tcatgtgata    140040
     ttcacttgat ccttcagtta aatcaatatc atctgaaata attagattaa attcaaggga    140100
     aaaatgtgaa catctatccc cgtcaattaa aatacctaaa taatctaaaa tcatttctcc    140160
     tgtcatatat tcagttattt cagctcctga aacatacttc gttggatcag taactgttcc    140220
     atttcttaat tcatacgcac ctgataaata ggcgtttctc caaatacccg attcagattg    140280
     ataccccaat tgctctaaag catcggcagc taaaaaacga gccttttgat tgttaggatc    140340
     agcaaatact agcgtactca taatatctgc aacaaactga taattaccat tttcaaaatc    140400
     aattaacgat ttttcaatta ccgcatcact tccacccata taatcaatta atttttccgc    140460
     ccgtttaaca tttggcaaag gatctaaatt tgctgggttc gcatcatacc agcccatata    140520
     cttttgatat acagcttttg cgttatgttt tggcgtccca taatatggac gaatatacca    140580
     gtatttcgct aaatctgtag gtagttgaat tttatctgca atttctgtac tcgtatatcc    140640
     ttggttaata tatagtaatg tttgatcatt aataaactta tatgctgcag ctgttactgt    140700
     tatatgttca cgaaccatat taggagaatc atcggtattc caatgtggcc aattatgcgc    140760
     ttgaaacgtt acatctgttt catcagcgaa taacgatata gattcgagta aatattttcc    140820
     ccatgcattg ccatctcgca cttgagcacc gcgcaatgta tataagttat gcaaggttcc    140880
     tgaacaattt tctgctaacc ataaggctct atatttgggg aaatgagtat tcatctcagc    140940
     tggagcttca gccccaggag ttaactgaaa agtaagtttt aaatcatcaa taacaatgga    141000
     ttgattctct gtaatttcat gagtaggtaa cctaaaacta attgttcctt ttgattgggt    141060
     ctgaccaata cctatagaaa ttgacccttt tttaccagca tctaaaaaag aaccatattg    141120
     atatgcagct ctacgtgcca tcgcatttcc tgcgtaaata ttctcactaa cagcatgctc    141180
     agtaaagcct ttaggagcat aaatagggat atccggattt tgctcttcgt atgtaaatat    141240
     accgttaacc cctccaaaat gatcgacatg cgaatgactc ataattatcg cacgaatatt    141300
     acctatcagt tttggtaaat tattttttgt gaaataagta tctgcaaaat tcaaagcggc    141360
     tattgtgcac tctgtgctca tcaaagtatc taacataacc catgtttttt ggggagttaa    141420
     aaccattgtc atattagcca tatcaaatcc tctaacctga tatatctcct cagttacttt    141480
     aaacaaaccg ctcacatgat tatttttccc attgcaccat agacttggat tcactgtaga    141540
     agaccactcg tctttttcta agaattgata ggctttttga ctccaaatga ttttattatc    141600
     ttccataata actagctctt cacacggttc aactaaattc ttaatagcta atgcatattc    141660
     cgtttcgcta tttatattta aatcttcagc aacttgttta ttaaataatg ttgtacaatt    141720
     cgttgcatct tttggatctt gtgttatctt cattgttact cctcatttct atactcattt    141780
     tcttcataaa attatctaaa tatttttttg caaatccatt taaatacttc acttttctat    141840
     atatggtata atttacctcg gtaatattta ttcttcatac aataaacaac gaggggtata    141900
     aacatgaata ttgaacaatt aaaattgatc gtaaccctct cagaagagag aaaactttca    141960
     cgtgtagctc aaaaattaaa cctcactcca tctgcagtat gtcaaggaat taaaaactta    142020
     gaaaaagaat tacatacaac actgtttaac agatctaaaa atggaacata tccaacaaca    142080
     gaaggtttac atgttataaa aaaggcatat gaagctttaa aaaccatcga tgaaattgtt    142140
     gaatatacaa cagaaaaaaa agattatccc aagttaaaca tgaaaattgc tattgtgccc    142200
     ggtgtgattc ctccactggt tgaggcaatc aacgaattaa aaatggagtt tccttttgtt    142260
     gagatggaaa taatccaagg aaaaacacag cacgtcctca catctttaca aatgggacaa    142320
     gttgattttg gattaataat gcattctgat aatatccaaa gcaaaagtat cccttacaac    142380
     attaagaaag tttgtaatgg tgaatttcat attgcgatga gtagaaattc caaacttgca    142440
     ttatataacc aaatcgatta cgaaacacta ataaaagaac cgttagcact ctaccaagat    142500
     gaacatattc ttgattatgt gagacatata gaaaaagaga cgggtgaata tagcaatact    142560
     ttgtttgtaa caaataattc aaattccatt atttatgctg ttaaaaataa ttttgcaatc    142620
     acgatttcac cgcagttcac atttaacaat gaatatagaa atttttataa tgatattaaa    142680
     caagttccta tcaaagttga tgagaatcgg caaccatttg cattatggtt tgtttcttct    142740
     aaaaggactg attcaactga aattacagat accttttttc aactcattca tcattatgta    142800
     aatgctttgt aatcatttaa aatccttaaa tatataagta ctgactttag aagtgaaaat    142860
     taataactct tttaacttaa tataatgttt cttgaatgat atagaagttc aaaaagcatt    142920
     agtagatttt caaacatagg aatgattgtg gggtacccct aaatttttat ttgctgtgcc    142980
     acatatttat cgtaacagaa ataaattatt gaatacattt aatgttttta caaatatgat    143040
     taagaataaa ttaattttct aaaatattaa caaattagag agaagaaaac atatctattt    143100
     ctagccgaat tgaactttat gttataagtt caaattgctg acggtagact ctctctggtt    143160
     ttggacagat tgattttgca aatcaatctg tcccttgttt aacatataat tggtttaaac    143220
     actactcaat atagagaggc ttgatttaaa taacttgatc aagagcgttg tcacaatggc    143280
     tcagcagtaa attcatgtaa tgaggttttc atggaatcgg ttaatagtgg tacggaaaca    143340
     ttgccatcaa gctaacaaag aaaaataccc caaaatgaaa aaacggtatt ctttttgtag    143400
     aaatatacag aaaggatacc gttttagcta tgaatttatt gatttctgat gaactagaat    143460
     tgttttctaa cgaatttcag cgatatatgt caccacatgc ttcggagtaa ttaattactg    143520
     cttacgtagt ttagagtttc ttgtctcagg ttcaaaaagt ttagagtttc atgtcttttt    143580
     gctgagacaa gaaagtacct acaaaacttg tgataatggc tatttatcaa cgtttgttca    143640
     taggatttta gtttagactt tcatgtcttt ctacacttca taaatgtaca aggacgtgaa    143700
     aatggatact ttttagacaa gaaagtggat acttctgttt ttgttattgc ttttggacaa    143760
     gaaaacaagt attaaacgaa tcttctttat tggtaattag atattttacg ttattaatta    143820
     gtatccagtt tcatttcctt ctgcataaaa acatgtttta cgataaagaa aaagaatcca    143880
     ttttgaaaaa agattaatca aaatagattc tcgtgttaga catataaaat tagtttttat    143940
     acaagggttt aatctaagat tcccaaaaaa cttcttaaat caatatttca ttaaatttaa    144000
     cgaaggtttt taatttaaac ttcattttaa agctataact atatttgtgg ccacccttat    144060
     agtactattc tattgtaatg ctccaatctc catctgcttt tactccaaaa ctatacatcc    144120
     ctgaatcttt gaaaacgtga gaagaagaac cttcataaga accaatttta ttcactaata    144180
     aattctgatc attcacttta ataataaagt ttcttgaacc tgtatgcttt aacttaacaa    144240
     tatgatttcc acttgggata ttaatgaata ctacatcatc accatgcccg ttaattgtcc    144300
     ctggaaccga ttctgataca agtggtgttt cttgcgttat tgctacattc caatcgccac    144360
     tcgatttcac ttctaaataa tattctccac tagccggaat cgtagctgat accttccctt    144420
     tataactacc tattgtattt actaacaatc caacatcttt gccactagaa tcttttaaat    144480
     gtattataaa gtttcttgaa cctgcattat taaaatcaaa aaaagccaaa cctgacttta    144540
     gattaacttt atttgtgaca gaatcaccag atccttctaa tttctgttta ttattttcgt    144600
     atgattcttt tagctttcta tcagcttctt cttttgcaac tcttttttct tcgttcattc    144660
     tattttcttc atctttaatg aaatttccta aagaagcttc gtcagttaac gtttcaactt    144720
     taataacctc ttttgcattt aataccacta ctacaatttg cccatcttta gtatcaaatg    144780
     tgtataatcc agctggatcg taattgttat agtttcgaac ttttaactta ctgtcttctt    144840
     ttttttcttc aaattccttt atactcatac cgatagtaaa caatgattta atttcttccg    144900
     tgctatactg tttgtgagta ggttctctag attcttcttt tgcatctact ttccccgcat    144960
     ctacagcagg tttcttttga cttgtaacat ttccatcgct actttcaaca cttgtactat    145020
     atggaattac attgtctagt atggtatatg tggtaaatgc aataagaacc acaatgaaag    145080
     tttttaattt tccggattgt ttttttacaa attgtaaaat tagttttact gtagcgcatg    145140
     ctccaataat aaacgttatt gcggcaaatc cacctcttac tccaacagaa aatccagata    145200
     tgattaaagc aagaccgaat gatataccag caattttcag ccatatgata gctggttttt    145260
     ttcttatttt ctgtattagt gagtatacta ataaactgat tgaagcaaac attaaaattg    145320
     ttatcaaaat gtccatacta ttaagttctc tccctacaat aattaactta gtaaatatta    145380
     atactccagt tattataata accttatatt ctgtaataag gaagtggtgg tattttttta    145440
     tgaaatacaa ataggaattc tatttagata actatatttt taacaataaa agaaataact    145500
     gtacaagaac atgaaaattg atacttttta gacaagaaag tagatccttc atgaatgtct    145560
     tttgttactt atgtagaatt aaattttagt tgaacttcac atttaattag gttttactga    145620
     gaactaaaaa agagagcatg gctctctttt tatactattt actatttagt tttgtttcaa    145680
     attcagttaa atgagttgaa gcgttattaa acttttgttc agaaatttta atggattttc    145740
     ttgcttcttt cattctgtct tccattggag ctaaatctcg tattccttgc aatatagcat    145800
     ttgctgcatt ttctctataa tttgccgcag caccaaactc ttctctaaat ttatttattt    145860
     tttcttttaa agttgggtca tttattttat cagaggaatt aaagttaata ttttcttttg    145920
     acaattccct gtatttagta gatacaagct ccatctgttc ttgtaaagta ttttggttta    145980
     tagttgccaa agtttccccc tctttgttga aaactgattt tacttcttga ttccatatat    146040
     tattaaactc ttttatcatg gaatcaattt taggtttaat ttcatttttg tatgtaacat    146100
     catccgtatt tgaagaagtt tgaggctgtt cttgtttagt tgtagttcct ccataatgtt    146160
     gatctatatt gaatcgaatt ttatattttt gtgtcttcgc aattgttatt tcaggacttt    146220
     ttttatttat ttcaaaagta aaatcaaccc attgtataga ctctaaatct tttgttccgt    146280
     aatcattaaa tacaatttta ttatcctgtg tatcatctat ttttttagta ggatttataa    146340
     aattttgttt aataaatgtg gatggttcaa atagttcgcc ctgatcagta gtagcacgca    146400
     tcttattaaa gctaaaagag aaagtagaat ttgttgtatt ttcaattgta aatgcaattc    146460
     ggagagaacc cacgtctttt ccatttgaag tcctttcttt attagttaaa gatagttggt    146520
     tcatataaac tttaagccca tcaaagttat cttcgaattt cgcattatca taaattatga    146580
     aatgctcatt atttgtacca ttaggactat atttatatgg acctgcatta atagttgtat    146640
     ttatttcttt tactggtaca tcttcttttg tatctttttt ctgtttatct aatgtccgct    146700
     atatacaaaa aaagagccgg aaatcggctc ttttttatcg tttttaaaca attatttagg    146760
     ggcatacgga agcgaagaaa tcttgctaga ttacttattt aattgctttg atctaacact    146820
     ttaaaatcat aagcatgaat tgatttccct ccccggacag atttaataat ttcttccata    146880
     ccactaattt cagtttcttt aattttctta ccatctttca aagaatagat ttctatataa    146940
     taattatttt ttcgattttt atcatacctt aatacatata attgatctcc ctggaagaat    147000
     gtttgctcat tatatctaac cccatctgtt acgctataat caatcttaaa cttagtattt    147060
     actgtatttg tctgtgtatt aaacgtaata acattgccta atccatttat aaaatatagc    147120
     tcattgttat gtagataagc ggaattattt ttggtaaaag gtattgaagc tgtagagtct    147180
     tcttcggaag acaacaaaac taattcttgc ttcaatgtcg ttttattgac acgcaacaaa    147240
     taaactttac ctttaattgt attatcattt tcaactaaaa ccgtatagta agaatttgaa    147300
     tcacttaaaa tagaagaata actagaatat gtcatgtttt tatctacact aatttcagta    147360
     acatcttcaa gtttcatctt tagatcatta aatgttaacc tttttaaagt atactctttt    147420
     ttatctatgt catgagtcat gattggaata gtttcttcat ccactccagc gcttataaga    147480
     taatgtggaa tattcccttt atgaatgcct tttttattac catatacgac atttgaatca    147540
     tatcctccag tatcaggatt actgccagaa ttatagatat tcacaaacaa gtcgctgttc    147600
     tttaaatatg ctctgtaatc tcctgtatgt tggtatttca tcttaaactc tttaaagttt    147660
     tctcctacaa atttaagctt atccttactt tctaataaaa gttctttttt attttccgat    147720
     actcctatac caccaagctc taaaccattc attttataac cacttgcttc gccattctta    147780
     ttaataaaca cggcataact aatcccctta ccatccatat cttgatcagc tgtagaagaa    147840
     aggtatatta cagattgctt atcctttaaa aaatcctttt tttgaacatc ttcctcagat    147900
     attaaatcca catttgagtt actaaaaaag aaataataga ctaatactgt aaccacaatt    147960
     acacttaaaa tagcaaatag tatttttttc attatgatat attcctttct taaaagaaga    148020
     agtgcaacaa atatgtttgc tgcacttctt tctattagat atttctaatt gttgatgtct    148080
     gttttgcatc acgaacatct cgtggatata cgccagctcc accatcttta tctaagtcta    148140
     aaccaccatt aagcttatat gctgaccaaa taagttttga acaattttta gctccataat    148200
     gagtggtact tctatttgta gcgaaattat aagaatatcc gtctttacct acacgatctt    148260
     tcgcccacca tgcagcatca tttttatttt gccaagaagt attaatagat ttgacaacag    148320
     catcgccttt atctactttt cgagctgttg tgctaagtgt acgtactcca ttgtctggaa    148380
     cagattctac tattgtattt gaactatagt acataccaac atgtccatga ttcaaatatg    148440
     cagtataaga accagtataa aagaagtccc ccatattgct attacctaca gaaactgtac    148500
     caccgccagc tcctaatgtt tttacttttt catttgcttc ttttgtacct aaagcttcat    148560
     ctgctttgag ttctttatag atttgttcag caattgcatc tttcgtattt cctgtatttt    148620
     ttgccatttc atcaatactt gataataatt ccgatgtact cagatcaggt tgcattttct    148680
     taatttcact caaatgaggt aactcttcac ttccggcaaa agtagcagta ggtacagcca    148740
     tagctgaagt tattaaacca attgttaatg ttaatgcatg tatttttttc ataatatccc    148800
     ctccatatta aaatctttca taaaaataaa ttgactaata tttcatatga taaggatatt    148860
     aaccttatca tatcttacaa ataacgtatc cgtaaatgca ttttgtgaat ttttaaataa    148920
     ttgaaaatag gaaacctttt cccatcccca agaaaaggtt attaaaatat tccactttct    148980
     ctttaacgca aattgatatt tttttcttat tcccctccct ttaaacccca tatattttca    149040
     taatttcttc atctcctttt agattaataa taggttctat ctcataatac aatttattaa    149100
     atcaaaatgg aatattttgt agataagtgt aatattatga tgatttggga ataattgtat    149160
     tattcggttt tggttaagaa tatttcttta attaactatg aatctcttat atttattaat    149220
     aaaaaaaagt atgctttaat tcggtgtcaa aatttgatag gtggagaata cactaaatta    149280
     gtgcataata ataaaagacg agatgctgga aacatcccgt ccgatatgta actgccgccg    149340
     ctaggtggta ggttgcaaaa agtttattgt ctttttgaac cacctttatt acgtttggct    149400
     gacgtggagg tggttctttt acgtttatta ctgcctttta caagcttatt tgcataagca    149460
     gttgcaaaga aaggaggcgt tttttaagtt ttataatcaa caaaattttg agattacaca    149520
     aaaccgtaaa ttttatgaag ctatgtatga ccaagaccat catttggttc gtattgaaaa    149580
     agaaatgaat tggaatattg tttataaatt agtaaaaccc ttctatcaat ctcctgtggg    149640
     gcgcccttct gtagttccac tcattatcgt aaaaattttg ttgattcaat atgttgaagg    149700
     gttcccctct gtccgtttca catgtaaaca agtcaaacaa aacgctacat atagatgatt    149760
     tttaggtatt tttcctcatg caaaaatacc ataacattct accatttcta aattccttac    149820
     tcatcggata caaggttttt ccatttggga agatcttttt catcatatct tacatcaaat    149880
     tcaaaaggat ggttttttat cccgtgatat ctggattgct gatgaaacag agctgaaggc    149940
     aaatgcaaat aagcgaaaac gtgaagtttg gatacaagaa gtagaaatca aagaagactt    150000
     ttacacatta gagaaagtga acaagcgaag ctttcctcgt ttttggtctg ttcgacttgg    150060
     cgaaagctaa aaacctatct ggcccagtat caacgttgct gtaaccaggg gcaaagtagc    150120
     aacgctggta ctgggcctac tttacagatc catcatgaat ataaccatct ttaagtctaa    150180
     taactcgatt acaaacatta gcgactgttt catcatgagt aaccaatatg aatgtttttc    150240
     ctattctatt caattgtgta aaaagattta gaattgtttg ctcggtctct tcatctaaag    150300
     aaccggtagg ttcatcagct aaaatcagat ccgggtcatt tattaaagcc cgtgcaatgg    150360
     caattctttg agcttctcca ccagacaatt cacttggata ttgatcaact ttatcctcta    150420
     aacccatttc ttgtaatatc tttaacactt tagagtgaat ctctttcttt gaagccttac    150480
     catataataa tggtaaagct acattatcga atatattttt atcttcaata agtgcatgat    150540
     tttgtaaaat aaaacctata ttattttttc taaacaaagc aagttcttta taactaagct    150600
     gtgtgatatc tttatcttgg aagtaataac ttccgccatt tggtttttct aatccagcta    150660
     gtatgtgcag taaagtcgat ttccctgcac cgcttcttcc catgattgct aacatttccc    150720
     cttgttcaac aattaaatct atcccttgaa taacatattg tgtttttttt cctagcttat    150780
     aagttttttc taaattaatt aatttaatca taaattcatt cctttttctt taatattttt    150840
     actatattag attggtttaa tttgaaagag aaaggtaaca tacctaatac tataattatt    150900
     aaacttacac caagcagagt aaaataataa ctgatcggca tttcacccac caattgcata    150960
     aatgaaaaga ttaatgtaag gctaagacat ataacacaaa gtatttctgc aaaggcatac    151020
     aataaaattt gaggaacggt tgctcctgat ataagatgaa tagcatactt tttaatattt    151080
     gtatcccatt tcataattaa tgaaagtgaa atactaataa tacagaatat aaatattact    151140
     gcagtaaaca aagacattaa ctgaatattt tgtttcatca ttgtgaacat taaacttatt    151200
     cctatagtat ttgctcctat tattatataa tcatcaaagc ttactttttg ggatatagca    151260
     ttaactacct tttgaacaga aatcatatct ttatttgtaa aaatttgccc attaatagca    151320
     tgtaagtagt gtttttgttg aaaacttaaa acttccgcat tctgtggaac ttcttccata    151380
     ataaattcag gcaggataac atatctatcg gcataaaatt ccgaatcacc attaactggg    151440
     aatgaggtgt ttttttgtaa aatccccact atcattcctt ctaattcctg atttaaataa    151500
     tcaaaataaa tagtgtctcc tacattatag gtagattgat attctgctcc gagaatgata    151560
     ggtattttcg ttcccttttt aaataaaaag tcttctttat taaaaactct ccctttttgt    151620
     acttttacat caaaagttga aagtacattg tcgtttattt gtatagattt tactctatca    151680
     aaagaaggta atccttcctt tttttgataa ggtggtctag gatccccctt ttcataccct    151740
     tgaaggaaaa tagattgtcc tttaaaattt tgaacaccga tatgttgtaa cgttgtattc    151800
     aagtaaagga aatcctttga atttaaaaga gtgtgataaa aatttttcac ctttagtagt    151860
     tcgtttggat ttgaaaaaaa ctctacttcc ttttcatcaa acagttgatc tgaaagttta    151920
     taaatatttt tcccttcata ttgtgcataa aagcttttcg tttttgtatc tatcttataa    151980
     aaagatagat acaatgcaga tattaaggcg aataacaaac atgtctgtaa taaaattaaa    152040
     atcgataaca tctttttctt caacaaactt tctttcaatt caattaataa tgttctcaat    152100
     tattacttca acacctttaa tctaattttg gaagaataga taaacatagc aagtatgcat    152160
     aatataaaat gatatacaca taaaaataat atccctaaac cacaagaata catatatttc    152220
     tctaaatgtg cgtcgatatt gtttaaatta aatattatga acataaatat actaaaaaaa    152280
     taggaactta ttagtaatag aacatgcttc ttaaatagat tcatataaat attaaacata    152340
     cgatgtccta ttacatgttg tatagaaatt gaaattcttt ttttataaaa ccaataacta    152400
     caaattatta tactcatact caatattact aaaataaaaa gaacgaatat tccataatcc    152460
     cctctatttc tttcaaatac ccttgaactg cctacagttt ctttatcggc ttttactata    152520
     gaaatagagg atctcatatc ttgttcgagt ctatcgaacg tagatgtcat aaccttgtta    152580
     ccatctaata cataagaacc ataactttca ttttctagtt tcagtgcggc atctaaattc    152640
     aggtatatca ttttgtctaa ttttgtagaa aaatcctccc ccataacacc aataatttca    152700
     aaagatgtat tgtttaattg gatgtatttt ttatcatttt tgaggacaat atcattatta    152760
     tcttttccga caaccgcaat gtttttattt ctgaaaaaat catctgcttg aaaaaagcgt    152820
     ccgctgacta gggggggagt tgcaatgtca cctgatttat aaattccttt tatataagga    152880
     agttccaaca cattttcttt gaacagcatg aaatcccttt catctatatg atctaaaagg    152940
     ttctgcatat ttaatgggcg gttatcatct tttatgtgaa aagcgacact atttttacta    153000
     taaaaattat ttgttatctt atcaatgcca tttattttta tcaaataggt tgtagtcaag    153060
     cttatcatta aggtgaaaat tataacatat gcacttaata caccatcctc tattgtgaat    153120
     ttctttatcc gttttatata caatcagtcc accccaataa catagtattt cctattaaaa    153180
     taaaatcagt tctcatggag attggataaa aacataaata tactcactca caaagctcaa    153240
     ataaaaatag ctagtacaat ttttgatata caacaatcta ttgtactagc taatcctaat    153300
     cagaacgcag tcctatattc taattgtttt ttgaggtttt ttatttattt ttcatttcca    153360
     taaaaagtat gagcactgaa aaattcattt ttccaaggag attctgctct agtctcatgc    153420
     cagtcccatt gtctaccgct atctgccttg acagaccaat acagtttcaa ttgagcgcga    153480
     gtatagtggt agacaccatt ccatgttgtt tcaccaacag ctcttctttt atcattctta    153540
     tattctgccc accctgcatg gctaacccct tgagttgcat aatttagatt actaaattgt    153600
     atttgttctt tatcagattc tagttcactc catcctaaat attctgtaaa gttctgtggc    153660
     tcagtctgtt ctatagattg tgaattaatc ttagaacccg tgttttcatc agcaaataca    153720
     ctgccggtcg gtaaaatcat agctcctgca agtcctaaag caatagtctt tcttcttaac    153780
     attaaatagt cccccatctc aatttattta tataacagat gcataaatga ttaaatttat    153840
     gtatcgtttt cattttaaca atatattcta tttatgtaaa tatatacaaa attatttttt    153900
     aaatatatta caagtttttc catgactaaa ttacttataa gtaactaggg gccaaaacta    153960
     cactaatcaa ccataatata ccaaaagtat taactataaa ttttttacat ttaccacctt    154020
     ctatattcaa tatttacaat aataatagta caaccaactg taaatgtata tattttacaa    154080
     tcaattcatc tattacattc atctgaattt ctaaatataa ctataataac taagggtttt    154140
     tactcatgaa atttagtttc ctgtttttgc tatttttaaa aagtatccac tttggtgtct    154200
     ctgtttaaaa aagtacccat tttcttgtct caatatgtga acaagaaaat gggtactaaa    154260
     tgaactccct ccgttgataa ttcagcattt taaactatga aataagttac tactttcatg    154320
     tctttttaca acaacgacat tgtagaaaga catgaaaatg gaaacttttt atacaagaaa    154380
     gtagatactt ctattcctat cattgtttta ggacaagaaa atggatacta aacgaatcat    154440
     ttttattggt aattcgatat tgcacgctat aaaattagta tccagtttcc tgtctttcta    154500
     caaaaattcc tcaaagaatt agagatacaa gtaaaaataa aacagctact atactgaaag    154560
     cagctgtttc ctaatgtatt tatcttctat gcatttgtag taatgttatc gttaaatttt    154620
     ctaaatctcc atcattttta atttcctgta tgacttttcc ttctttcata aagagtatcc    154680
     ggtcaccaat ttcagcagct acatccatca tatgtgtgga aaaaatgatc atggtaccat    154740
     ctctttttaa agtctttaat attgttaaaa actcatctac ccaatacgga tccaggccat    154800
     ttgtcggttc gtctaatatc aaaattttag gatttccaag gtacgcctgc ccaaataata    154860
     gcctctgtct catcccttta gataatctat gtaaccgttc attttttttc tcatttaagc    154920
     ctattgattt aataactgcc tgtacttttt cttttcctat atttcgaaaa gcagcataaa    154980
     agaataaaaa ttcttgaact gtcatatctt gctgtgcatg aaaatcatct ggcatataac    155040
     ctatttcact cacatactgt tttctatctt tctgtaattc tatattccct aattgaacgg    155100
     taccagttgt aggtgttgta attccagcaa ttatatcaag gagcgtactt ttccctgctc    155160
     cattcccacc gcataatacg atacactctc cttgtttact ttgaaatgag attggagata    155220
     atgctatttt ctttttatat cttttacata cttctttgat atttaatact gtcatttttt    155280
     tcttctcctc tccatttgcc accccgccac aaacaagaac acgattgtat agataatgca    155340
     gtatattagt agaatccaaa taacagcttt actttgaaaa atcattacca attgatcata    155400
     tacttgccca aatattgctc caccacctaa ttgaattaca aatataattc gaaggaattc    155460
     tgctgggttg caaaacaaga acatttttat taatggcgca atcattgaat atggaacaaa    155520
     attaagaaca ctaattaaag ccgttggcca catcataata agaaagaacc aaactacgat    155580
     acttatggct aaagcttgcc acctagttat agaaaaagaa ccgattgtta ttcccagtaa    155640
     taaaaataaa aaaattaata aaacagagaa gatatacgtt gctaccatcc aaaatatatc    155700
     aaaattacta ccgcttacta acccaatgat tatacttact ccaaaactca ttgaaaaaat    155760
     agctgtttgc gctataaatt gaccgattat tttacctatt acatatgagg tactctttaa    155820
     aggatacgta cataaaagtc tccatttccc attttccact tcgcctgcga tagaaaatgc    155880
     tcctataatt aacataagta agggtacaat atataaaata aggtttacca ttgtccccgc    155940
     cacatttgta taacctacta aagacggggt atttctttcc ataacaaata ttaaagaaaa    156000
     tatagttatc caaagaaaca aaaacatgta tgcaagttta ccccttactg cactacgcca    156060
     ttctgaatat aatatattcc acatagctat tcacctctct actgaaaaag acaaccatag    156120
     ttggttgtct ttttctcact aatttttcat agtaataatc acttattagt gagaatgtcc    156180
     actaccatga tctttctttt cttttcccat catctcttta ttcatttccc atttatgttc    156240
     tgcaagctct ttagaagaaa ggatttctcc agtatgtttt tctacgaagc tgtctgcatc    156300
     tttcttttct ttaaaagaaa ttacattata agccattggc gtcttaattg atttgtcata    156360
     tatatatgta gctttatcca ctgcaaccca atcttttgta ttgtaatctc ttacaaattt    156420
     ctcttgtatt ttttcatttt tatgttcatc catccattta tacatacaac caatatcatc    156480
     aaattttaga gcttttccat tttctaaaat aacctcagtt gcaaattgat tatccattac    156540
     tgccatatta caaatatcac acttatcatt tttttcatta atagcaaccg gttttgtttc    156600
     tttgttacca catcctacta tggcaaatac catacataaa caaatagcaa ataacatata    156660
     cttaactctc atcaattttt cctccctaaa ataaacaata tacttcccat tagtaacata    156720
     cttacactta caatcaaaat gttagactga aatgccatcc cctcaccttt ttgcggaaca    156780
     ccttttggcc tcatgctagg ctctttatct agcaataaag attgatctgg aatttttatg    156840
     aaactttgta aaatacgcat ccctggtgat tgaaagaaca actgatattc tggaatatct    156900
     tgtgttaaca gaagaaaata ggcatctgct ttgtatggaa tattactagt acctgaaccg    156960
     tctgcatcta cttttaaaga agcgtcccaa taattattat agatattgtt ttccctgctt    157020
     tgtgtagctt gcgattcatt aacattcccc atcattacat tttgagtaaa ttcatttgca    157080
     ctggcatctt taaattgtaa accgataaaa ttattagaaa ttgagttatc cataatagta    157140
     ttgtgatctg ccttttctac ataaacccct actctattat tagcaatttc attttgtaaa    157200
     acttttgttt ttgtcgcatc atatagtaat aagccttgtg catgaacatt acttttattg    157260
     taaataaagc gatttcctac tacagatgtt tcctttgttc ccataatcat agcacctgtt    157320
     gtattttctt ttgatatatt tttttcaaca actgtcctat cagaatacat aagatgaatg    157380
     ccataacgag actgccagat tgtattttcc tttattgtat tattgtcgct ttgttccaaa    157440
     taaataccat cacgggcatt ttggattttg atgttctcaa taagattgcg attggattgc    157500
     cataaatcaa ttccattggc ccgtctttgt ccaacaatca tactattctc aatctttata    157560
     tccctagcat tttctaactt aatccctata tatgacgtat gaacttccaa tccactgatg    157620
     tagtgcttat ctccctctac aaatattgct ggctgatccg tattatcatt acattgttct    157680
     attttcaaat ctttaaggat aatgttttcc ttatttattg taatgacagg atctttacca    157740
     caagagatta ttttagtatt tttatctcct tgtattgtaa gcggtttcga tattttaatt    157800
     gtttcattat aagctctatt ctctaatgta attgtttcat atggggaagc cgcgtcaatt    157860
     tttgattgta atgtagactc cgcatgaata cttactcctg gaaaacaaaa aactaataat    157920
     aacagaagag gagaacaaat cttcttcata tacagttccc ttctctcaaa gctattagtt    157980
     atcactatag aagagaatac caataatttg tgtgaaattt gtgaaaaata aacgtagttt    158040
     ttgtgataca tataagatta tacctgaagg taacagagtt actacacttc attagaacat    158100
     gatttttaaa caaataagtt tgtttaaaga agccaatacc tacaactcat ttattcgcaa    158160
     ttatacatac gatatttaca taaacccagt caagaaatta ctacaagtag ttattgaatt    158220
     acgtacaaaa gaaaagtttg ttaaggcagc cgtataagag ttatgaatat tattttttat    158280
     ttgcgcatgt accacctttt tatagtaacc atgttttact acttgcctaa catcatctac    158340
     ttcaattttc attatttgtg aaacatctac aacaattgta ttctgcagaa cactcactac    158400
     aaatcccgtt aattgtaagt taggattttt acgatatgaa aattgaacgt aatccccaat    158460
     tgctgccttt ttgttatgct ccatttggta ccccctaaat tatcattaat tattcaatag    158520
     gtttcccctt ttttgcttct tcatactggt tggcaagttt ataaaagaac acgtaatcct    158580
     atttttcata gcctctactg cagtaattat accgataaga cttcaatctt aaataaaata    158640
     aatacttaat tattttatgg attttgtata gcacttttat attaaaatga aagtaaatta    158700
     acattcaaaa attcactttc aaatattata ttattactgg ctaagtagtt tagaccttct    158760
     tgtcctatgt tcaaaaggtt tagactttca tgtccagtta ttgagacatg aaagtaccta    158820
     caaaatttat gataatggct atttatcaac gattgttcat gagatcttag tttagacttt    158880
     tatgtctttt tacaattaat gatttgttgt acaaggacat gaaactccaa actatttaga    158940
     caagaaagtc taaactttcg cttttagata ttggttggga caagaaactc taaactaaaa    159000
     ttttatagat ttacagaact agccacattt aatcttgtgc aagatgctcc ccttcttacc    159060
     taatgaccta taccatcatt tccgttaatt tattaatata aatataatgt ttttgatgga    159120
     ttatgagggt tacattatct tgaaggaaaa ctttcccccc aacaattcat atatgattca    159180
     aaaggtctat gtatttttga agtccttcaa aatgttatct cgaacctttc gacacattga    159240
     tttttataga aatataacta cttcaaaagg cgtacctttt gaagtgttag aatactcctg    159300
     aagaaataaa taattctaat cataaagggc agttaatatt aatttgtttt ggcagaggtt    159360
     ttgataatta taaatccaac ttttctattt tggggacgat tcatttacag aagataggta    159420
     ataacataat tttctcaata aggaatttta ttctttaaat gtaatttttc acaattcatg    159480
     ttatatctgt attaagggga ccttttcggt tgattaggga gaaagattat aaaaatgata    159540
     tgggaggaac aaaaaatgtc attgaaaaag aaattaggtg ttggagtggt ttcagccgct    159600
     cttggtttat ctttaattgg tgggggaaca tatgcatatt ttagcgatca ggtggtgaca    159660
     aataattcat ttgctgcagg tacattggat ttagctatgc aaccaactac ttcacttaac    159720
     ttagaaaatt taaaacctgg ggacaaaata ttaaagaaat tcaatttaaa aaatagtggt    159780
     acattagata ttaaagatat catgatgaaa atagactata ctgtaaacga tttaaaacaa    159840
     aataacacta cagaagattt cggtaaacat attaaagtac aatttctttg ggattgggat    159900
     cctgcaaaaa gccctgcata cgagacaacc cttgcagaac taaaatcaca aagcccagag    159960
     attgcctcca aaaaagtatt tcattctaag tggaatgaaa caggaggatt aaaacctggg    160020
     aaaatggatt ggttttggat taagtttata tttgaagaca acggaacaga tcaaaacgtg    160080
     ttccaaggag atagtattgc tctaaaaatg gaattccaag ccaatcaaac agatggacaa    160140
     gaaagataaa gtatttatat tcaggattaa tttatatctt ttgttattta tgtagaattg    160200
     aattttaact tcacatttaa ttagtatttg ctatttttac aaagtaccca ctttggtgtc    160260
     ttagtttaaa aaagtaccca ttttcttgtc tcgatatatg gacaagaaaa tgggtactaa    160320
     atgaaatgta tctgtagata attcagcatt ttacacttta aaatcagttc ctactttcat    160380
     gactttttac aaacgacatg aatctctaaa ctatttcgag aagaaagtac aaaatttatt    160440
     tactgtctat ttatcaacgt ttgttaatga gattttagtt tagacttaca tgccgttcta    160500
     cacttcttat tagaactgta ttactcaata ttaatttctt ctaagattat agatggatta    160560
     acaacaaata taatgaagtt taagtttgta gtatgtacta gtattctatt cttcgaggaa    160620
     gatggagttc caatataaac aacatgatcg agcttattat gaggaacgtc attcgtagat    160680
     atagtaatta tatcttttaa agggatggta atctctgctg attgccatgc aatcattata    160740
     ctatcttggg actttgttat gctaattatt gacattttat atcaatcctt tattaatttt    160800
     agataaataa ttaaccaatt acctaaataa ttttaaatca aaccatctat catgatataa    160860
     gtattttaag aatttgtgct tatatatgca aaattacatg tacaaactcc ttattttcat    160920
     aaaaatacac tatattaaaa acgatttgac tactattaat caatttcgtt tcttttcaat    160980
     ttaacagtaa ttaattgaaa aaaagctgct attctattag cgaatcaaat aaggcataaa    161040
     ttgatgaaaa caaaatcttt gtagacaata gtgtgggatt ttttgacaca tctgctcaat    161100
     gaaaataaaa aagaccattg tattttataa aagttacaat agtctttttt aaaaatctta    161160
     tatcatcata tttgatattt attatttctc ttttcctttt tcctcaataa taaattttga    161220
     aactaatttc gataaagctt ctacttttta ttttgttaga ttgattcgat atctcctcaa    161280
     ttgatactta agcctattat tacatttata ccttctactt taagagtctt acttagatta    161340
     tcaataaata tagcataaat ggaaaataag atacccataa ttccaccagt aagccctaat    161400
     atgtattctg ttgttcttct caagattaac actccttaaa atacaatatt attctattaa    161460
     aagtaaaata caaatcagtt acttttatag ctatattgat ttataatttt atgaacgaaa    161520
     aaagcactct ttcgagtgct ttttctaata ctgcataaaa aaatatgatt ttccactctt    161580
     aaaacatatt gtaaataaag tatactaact atctcaattg aaattatata aaggtataaa    161640
     aatgtaattt tatttaaaca aatctattag atgttatatg atgatttaaa tacctataaa    161700
     aaaactacat tctatataga atgtagtttt tttactaatt tatttatttt tcacttcact    161760
     tttatagaaa ttgtataact gctctataga tggactagat aaaagaggaa ttgccctctc    161820
     aactaattct ctattccaat caaaccaacg catttccatt aacatactaa tttctgtatc    161880
     agtgaaccgt ttttttattt ctttagcggg attaccccca actatagtat atggtggaac    161940
     atctttagaa actacagatc cagctgcaat aattgcacct tcgccaattg taacaccagg    162000
     catgattata gcattcatac caatccaagc atcacttttt atgactgtat cacccttcgg    162060
     ttcaaatgat tgctttattt gctcaacgaa tggataaact gtaacccatt ctgagtggtg    162120
     gttatgatta ccccccatta atatgacaac tccagttgca atacatacat aatttccgat    162180
     tatgagttta tcaagatgcc aacccatttg ttcaattgga ttgaaaagcg ctcgagactt    162240
     aacatctccc cacaaatatc ttacacaact atcttcaaaa ttttgatgtc cataatatcc    162300
     tgaataatag gagtactctc ctacttcaat aagtggattt gttactatat cttttaaata    162360
     ctttgtttca gaccaatgat taaataatgg atgcttcata actatattcc tcgcttctaa    162420
     gtattgtaga tttttgcaat ttacttagaa gcttaatacg acagccacat tttttaattt    162480
     ttttaaacga cgaatcatca ttctaccctt tcctttttat attgagaatt gtttagaatt    162540
     acttccaaga agttaatttt cagtttttag tcttatttca atgctatggt aactaaaaat    162600
     ataaaaagac gctacataga gcgcctataa taaaagtatt ttagtcttaa agcattagag    162660
     taaatgtttt attgtgtgaa aaataagaga acttattgta ctggacctaa taaccccata    162720
     atttcttcag ctttaggatt ttggatgcta tagtaaattt ctaatccctg acgattcccc    162780
     tttaaaacct tccctctcat ttttgataaa tgttgggata ctgtggattg tggaatattt    162840
     aaaatttcag tcatttgggt tacatttagt gttttatgtt tagaaagctc actgatcaat    162900
     tttaaacgca ttgggtgtgc cataactttt aaaagctcta catcctcttc taaaatcgtg    162960
     ttatctacat gatggttcgc aaatctcgtc atagtttttt ctctccctta tttgttttct    163020
     ctaacttagc gtaacttccg tattacataa tattagtatg tttgaatgtt taatattaat    163080
     ttaactacct aaagtataca atttcagttt gtgtatgtag tggagttaat atgtggtttg    163140
     cgtgaagtta tatcttgtaa atttgccatt tgaacacttc acattcatag tcaacaaaaa    163200
     taattagttt ttaatcattt acttttatag agatacgaag atattgtctc gagtatagaa    163260
     ttatgtgtat atcaaatgtt tattcaaaat atgaaaaaaa tatatatcac aagggagata    163320
     aagaaatgta ttttgtaaat gaagaacatg aacggaatta tctcaaacta ttagatgcaa    163380
     gaagcgttga acctagtgat gatcctcaat acgagacatc tttttacata actgcatatc    163440
     cggaaatata caaatgtttt gattggggta cctgtaaggt agaatactct ccattaggtg    163500
     aactaatata ttctcaaggg gataaaaaag gaataaatcc tgacgcactt actggaacaa    163560
     ccctaccact tgctaaagct ggtcaatctt tattcaatgg atataattgg agcattaact    163620
     attggaggaa gtgtattttc ctatactgca ggaggcatta cacctgcttc tgctgaatct    163680
     caatttatac agaaagtatc accggttttt gatgactggc aatggcaaaa ctatttttca    163740
     ctccatcata atgcagactt cttacaagaa ttagcccttg gtgatttgaa gcaaggagat    163800
     acttttgaca ttagaattta tacaggtggt aaagatacag gtattgtaaa gatatatcga    163860
     ttaagtgaag atgagaatga agtagtaaat atgcaaagat ataaaacaat atatgatact    163920
     ggtactaagc ataattatgg tagatttgta acacctatta catcagttta taagccagga    163980
     tcatatgtag ctgttatgaa acttggagaa aattattatt attatggtgg cagctttaaa    164040
     attaaaaaat aatgaatgtt aatttcacta atgataatat ttttgatatg atcaatgtat    164100
     aataaaatta taactcatgt aagagtcaaa gcgttatttg atcaacgatc gctcaggcaa    164160
     tgagttatac cccttggaaa aggtaccttg cagcaggggt accttttctt ttatttttag    164220
     ttataaaata gtttaaatag aaactatgta gttaaaaagt atgatgatta aattgtaatt    164280
     gaagtgaacc atatatccca tatgaatatt tttaaatatt agaaagaaaa tcatttgagc    164340
     gatagctggt ataccgatga tagctaaaca ttgcacccaa ttataattat atgtagaaag    164400
     atggagtagt ccaaatgagc ttccagacaa aattaaagag gttgtaattg aaggaatggg    164460
     acttattatg aaggaacgta tgattttgtg ccaaatgaat aatatagata caaacataat    164520
     gttctcacca aataattgaa ttgcaatacc aggcgtttta aggaacatat tggtcatccc    164580
     ttcattttca atggggttag atgttccatt gaatgttgta agagctatta gtacagacaa    164640
     aaaaacaaca ttataatgta aataatgaaa gcactgaaga aagatgtttt tagctgccgg    164700
     caagtaattt ttttagaaat caaaaatctt tgattccaca ttatgaatag aaaaacatat    164760
     gagataggaa acgaaaaata tactgcttta attatgtatt gcatcagtat atctatttta    164820
     tttatataat taagcgtaaa tgaagggaaa ggtatgtaaa ctgtagcaat acaaagtatg    164880
     attagtatta ggagctgcaa atacgtttta gtttgcacta agcaatctaa gtatgtattt    164940
     gcagcactaa acgcgtttaa agaccgctta gactctctaa aaaatgcgtt cataacaccc    165000
     ctccattttt atattggtaa atacatttga ctaatactct aacactccat tcttccctac    165060
     ttttatgaaa tgtaatctca tgcacatttt ataaaacttc acgtaccgta attattgatt    165120
     atatttaaaa tatagttaac aaagggattt ctattccaaa agaaaaaaag cacctttttg    165180
     gatgctccct ttattatata tatcaactaa ttaatacttc atcatattgg ttatgcgggt    165240
     tatttcaaag tgctcatttt tatctttcag gtagttctaa ttgataaatc aagaactatt    165300
     tcttcattct ctcttcaacc ccactaataa aactaatact caaactaaac aaacaagaaa    165360
     atacaggtaa tcattcattt gctaaccttg aaaaagaatt tgatgctaaa ctcggtattt    165420
     atgcattgga cacgggtacg aatcaaactg tttcttatcg atcagatgat cgttttgcat    165480
     ttgcatctac atccaaatca ttagctgcgg gagctctttt acgtcaaaac tcaatagaag    165540
     ctcttgatta aaggattacg tctactcgtg aagatctttc taattataat ccaatttcag    165600
     aaaagcatgt tgatacagga atgacgttaa aagaacttgc tgatgcttct gttcgatata    165660
     gtgacagtac ggcacataat ttgattctta aacaattagg tggtccctct gagtttgaaa    165720
     aaatattaag agaaattggt gatactgtta ctacttcaga acgatttgaa cctgaattaa    165780
     atgaagtgaa tccaggagaa acacatgata ccagtacacc agaagcgata gctaagacgc    165840
     ttcaatcttt tacattagga actgcacttc cacttgataa acgtgaacta ttaggggtca    165900
     ccatacatga caatcaagtt aagttttcat gatgtcccca aaacaagaat ttcatgaatt    165960
     tttactgttt tggggtgttt cttttcacta gattgatgga catgtactgc tactccaatt    166020
     atgtagcaag tgttttttta tgatttgatt gttttacaat acacgagcgt cgtcttctat    166080
     agtttgtttt ttaaattttt gggtcttatt tttagatttt ttgaaagtta gagccatacc    166140
     aacaaaaatt agagtaatcc ctgatacttg cattaaagtt ggtcggaatc ctgtaagcac    166200
     cgtgtccaat aaaattgcta cagctggatc taaaaaaact aatatcgaga ttaattttgt    166260
     tgataaatca cgtaagctat caaagaataa gtagtatacc aatcctgtat ggataaggcc    166320
     ggttgctata atatacgtcc aattactttg agtcagtcca tggaatgcat caaaatctat    166380
     aaagggtatt agaagaaaaa tccctaaaaa tgtttgcaaa aaggtcattg cataagcact    166440
     catgttctta atacctttcc caaataaagt tgtaaatgca taaaacagag ctgcgagaag    166500
     tccccaaacc atgccagaag acattaacga gtcgaaagag aagtttttgt ttatgccagc    166560
     gattaataac gctcctacaa agcagataat gatagagata acagataata ctgttaattt    166620
     ttctttaaaa acaatacttc caatgataag tacaattatt ggagcaaggt gatagactga    166680
     tattgcaact gtgactgaca tattttcaaa cgctttaaat aaaaataccc aattaaatac    166740
     aaggaaaaat ccacatatca agacttgaat aacttctttt cgttcccatt tatcatgttt    166800
     gtactgtcca gtaattagcc agcatagacc taaaaatatt gtagcaaaaa tgcatcgtac    166860
     aaataccaac tcaaatgaag gtaaatttgt ttgtacggaa aaaaagccga ctgaaccgaa    166920
     aataaccatt gatattatca tcttcaaagc cggtaatgat tttctctcaa tagaattttg    166980
     ttgaatcaat ttaatccccc cgttaaatat ctaattttta gtaagaaaag caccgtcctt    167040
     ctataaaggg caggtgcttt taatttatct acaaaaaaca cttaattata aattcttccc    167100
     agctgtccaa ccaccatcta tgacaaagtt ggaacctgta acaaagcgag cctgatcaga    167160
     aattaaatat tcaatacacg aaacaatatc ctgcggtagt ccccacgtat ctaaggattg    167220
     attgcttttt ataagggata ccaaacgctc atcactaaaa tattcttctg taagctctgt    167280
     cctaatgaca ccgggagaaa tactgttcac tcgtatgttc tgcttaccaa attccatagc    167340
     catctgttta gtaagtccaa ttagagcatg ttttgatgca acataagctg ctctttcagg    167400
     ttcagccatt aatcctgaaa cagatgctat atttactatg caaccttttg ttttagactt    167460
     gtaccaacgc ttagcagctt cccttgaaag aataaatggt gctactaaat taacatctat    167520
     tactttttta aatagatcat cagagagttc taatacaggt gttatttccc tgataccagc    167580
     cgcgtttata agtatgtcgg gacaaagggt atctgtatcc aattgtataa aaagattatt    167640
     aatctcattg ctgttactta aatctatttg tactaactta aaagacgtat gtgtttttgt    167700
     atagtctact aatttatttg tattaatatc aagagctatt acattgaatg atttttctaa    167760
     aaaatattca atacaagcat ttcctatacc actgttggcg cctgagatca taatagtctt    167820
     attttttatc attttggctc cttataagaa aacgttacta ataaaatgtc acgtaaggct    167880
     tctgtattac actctgttcc tagtggtgtt acagcgtgga ataccttttg tccaaatact    167940
     aaagtttcta ggggatcctt caagctaata agcttgttaa tttccctagg gctgtttgca    168000
     atcagattgt ctccgccaag agctgtatta cttaaattca tgagatgtaa aaagacaatc    168060
     ggctcatcat ccttatgtag ccaaattgga gagctaaaag aaggattttc tctagttgcc    168120
     ttatatctta cttgatgtag acctataacc aaatccttac ttgtatcaag tatatttgta    168180
     ttagatgcaa attcactatc aaagcgaaca attttctcaa ttaatgaatt atgtaaaaat    168240
     tcatctgtta tactgttgaa atttctaatt ttcccaccat cgtcataatt atattcttca    168300
     gattggaaat atccattgtc tgtatctaga acataatctg aagaaccagc gtattttata    168360
     tatcttgaat aggctctagc gcgacattcg ccatatgcgt cgttttgtaa gctgtagtag    168420
     tctaactgtg ctttcgttag taatgcttga tcttcttgat cttgtaaaaa aatatcatta    168480
     aagatttgaa tgtatccatt tgattcgaat tcatgtacct tttgttctac gtcaaaactg    168540
     cttgtcttat tagaaactgt tgttagcata agagcacctc aaactttcaa attatatttt    168600
     ccccactgta tattcagcat gaagcatggg ttgaggagta atatgtttaa taaccttaaa    168660
     tataacttgt taaattaata cacaacatta actatccatt aactatttgg ttattaataa    168720
     ctcctattac agtataaacc atattagata atttctgcaa actttttcga attgtatgaa    168780
     attttatttt aattagtttt ttattctgac tcgctaggct ttttctcttt attccccatt    168840
     tttgcttgtc ctctccaaaa tgtcagatgt atcattcaaa taaattcttt tcaaataacg    168900
     tcgattaatc catctgtata aatatatgta tataaagacg agaattgatt ttttaaaaag    168960
     gtaaaatatt accttttatt agtagaatgt tttatctcca tatttttatt attgaaaaaa    169020
     ctaagtgtta aatcaaatgc aaatattcat atcgttattt cttgattata aaatataaag    169080
     aaccaccact gctaaatgga acgctatgca tgaccaccgt catcctagtc cagcgctaat    169140
     ctattagcaa aacattgaac ccttatttcg aataccttct ctttttatct tcttttttca    169200
     acaatctttt gctaatttaa tattcagttg tatgtagtgt tatcaccctt aaatatattt    169260
     ccatgtaatg cctttagcaa tgtcctctac tgtttttggt gatactccaa attcccgggc    169320
     taaaatcgtt gatccaaacg ctgtatctct tgctttataa ttttttctaa ttaacaacgc    169380
     atcgtcttca gtaatctttg tagccccgtt tttctcacct gtagtagcta atccattctt    169440
     aaatgcatga attgtattct cagatgatgt acaccatgga cctttagaaa aaacattttc    169500
     atctgaaatt aattttacat aagcttaact tgaatctaag tacattcact taaccagtgc    169560
     ataggataat tttataaaat tgtgaaggat tgagaaaaat gtactatgct ccttttatgt    169620
     atcgatatca atatccttat tatgttaatg taccaatgta taactatggg agacagtctg    169680
     tttactggac ttctcctaat gagatagagt atgtaaaaag atttgattct tttagttttt    169740
     ccaatggtga tgaaagtatt ttgttaaaag attatggatc agaaccattt gttgttaata    169800
     tcaatgaggc aacaaagcaa aacaatacgt atcgtaaagc tttatggaca ggaacacatt    169860
     tacaggttac cttaatgagt ctcaatgttg gcaaagatat cggtttggaa atacatcctg    169920
     gtgttgatca atttttacgt attgaacaag gtcaggggat tgttcaaatg ggcaagagta    169980
     aagataattt aaatcttaaa agaaacgttt atgctgattt tgcaataatg atacctgccg    170040
     gaacatggca taatctaact aatacaggta atgttccgtt aaagctttac tcgatatatg    170100
     ctcctccaaa tcatccattt ggtaccgttc atgttactaa aacagatgca ttgactgtgg    170160
     aagaaggcta cagtcatggc aataggaata cagttagtta ttaatcaaac tttattataa    170220
     aatctacaac tgtgtattaa agagaaaagg aataaacttt tgctaatctt taagagacaa    170280
     ttgaaaactc ttctttaaat taaaacgagc tgaatgaaca taaataactg tagagagata    170340
     aaaatttcgg tttggggggt aattaaaatg caaaaatacg ttttctttct gtagacttat    170400
     aggaaaggat ggcgcttttt ttacacttgc ttgttcccca aaacgcaaaa aatgcactaa    170460
     attcccataa ataactgttg tattgatatg aaattttcgt tttggggata cttcaaaata    170520
     ttagcttgat gtacattgga cggcacccta atatgcttgg attaaaatca ttgcaaacag    170580
     ctaaaaaagt gattgctgga atagaagtta tgcatatgat caaaaaagga caaactctcc    170640
     aaggtgagaa gtttgtccaa aaccatgatc tctttggttt aataatatat aattcaattc    170700
     cgctaggaat ctttcggtct tttttcatat cccactattt ttgcatgaga actaacaata    170760
     gtgaattaga ataatgactt aatacttgct aggacggtaa ggatacctat aataatgaca    170820
     aatacattgc tcattttccc tctatattta gctagtacag gcactttacg aattgcatac    170880
     attggtaata aacataagat agcagcaact aacggtccgc taagggcatc aatgattcca    170940
     agaatacttg gatttgcata agcaacatac cagcatgtta atacgacaaa agtaaggatc    171000
     attgtcttaa ctgttttttc tcctatatct ttcccgcgtg ttttaccgga cttaataatc    171060
     atgtcacgca ttacttcata tgctcctata taatggccaa ggaaagactt tgtaatagcc    171120
     acaaaagcaa tgataggagc tgcaatcgtg attacaggcg aattaagctc attagcaaga    171180
     tatgatagga ttgacaaatt ctgttctttt gccatcataa gatcatttgg agtcaaactc    171240
     aaggtactgc tccaaacaaa gaacataaca acagcgaatg tcatgatata acaaactttt    171300
     tgtatttgag cacatttggc atcagtagct tctattccat acgtagctct ctgtttcata    171360
     acaaatgacg aaatcatagg agaatgatta aacgagaata ctatgattgg tagtatcatc    171420
     catatcgttc ccaaatatcc tgttcctgtt gaagcagtag aaacacttga aaaactaagc    171480
     attgacgtat tccactgtgg aatcaaagat attgagataa aaagtagaga agctatgaaa    171540
     ggatatacaa gcatgctcat tatctttaca gtgatatctt gaccaaaatt tagtatagcg    171600
     ataagaccga gtactaatac aagcgataaa atggcccttg gaggctcctg catgtgcaat    171660
     tgatgcacga taaaactact tgcagtattt gtaagtgcaa cagaatacat tagcacgatt    171720
     gtataaattg agacgaaata tactatgtta aaaatgatac ttgccttatt tccaaaatac    171780
     tctcttattg tacctgtaat cccctcttca gcagaattgg aagcatatat cattttagca    171840
     agcgccctat gtgagtaata cataactgga tatgcaagta atgtaattag tagtaatgat    171900
     aataaccccc ctgaacctgc attaatcggt aaaaagagta ctcctgctcc aatggctgtt    171960
     ccaaaaaggc tcaatgccca ggtagtatcc tgtttatgcc actttgtagg atctggatat    172020
     ttctcatttt ttactgcagt attttcagcc tgaaattcta ttttttttgc agtattccca    172080
     ttcatataat aattcctcct tgtgtactat tcttccgtct ctttttaagg cttaggaata    172140
     tagaccgttc ttgaaaaatg aattgcttac aaagtgcgcc acatcgtgtg tccttctcta    172200
     agttgatcaa aatcgaaaaa ttcgctagtc atcaacctga tgggtttgtt agctcttaca    172260
     aaacacttta attatatagt agtatatttt agtgataatg gctctcaata tacagacatc    172320
     cttaggagaa caatagagaa taggattgtt aactatttca caatatttcc gataactgtt    172380
     tattaatttg attgtttctc cccaaagatt ttatttttaa tggcaatccc tgtaggtgtg    172440
     gccgcaattc cgcctaaacc tgtctctctt aattcgcgag gcatctgtct tccaactcta    172500
     tacatcgctt caataacttc gtctgcattg atgatattgt ttacgccggc taatgcgatg    172560
     tctgctgctg ccaaagcatt tgccgttcca atggcgtttc tctttacaca aggaatttct    172620
     accaaaccag cgaccggatc acaaactaga ccgagtaaat tttgtaatgc ggttgagaaa    172680
     gcttcagaag attgctgtgg cgttcctccg gcaacttcta ccgctgctgc agccgccatt    172740
     gctgaggcac tgcctacttc agcttgacat cctccgtacg ctcctgaaat acaagcgtta    172800
     tttgcgacta tcgttccaag taacgctgaa gtgaatagaa aatggatcat atcttcatga    172860
     gttaactgca tcgtatcttt aatactatat aggactcccg ggatcgtccc actcgcacct    172920
     gctgttgggg ttgcacaaat agcccctaat gcagcattta cttcattaac accgatagca    172980
     ctttgaatcc ctaacaccat caaatctcca gaaagagttt tcctattttc tcgatagtat    173040
     ttaattttaa cagcatcacc tccggttaaa ccggtcggag aaaatacccc gtcgccctcg    173100
     atacttttat ttatggcatt ttccatagtc gctaaatttc tttccatttt actccaagct    173160
     tcttcataag aagttttagt ttgttcgatt tcctgttcga ttgctaattc ataaattggc    173220
     ttttggcttt tattagctgc atccacaatt tctcttatag tcatatacat attttttcac    173280
     cccttaaagt aactaaagaa taatgacatt agctatattg cttaaatttc ccaattcctt    173340
     ctgaacataa ccaggcaata gcgaatccaa agcgaatgca tataaatatt ttctgttttc    173400
     ttctaaacta tgaaagttgt taatttccac atcatattgt ttaaagaccc tgcgtaagac    173460
     aaattcaaag tcagctcttt cagaaatcgc aataataact ggcaatggcc cctgcagatc    173520
     taagctaaat ccgtcaattt caacatgttt gacttcaatt aatccaccgc cgaccgaaat    173580
     acccatcgtt ctaatacttc ggctttcatc ctctaaatat acatctgccg tattgggatg    173640
     accagcagga ctatcacccg ctttttcaat aaaggtaatg tcaattcctt tagattctgc    173700
     tattttaata gcatctggca ctttgctgtc atcggcagca aatcctaata tcccagcaat    173760
     aattgcaaaa tcagttccgt gtcctttatg ggtttcagca aatgattcat aataccttac    173820
     cacgactttt tttggaagac cttgaaataa tttattggca actgtcccaa tagccaaagc    173880
     acctgcagta tgtgaacttg aaggacctat cattaccggc ccaatcacat caaaacaact    173940
     tttgtattta acaacctttt tttctttaat agatgctaca ttcatgttca tataagcacc    174000
     ccataattta ttatttttaa ttgcagttga atctaagtta ttagaatgac caattcaaaa    174060
     taaaatcgag ttgataacgc tttcattttt cgtgttaata aatttccctt ctgaccacac    174120
     acctttctta gagtaatcgt atcagtatgt ccaattttag aaggttactt gcaaggtctt    174180
     tagaattttt gcaccagaac taggtttgat attttctcta gaggtaatag attatctcta    174240
     gacgccctca ttataacttg tatatttatg agtttaatat ttttttattt ttagaaagat    174300
     tgaataaaca gaatcttgaa tggataataa attacacttg gcatgtagca attgtgtcca    174360
     ttgtttgaag ctgtattagt tagtagaaaa gcaaaaataa cacagagttc ctttcattaa    174420
     cacattgatt atattgaaaa atcattataa agatacttat actttccttt gctgaacatc    174480
     ttattttaga cgtgaaagct gttgcaataa atgattaatg tagatggaaa ggaataaatt    174540
     aatgaaatat aaaatctttt tcggatattc atgatacatt ttgcatctat atacattttc    174600
     agaaaaaagg aacttctttt cggggtagaa ccacatcgct atcaagctaa gattctgaag    174660
     accccccaaa acgaaatttt atctcgctac agttagttac ttataagaat ttagattttt    174720
     ttcgtttgag ataacaataa atttcttaac ttgatggtga tgaagcgaga cttcgtttag    174780
     aaaaagcatc ctatttggat gctttttcta aatgaatata ttactatcta actgctgcta    174840
     ttgatcgtct caaaaaaatc cagtaacttc atcataaaaa atgctcctag atttatctag    174900
     gagcattttt tatgaaacag tattttttat ttgcttatga accactttat tatagcaacc    174960
     atgttttact acttgcctaa catcatctac ttctattccc attatctctg aaatatctac    175020
     aacaattgta ttctgtagaa cactcactac atatcccatt aattgcaaat tagaattttt    175080
     acgatatgaa aattgaacgt aattcccaat ggttaccttt attttatact ccatttggta    175140
     ccctctgaat catttttttc acttaactta gtgtaccatc tccaattgct gcgtaatttt    175200
     tctgtctaac ttttcgggtt cagttcaatg tatagtgacc ccaaatatgc cccaaaaact    175260
     ttatagtaat aattctcatg ttacctctct ggttattagg atattttttc ttactatatg    175320
     catactaaac gtactataaa aggtacatag aaagtgaggg aatcatggct aaatttttga    175380
     agcgtttaaa atatagagac aatcctaagt cattttcaat acgagacaat actcattttc    175440
     agaaaaaaaa tattgaagac tccctcttag gcgctgattt atcgaaaaac atagctgata    175500
     ttcagaatat atttcgtcaa gcacctgatt tagtgattcg ccggtttcaa ataaaagcag    175560
     atggattaga agctggttta gtatatttgt ctggattaac agataaagaa ttgattcaaa    175620
     atcatgttct aagtcctttg atgaatagtg attttgatac caatacggaa cttccaattc    175680
     cattaggaca aatcaaaatt attaatacgt ggagtcagat tgaaaatgct atttttggag    175740
     gagatagtgt tttattaatc cacactcgaa caacagcaca tcaattggat acgaaaggat    175800
     ggccacaaag aaatgttgaa gacgctcata acgaaatagc tctaaaaggt gcgcatcaag    175860
     gatttacaga aattagaagt caaaatatcg caatgattcg aaggtatatt cctcatcgtg    175920
     aattaacggt aaaagaaata gtaattggtg tacgaagcaa aacgaggatt tctattttat    175980
     atttgaaaga tgtagcttct gaagatgtgc tgaaggaatt agaaacacgg attcataata    176040
     ttacagtcga cgctgttgct agtaatgggg aacttataga attcattgaa gataacccgt    176100
     actcaccgtt tccacaattt atattaactg aaagacctga tttggcagta tctcacattc    176160
     tacagggcag atttgtaact gtaatggatc attcgcctaa tgtgttaatt gctccaacaa    176220
     attttatttc cttttttcaa ggagtggatg attacggtac aaggtggtta gttgcttcgt    176280
     ctattcggat gcttcgtttt atctccttta taattgcttt atttttgcct gcgagttatg    176340
     ttgcgtttat ttcctttaat tttgaagtta ttccagtaga gctgtattta tctattgcag    176400
     aatcaagaac gcgcgtaccc ttttctccag ttatggaagc attacttatg gaaataacat    176460
     tggaaacgat gagagaaggg gctttacgga tacctactcc gatcggtcag acagttggag    176520
     ttgtaggtgg tattgtcatt ggacaggcgg ctgttcaggc gggaattgta agcaacatta    176580
     tgattattgt tgttgctatt acagccatct cttcttttgt tatccctaat tatgatatgg    176640
     gagcggcagt aagactttta cgctttccga tgatgctagc agctgcctta tttggaattg    176700
     ttggacttgt tatcgggtgg atgactttaa ttggacatct aatcagtctt gaatcgctag    176760
     gtactcctta cggaacgcca ttagcaccgt ttcgctttgc agatatgaaa gatgcttttt    176820
     tacgctttcc tttatgggca ataagaaggc gtcctaaggg taatggaacc attcaatcta    176880
     ttcgacaagg aaagaatcct aataaaaggt gaaattatga aaaagtatgc ctataatgac    176940
     atcactctta tgcagtatat tgttttaatc aatggaatgc aggtggccac tggcgtttta    177000
     tcacttccgc gcgtgcttgc agaaaacgct ggaacagatg gatggatagc tatattgatt    177060
     ggttggatat tctccacaat atcaggtgtt tttatcgtga aaactgctgc aagatatccc    177120
     gaggacacga tttatgacat tcttatacga ttgtttggaa aaatagtagg gaaagcattc    177180
     gttgttattt acatgatgta cttcgctttt tatacttgta tcgttcttgt aaacgctatg    177240
     ctttttctta agggatggct tcttccgaaa acgcctgact atatcgttat ctttttgttt    177300
     tcgattccta ccttttttgt tgcgcgtaac ggacctcgta ttatagggcg atactccgaa    177360
     ctttttttat atatggcgct ttggattccg ttgttttttt tgataccgct taaagagaac    177420
     ggaagttgga tgcccttctt tccgctatta aaagaaggat ggaaacctgt attaacggcc    177480
     gtaccgacca ctatttttgc ttatttaggg tttgatattg ctttcttttt atatcctttt    177540
     ttacaaaaaa aacagtatgc agtccatgga atggttattg caaacacatt aacgatgtta    177600
     ttttatttat ttactactat tgtttgtttt gcttatttta gccctgatag cattacgcaa    177660
     tataatcaac cggtactaaa tttagtgaaa gtaattgaat ttcgtttttt agaacgtttt    177720
     gacatgattt tattggctgt ttacttaacc attgtttcca catcatggat tcctgcctta    177780
     tactgttctg tattttgttc aagccaatta cttggaaaac aagatcatag ctctcatgta    177840
     gttgttctct tattgctcat tatcggcatc atattttgga ctcatcctag ttggaatgaa    177900
     gccgaaattt ggcaacaggt attttcgaat gctggattag gattaaccta tatattacct    177960
     atcattttat ggctgtactg ctgtctatat gagaagtttc gacaggggag gatacattga    178020
     aaagaaaagt actatgttgt attttattat cggtgttcat gatgactgga tgctttgatc    178080
     aaacaaatgt tgaagatgtt tctcttactc ttgttcttgg tattgattta gatcgtaatg    178140
     ataatttatt agtgtatata tctagccctg ttttcaataa agaagcaaag ataaaagaag    178200
     aaactactgg tgtgaaatct gctacggttc gaaaatctag agaccaattt gatgctacgg    178260
     ttatggcgct taccgcggga agtaaaacac aggttatttt agttggaaaa aggctactga    178320
     aacgaaaaaa ctgggaaaat cacctcgatc cattttaccg agatcccaaa aatacagtta    178380
     ccgcaagggt tgtcgctgta gatggacctg tttcggacgt catcttctat agcccaaaag    178440
     ataagcctcg gcttcctata tatttaacaa aactagttga taccgcttct ttaagaaata    178500
     tcacagtaaa aacaactctt caagaactat atgaacaaag agcagacaaa ggggtaacag    178560
     caaatattac tgaggtgaaa aaaaagaata aaatatgggt gacaggtaca gctttattgg    178620
     atgaaaaagg aaagtataaa ttaacgctaa aatctgatga aaccaaacta ttacgcattt    178680
     tgcaacaaag aactacaggt gagtttccat tcacaattcc aattaagcta aagtcggata    178740
     gccaagataa agattggata agttttactg ccaatggtat taaagtaaag acaaaggcaa    178800
     gatatgataa tcattttata tttaatgtag atgtaaagat gagaatcggt attacagaac    178860
     ggcttttttc gtttaataca aaaaaggacg cagcaaaatt acaaaaagcg attgaaacta    178920
     agctggaagc tgatttcaag caattaatac aaaaaatgca aacttccaaa atcgacccta    178980
     ttgggcttgg aggatatgca agaacttaca catatccaga atggaaaaaa gtccaaaata    179040
     aatggaataa tgaattagca aagggcgatg taaacgtcaa ggttaagatt aaaattggcg    179100
     ggatgggaac gattaagtaa cacgaattca actggaattc gtactaaaat tgcaagtacc    179160
     ttctatttta gaagtggaaa tgtctttaat agggtttacg ccccatcaca atcaagctaa    179220
     gaaaagcaaa taccccaaaa cgagaaaatt ggcatctcca ggtgaaaagg tacaattttt    179280
     tattttgggg tgctataaaa tttttaagtt gatggacatg tatggtgacc ccttttaaag    179340
     aaaaaattca tggaaattat gcgaattttt caataaataa aaataatata ttgtacccct    179400
     tatacttgaa taattttttg aaagtataag atacggatat tgtcttatgt tttctactga    179460
     tttttatcca tatcagtctt ttgtacggat ttatgctcta catcaattaa aattttggtt    179520
     atccaatttc cttctgtttt tccaactcta ttaatattta tgtttatagt taaagaatta    179580
     gggaatcttt ctccttgaag tacttcaaaa actactgttc cttctggttt atcatgaaaa    179640
     gccagtgcag tttcaaaagc ctttcctgtt gcattagtta agtaaaacat acctatatcc    179700
     ggtgcatttg gattaccaat acgatccttt tgatagctgt ctagattatt gttactaaga    179760
     aaacccaatt cacttacagt attaaatttt tcatttttat atgttggcct tgccacttgc    179820
     ttaccctttt ctttaccact ggatacgata tgcaatccat ttgtattaaa ttcatacgga    179880
     attaatgatc catcttgttg ttcaaaacgg tagtaaacaa gtattttatc ctcttggagt    179940
     aacatttctt ttaaatgaag cgtaattcct tgatctgtta ttttttgatc caaaggtata    180000
     gattttcccg ctgctgcata ctttctaact tgatcagtaa tcatgtcatt caattttaat    180060
     tgaggttgcg taaaataaga gttatttagt gccattgtgc tagttggtat aatgatagct    180120
     gctgctacac ctgttattaa taatttcttt ttcaatttat ttttgttctc ccttttgtga    180180
     atttgcgtaa atgattgata tgcacgttct tttacttctt taggaacttc ttgtttcatt    180240
     gcttttttta attcatttga aaatgacatt tgaattatat tcctcctcat ctatttctat    180300
     attagattga ttccgaattt tttctaacgc tctatgaatt ctagatctta ccgtacctat    180360
     agggatttgt aataattccg caatttcttc atacgtataa tcgtgataaa aacgatacac    180420
     tatcacaact ctaaatttga acggcaattc ttgaatcaat gttaacaatt ccttttgtgt    180480
     ttccttttca agtaataatt tttctgggat ttctacaact gactcctgca ttgaatgctg    180540
     tttttcaaat aaacgcatcc tcttccaaac ttgttttcgc cattgactaa tttgtttata    180600
     gacaatgcca ttcaaccaaa ataaaaaagg tctagattga tcatattttg agatggattt    180660
     ccatagttga aaataaacct catttacaat ttcatttgta tcatgaccat ttttaactat    180720
     agcaaatacg gtgtcatata ttctctgatt tgttaaatca aatatatatt caaaagcttc    180780
     ttcgtcacct gataacagac ggtctatcca ggtgcttatg ttgtcattag tggccaaaca    180840
     ggcaccctcc ttaaaattga tttcactata tattggacag taatcaagat aaagttccaa    180900
     gtttgataaa aatatatatt tttttatcat ctcttaagac gtatatagat tacgttaaac    180960
     aattcttgtt tatatttcta ttcttgttgg ggtacggaaa cgattcgagg tatgaggggt    181020
     cactctggaa aagtattcaa taataaaaat cgtaggaaat gataattcct acgatttttt    181080
     gattagaatt ctctaatatt aattgcaaaa tgtggtttga atcttacttc aattgctttt    181140
     ttctcttcag agcactggat atggagtata tcattgcgag tatagactcg ttctacaaat    181200
     tccatattaa cgtcaaatac acatccttca ttataagaaa gacttaattt aattgtattc    181260
     tcataaactg acataatcgt tattaattta aatcctaagt gatccatttt acgataaaga    181320
     tacacacctg caccttcaat caaaaagtct tctggttcac tctcgaatag ctctaatagt    181380
     tcgtattcat catatttaat atccaaggtt tataaccaac cttctgcacc gtaaaaaaat    181440
     ttttattatt ttttctttgc gggaacagcg gtaataacgt ccccgttatc attaagtata    181500
     acataaccat ctgctctact atatttccat gtgccaggcg tatcagctgg agcacgagaa    181560
     cccgttttga taatatcttc aactacatta ggtgtcatac cacgagggtc aattttagaa    181620
     aatagctcgt tatattccgc agaacctagt ttatatccct ttttagcagc catttcctta    181680
     gctcttgaat taagctccgc tcttattcca agggtatctg gagccattct ttctaaaact    181740
     actggggata ctttggtcgt aactagaatg gatcgtatag gtcgaaatac cattcagcta    181800
     ttacagttag tagaacaact tcgggaaaag gatgttcact ttgcgatttt aaatttagga    181860
     atagatacta gaactccaac aggaaaattc tttttaactg tcatggctgc ctttagtgaa    181920
     cttgatcgag aaatgattaa agaaaagcaa cgtgcgggaa taaagttagc gaaacaaaaa    181980
     ggagtgtata gaggaagatt gaagaaatac acggataaac acccaggtat gaatcatgcg    182040
     attgaattac gggagcacac cactaaaaca gtgaaagaaa tatgtcaaat tacaggtgtg    182100
     agtcaggccg ccctgtatcg tagattaaaa gaacttgaat aaagttgttt tttaatttgt    182160
     aattaaatcc ctgagtggcc cctaataccc agaatcgttt ccgtacccct agcacccgta    182220
     agttgaacta ctccgtttta tgtagctaaa aaagatatga aaattcaact ttgttcttta    182280
     attccagtta ttctttttac aatatcatct gttcccccaa cacctccaat gcccatatta    182340
     atcggttctt cctcctctat agctaaaata acaaattttc taaactcttc atttccctta    182400
     ccttcaattt caaccattaa gtcagcaaac cttttatgaa gttcaacttt ttgttctttt    182460
     gataacgcac ctttgaatgt tttaatagtt gcgattggca ttctaaatat cctcctaagt    182520
     ttttataaat aaaatatacc tttcggtata ttttatttat aaaaaagtta ctttttcaga    182580
     gagtatataa tttcttcaat tgtttcaatt gcatttatta aatagctctc tttttttgtt    182640
     gattttgtta aaatcattcc accttcacat aaagttataa tagtttgtac tgttttatgt    182700
     gattctgtgg tttcaataaa ttccccatac aatagtcctt cttcgattat agaaaccaag    182760
     aaattttcca aacgatacaa tgtatctaat gcgagcttta acaatatagg atgtgtatca    182820
     tcagattcta taagagtatt tgcaatcgga caaccaccat tagcaataat atctttaaaa    182880
     atctttctat aaattttcgg aaaaaccaac agtttctcta atgaattttt agctccttgc    182940
     atgttgttat aaatctcgtc tgttatattg ttgacattga ataaaaagca gttcaccgca    183000
     acatcatctt tatctttaaa attaccgtat atactacctt ttgtaagctt cgtcgcattg    183060
     gttatgtccg ataaagatgt tccgtaatac cccttcttat taaatatggg taatgttttt    183120
     tttattatat aggcttttgt tttttcgact ttgtttgtat tcatatataa atatctattt    183180
     cttttaataa ggtttgatta gaaatagagg ataaaccctt gttaattaag ggtttacaca    183240
     aaaattctaa ctttttatca aactttatta aaagctacaa attgaagtga tttttaatag    183300
     attaagtaaa ttatatcatt taagataaaa attaaatgtt ctagtattta acttttttca    183360
     aaacatcgcg actttacttt aaatgaacat ctatctatgc atctaatttt gttttcaaag    183420
     aatatttgcc cataaaaaac tgcacctcta attgttagtt atgtctaaca attagaggtg    183480
     cagttcacta atgaggtgct acttttctat ctatttacac acgtacagcc gtaccgctta    183540
     ccgcaaccat taacattccg tcacgaacca cttcgtagtc tacatcgata ccaacaattg    183600
     catttgctcc tttttgcgtt gcaagttgtt tcatttcttc catcgcaatg tcacgagctt    183660
     cttttaattt actttcataa gcaccagaac ggccacctac aacatcacga acagaagcga    183720
     agatgtcgcg tacgatattt gcacccataa ttgcttcacc gtttacgatg tccacatact    183780
     caataatttc tttaccctga atagtattag ttgttgttac gatcattgct gacacactcc    183840
     tataatctct aaaaatttat tttcgtttct tataatctta ttattcattt atacttgaat    183900
     cgtctttttt tgtatgtaaa atttcccctt aacgtacaac gtttttttgt cgtgtcgagc    183960
     taaatatagc atacatacaa caagggaatg cagcacatat cagcatacaa gcattccctt    184020
     gttattttta tgttattact ttacatttta tgtccccact ggtcaaagtg ataatcttta    184080
     ccgtcgattt taaaccaacc gtctgaataa agtgaaccat cttctctagc acaataccaa    184140
     aggtatccgt atgcaagagg ccaaggtcta tatccaccac caacttggaa ccatcctgtt    184200
     ttagctgctc cattctcatc gaagtaataa tatttattat cgatagtttg ccagcccgtt    184260
     tgtgctacgc cgttattgtc aaaatggtat agtttaccat ctgttttttc aaatcctgcg    184320
     cggttaactg atccgtcttc atgaaaataa tatttttttc cgtcaatgtt tttataatca    184380
     ttgaacgtat cattgaagcc atttgtgaaa tagtatcttt taccgtctat cattttccaa    184440
     ccggtatagg aaggcccatc ctctaaacta taatatgcta ttgtattcgc atttttgttg    184500
     attcctgttt tcaaaatcga accgtcttga ttaaatgcta atgttttgtt gtcaagctta    184560
     acattaacac tgctgtttat agcttctcca tttagcttag aaactctctc aatcacacct    184620
     ttgtcggaaa agtgaagagt gacatcttga tcttttatag gtagttcatt tgtagtagga    184680
     tgataatctt taaaataata aactttaccg tctatatctt tcaagccttc tttaacaaat    184740
     tctcctgaag catcggaata gttattacct ctccagactg atcgttgcag aacaccggag    184800
     tcgttgaagt tatagaactt cccatcaatc agtgaatcac ttccacctcc agtaaccatt    184860
     tggccataag gcgatgagaa ataataagtc ttccccttaa tttcttgcca gcctgtcaaa    184920
     atgactcctt cagcatctgc aaagaaatac tgattctctc gatttaccca gctgttcttt    184980
     atcacgtttc cagaggaatc ttttgcacta tatttagtag ggtccttttc attctttatc    185040
     atctctattt tgtcatactt ctgtctctca ttttctttac ccggatacca ttctattaac    185100
     caattgtgaa tttcattgtt gcttttatca gggaaacgaa tttcagattt gaaactccaa    185160
     tcagtagcga atccatgaat gttttgatta ccagctaaac ttaccccatt tttgttattc    185220
     aaacggaact gaaatttatc atcgtaagaa tttcctatct gaacaagttc aaacacttca    185280
     tcatcgccaa gcgaatcgga atattgaagt ctgtttcctt cttttcctga aaggtatttt    185340
     gaacctgttt ttacgattac tttattcgtt ccttttttat aagggataat ttgataagat    185400
     ttaccatcat ttagtgtagt aaatggtagt gcaatagatg tctctaggac gttagtacgc    185460
     tccgccaata tatcagataa tcgatcataa aaatctgcac gagctttagg ctcattatta    185520
     acataggtgt caagaacatc tttggatact ggctttgaag tcaatgttat caattgtttc    185580
     tgcttatctg ataatttatt tgctatctga tcaaataggt aatccgaatt tctagcaatc    185640
     accgtccaat cgccaaagga gtcgccggaa tattttttgt aaagtggacc aagaaatctt    185700
     gggtttttac cagatgcttt ttctacaaat gcatgttggc cttgatttat cacaactccg    185760
     gtctttcctt cgtctaattg tgcttgtgta atgtaaagaa gatcgtgttc tgagacattt    185820
     gctccattag ggtttagatc tataattgca cctgcttcag taattttaag ctgctgccca    185880
     gattttagtt gatgaatttc aattcttcca tttggatagc gtactttaac tggtttaaga    185940
     aaattcacat caccttgtgt atgatacatg gaaatattaa attccccaga tgtaaaacta    186000
     ggagcctggt aagtttcgtt ttctgcatat acatcaatgt gagtgcctgg gtctggattc    186060
     tctgggttta ttccaagtgc ttcataagtg tttgctacag cccctaatac agtaatagat    186120
     atatctatta ccgtacctat ccctgcacta gccttatttt ctgcaatagg agctactgaa    186180
     aaaagaatac ctaatgccgc tgcagtagga attactttct ttccaattcc aattgtttta    186240
     aattttttct tcatttttgt tgtcctctct aagtaagatt tagcctagat tgcttacatg    186300
     taacactgta aaaaataaac atatatagac tgttgtatgt tcatttataa atataatatc    186360
     aatatttata atttcatctt agtttaaata cctttcaaat ttctttcata aatgttacaa    186420
     aagtctttca ttaatatcgt ataaaattct aaattttacg atattctata ttttttcagc    186480
     ttggccccat gttcattaac cgaagatttt taagtatccc caaaacaaac ttttcatttg    186540
     aaaaatgaat gaagtagtaa acaagaaagg ctagcaaaat gccaaccttt cttgtttctt    186600
     gggtctcaat ttttaattta ataagatata tcggtggttt acttatgctt caatcatttt    186660
     atttctatcg gtatttccaa gtttaagaaa ttacttacaa gagtcttgaa gtgtttgtat    186720
     gagaagcaat gaaagggttt tgtaacattt acgaaagaaa tttgaaagtt atttaaatta    186780
     aaataaactt accgatatta atttaaatat gttggaaaca gtataaatta gaaagtaagg    186840
     agcacatcca tgaagggaaa gataaagaga tgtataaaaa aaatcccccc tgtaggaata    186900
     gcgatgggga ttgtattcag cttgaaccca tttacaaaac ataaagcaaa agcagacgtt    186960
     gatacgttcg caacgattgt tacaacattt ggtgatacct atgattcgtt tttaaaagag    187020
     ccttttgtta tttctttatc agaacaaagt gctaaaaatg attatctagc taacaatgaa    187080
     aaccgtgctt acaaagctcc tacttttaac aaaggagaat ttggtattag tgcgtatgat    187140
     tattataaaa accaaaactt ttctaagaga attaaacttt tctataaaga tgggaaagtt    187200
     gaatataaaa cgataaaaca tggtcaacaa cttctgatta agcaagcagg tatcatagtg    187260
     gacttaaatc ctgatgcctc ggatctatat gaacatgata ttttgtatat tacacaaaaa    187320
     caattagatg aagggaatac cggtattgcg cttacgaatt ggcaaacata ttacttgaaa    187380
     agtgacaata gtggtcaaat gaatggtcct ttagctctaa aatatattag gcaggagttt    187440
     ccaaatataa aaccaggtag tgcttctttt gacctagaga aactttttca tgcactaccg    187500
     gaagaaaagc gaaaactggc aacgataact tcgaatccag taaaaccatc tgaaattttt    187560
     agttatacct ctgatgaact tgctgagata aagagacata aactcgccgt cgttacacaa    187620
     tataaaaatg aagaatgttc ttctatttct atgaaaatta gaaacaggga taacgtcttg    187680
     cgaacatggg aggatagtat gaatatttct gcttcatcta attggatccc agaagatagg    187740
     agcatattta caattattcc aattaaaaaa ggatctaaca aggtgtacat agaagcaaat    187800
     tcaacctatc ttacatctgc aaatggtgag gtgggcgtta caggatttcg cgcttatgga    187860
     caagtatgga cacttgttaa ttatggattt gaaagcttct ctttaaaaaa taaccacgga    187920
     caatatttat ctgttaatga tacatccgta tgtctgactg acaagcctga taaaaacact    187980
     atatttccca ttactattca aaaagaaaaa tggaatgagt ggttagctaa atggtattct    188040
     agcaaataaa atgcaagttg atataacctc tagaagcttt acaaacattt ttaacgagta    188100
     acgaaccaac aagccaattt tctgtacgtt aaggaaatcg gctacacaga tccctaagtt    188160
     atttttaatc aatctttatt tcaaaccaaa aataattcgc ccttacgttg agcatatgta    188220
     ttcaacgtaa gggccctttt aaatttatat tttaattttc ttggttaaga taacgtatat    188280
     atctcggctg aacccctttt tgaggggatg ggcaaaaaca tccaaaaact acttcatgta    188340
     aaatacaagc taatcttacg cttcatctcc acacatatcc ttttccccat actgttcgga    188400
     gaaactgagg tccagaggga ttaggttcta tcttttgacg taagcgcctt atatttacac    188460
     ctattacttt ggttttaact acataattca caccccatat ttcatttaaa agctcatcac    188520
     gtgaaattgg cttgccctga ttttccatta agcaccgtaa aataatatac tctgttgggg    188580
     ttaaatcaat taccactccc tccttatata atctttcttg ctgaagattt aatcgaaatg    188640
     gttccgaatg aatcgattcc atattctctt tgtttccttt tacccttctt agtaatgctt    188700
     gtacacgtgc tgttaattca attgaactaa atggtttttc aatataatca tctgctccaa    188760
     ttgttaaccc ttgtacctta tccctatctt gaacacgtgc cgataacata ataataccga    188820
     tatttttatt gttttctcgt atacttttac atacctgaaa accatctatt ccaggtaaca    188880
     tcacatcaat taatataata tcaacattat gtttacctaa aagttcgaga gctgtttctc    188940
     ctgtatctgc tgctaacgca ttgaaaccag cacgattcat aattaataca ataaaattac    189000
     gaatcgttat tccttcttct actactaaaa tagttgtcat acatcgcttc tcctctcctc    189060
     tactcatgat gatattcagt tataggttta atataaaatt cgggcttttg gtatgtacat    189120
     tgttttggca ctgcatatac atgtaaattt attttgactg tgcttcataa ttttttacct    189180
     ttccatcaaa ggtgtgaact tcaagccact tctcatctgt atcggtataa agaagatact    189240
     gagtactctt ggaaccctct tgaattgtaa tttccccaac taactcttta ggaattgtaa    189300
     taaaatatcc ttgctctata tttacatatc tctcttctga aggccgaaat tcagcatttg    189360
     gatattcttc ctatcctttc ggacgaacag aagtggaaaa ctcaattatt ccatcaccat    189420
     tcaaatcttg actctctaac aaaaattcat tcataagtgg atttgtttca tctgaaatga    189480
     tgacaagtcc acttatgaat gaattaacgt gtctaacttt tttgggtcac ttcaatgccc    189540
     gatcgtcttt tcattatatt tttctttcat gtaattcttt taaaagctgt atcatttcag    189600
     cttgttgttt tatcttctta cgaccatttc gattaatcgc tgcaagttca catgcaattc    189660
     caatggcaaa gaaaaacaat aaactttcta acatataaaa tcctccacat gcattgtcta    189720
     ttagacagct tggcgtaact gttcctcttg taagacctgt ttattcttat tttcttcttt    189780
     acgctaacaa tataaataag ttaagtatta aaagaaatac ttgaagataa ttttatattt    189840
     atgtttgttt gctccatctt gctaaacctc cgaaaaataa attatttaaa cacatacagt    189900
     tgtatcactt acagtaacca ttaccatacc gtcacaatcg aaaattccta gtgatttgga    189960
     tttacattat aaccaaattt gaattattcg atttaatcgt gtattcatcc tctaaaagtt    190020
     atttcatcct ttcaccaaaa ctgtgtcttc taatacgttt ttttttgatc ctatattttc    190080
     tattcttatt aagttgggca atatctttta acaaaaatac aatcgtaatg acaaccattc    190140
     caaaattaaa tataagggat gttataacaa tttcgtcagt ggaaggtaat aagaaggtgg    190200
     atacaaaaaa aataatggta ataaaagaaa tgcattgtct tattggtagg atagaatgcc    190260
     tttttcttgt attatggtat gtcataacgg tgccagtaat taataataaa ggagcagtaa    190320
     gaaagatttc ataacatcta acagcacctt taacaaacca aggtaaaaat cgcatggttg    190380
     aggaacacat acataggttg attactaaag caaataattg tatgagggat aacgttatat    190440
     ttaattttgc ttgtttcatt ttattcaccc cgtcatcatt gttatatatg agtgtgttca    190500
     tgttgctaaa atggaatatt tatcaaaatc actgttccca tctcttcttt acttacaata    190560
     cttaccgtgc cgtcatgtag ttcaacaatc tccttcacaa tggctattcc aatcccggct    190620
     cctgaagagt gagtattaat ttgataaaag ggctgattaa caaatggtaa atattctttt    190680
     ccaattccaa ccccttggtc ttttgtattg ataacagctt gtccttcttt ttgtgttaaa    190740
     ttgacaaaaa cttttccatc tttatgtgaa tacttaatag cattttcaat gacattttaa    190800
     aaaatttgtt ttaatctatt tttatcacca aggacgtcta tttcttctaa actagtaatg    190860
     atttcaatct attttttcct gcctttggtt ttaactgcca aattgtttcg tgaagtatat    190920
     gatgtaatgg caccttttct ctatataaat gaagatgatt taactctaat cttaaaaagt    190980
     ctaacaactc ttctacaaga tgaatgagat gagatgagac gattcgtttc atttatcttg    191040
     tatttgatct tatagcataa aggtgattcc attaggaatc tatagttatt cttgttcttc    191100
     attatatatt tgcaccagag ccttttaaga tactaaagct gataattaat attcttgctt    191160
     ttgctcttta attttaatct tcgcgtcttt atagaatctt agttttcctt cattataatc    191220
     tttagtatat tgattgaact ttgctttttc ttttagtgtt tctttattca atgtattgac    191280
     agctttaact ttctcactaa tctcttttag atttatttct ttatctttta acttttcata    191340
     aagttctttt tcagttatta atgattcttt gcagatttta tccatttttt gaaaaacttc    191400
     ataacgattt ttgtaaactt ctcctacttt tttcgcttgc ttttgtaatt tttcgtcctc    191460
     gattttatct atataactat gaaccgatgt tgtttctttt tgggcttttt ctagtacatc    191520
     tttttcactt ttcaacactt tttcacgttc atctacattt gtaacagcct gttctatttt    191580
     tggtattact gcctcgttat gctcttttcc ttcctgtaca atttgatcgt acaattcctg    191640
     tccttttgtt tctaactgct ctaatttgtt tacattttca aataaagttt tttcttgatt    191700
     tgctgcgttt tcaaaagcaa catataactc ttcctcgggc tgtgatccca aacatcctcc    191760
     aagaaatcca atcgataaaa ttccaattaa cgccactttt ctataagtca atgtcaattc    191820
     ctcctatgtt acatacgttt atcatgcata aagttcaatg ggaaatgatc atcttcatga    191880
     tatgcttcaa attcataccc tttttctttt aaacccttaa taatagcagg tactgcagca    191940
     acggactgcg gatgaatgtc atgcatcaaa ataacttctt ttggatccgt cgcaccagcc    192000
     agtacatttt gaacaatttt cgctttcgca gtatcaattg gtacactatt atattcccaa    192060
     tctaatgaat caattgtcca atcccatact ctaagaccat cttctacagc tttattacga    192120
     agttcttcat gtaatcctgg cattgaacca tatggtggac gtgttagttt tggtgcatgt    192180
     ccaagaatac tagcaattaa actttgatcc tctttcattt catctacata gccagcttga    192240
     gtatacagtt tcttataatc gtgcgtcata ctatgcattc caacataatg cccttccact    192300
     tcttctcgtt ttactaattc aggataagat tttacatttt gaccaattag aaaaaatgtt    192360
     gcttttgcat cattctcctt taatatgtct agtaactgtg ccgtatactt tcctggaccg    192420
     tcatcaaaag taagataagc cacttttctc tcttgaccat taaggcgaac tggtactgct    192480
     ttctttattt cagtttcggg ttgagcgctt actagctgca ctgggttttc ttgcttagct    192540
     acagctgtag ctgatgaagt aatagtttga aacataaagt aaccaattgc aattgcaatt    192600
     gcaacaattg taattacaat gcgctttata ttggtgatat ttctcatgat agaagtcctt    192660
     ccctctcaaa tctttatata ttaatatttt tataaaattt tcgtttattt tattacaacc    192720
     cccaacaaca aatattggga agattccaat gtacccattc ttcacaatag cccatttaac    192780
     ttctgttctt gacgagtaac tattaatttg ataaattagc tggttcacaa atgtcaactg    192840
     ctctttttta atttctggat ctcttataat gagtgctgtt tgtcacatct tttgtattaa    192900
     aactaataat atgtttcttt taacagatgt gatatcgatt ccagttaggt ttttaattga    192960
     agttttttgg taattcaaga agactggata aacagttcat ccaatcttct tgaaagaata    193020
     tggtagtgca atttcttcat ccatagcttc ttaaaatatg cagctatagg tctaattgct    193080
     ttgaacgagt aatgcctgca tttcatagtt tcatcgcttt atccaaaacg agtcacaatc    193140
     ctattgtctg tctctattta tatgaaactc tttataattt caaccctatg ttaacaactg    193200
     tcataacgtc tgtttattcc tttatatgtt tcccaagtta taaataatta caatagatgt    193260
     tatctaataa aatgttagcc aataatatac gataacattc ttatttcttt gtccatcgct    193320
     ttaatatatg aaaaaacaca caaattttat ccttaattag agttttatcc aaaaacttta    193380
     attacttaca attctttttg caaatgcttc ttctatggaa acatacttgt agccaagttc    193440
     ctttgcaacc acttcacatg taatttcacc gttcaacgtg tttactccaa gttttaaagc    193500
     atcgttttca aatattgctg tttgtacacc cttgttagca atttgtagtg cataaggaat    193560
     tgttacattt gttaaagcga tagtggatgt tctaggaact gctcctggca tgttcgcaac    193620
     ggaatagtga agcacttcat atttttcaaa tgtcggatta tcatgtgttg ttacatggtc    193680
     acatgtttcc acagctccac cttggtcaat cgctacatcc acgattacag agccaggctt    193740
     cattctttgt accatttctt cggtgacaag cttaggagct ttagcaccag gaatcaatac    193800
     ggcactaatt aaaagatctg cttgttttac tgcctccgcg atgttgaacg gattagacat    193860
     caatgtcttg atttgagtac cgaaaatgtc atctagttgt cgtagacgat ctgcatttaa    193920
     atcaatgatt gttacgtcgg cgccaaggcc aatggccatt ttcgcagcgt ttgtaccgac    193980
     gatacctccc ccgatgatgg caattttacc acgattcaca ccaggtactc ctgcaagaag    194040
     aataccttga ccaccgtttg acttttgtag aaattgtgct cctatttgta cagacatgcg    194100
     tccagctacc tcactcattg gtgtaagaag agggcgggta tggtttactt ctactgtttc    194160
     atatgcgatg gcggtaactc ttttatcttt aagggcctga gctaaattag attcggcagc    194220
     taaatgtaag tatgtgaata aaattaaatt tggacgaaag tgaatatatt cactttcgag    194280
     aggctctttt actttcataa tcatttctga ctgattccat acttctgcag cactttcaac    194340
     aatttcagca ccagcatata catagtctac atttctaaag ccactaccaa cacctgcatt    194400
     tgtttcaact aataccttat ggccagctgt cacaaatgga ataactcctg caggtgtaag    194460
     tgcgacacga ttttcattat tttttatttc ctttggtaca ccaataatca taaaattccc    194520
     tcccattact taatctttga gctaccatat tttaagtata gagtattgaa aatgtctttt    194580
     cattgttgag aaaaaacaaa aaaacagcat ccttttgtgg aattccacaa aaggatgctg    194640
     ttacataaat tttttcagct tgagatccaa gtacagaatc attttttgat ttggatcttt    194700
     taaatcaatc tcactaattt cataaatacg cttaagtcta tagctaagtg tattagcatg    194760
     aatattcaat gccttggcta cctcgccaac attgctatct ttatttaagt agacttccaa    194820
     cgtttcaata agattgcaat tatgcttatg gtcatattca tctagctttt gcaacgcctg    194880
     attttcatac tcttcatctt ttctttgctc aagtagaaga tcgatcaatt gataaatccc    194940
     taagttttgg tagctgtgaa tattagttgt gtcagaaggg aatttttctt ttatggataa    195000
     aaccgttagc gtttctttgt aagctttact gattttttgg taatcactat atacgctgct    195060
     aaatgccggc ttgatagatt tgatgccata tcgcttttcc atattgtgta caaacatttc    195120
     gatgaaattg ttgatttcat gaaaagggcg cttcacatta tccaatgaag taagaagaat    195180
     caattgatta cgatcaattg tataaagtaa aactttcaag tgttgacttg tttttaacaa    195240
     ataagaaatt tgtttttctt tttcattcgt aattccttgc tcaaaacgga atacagagac    195300
     agtaaataag gatgctggag ttatttggag caggtagaaa ttttccataa tttctgtgtt    195360
     tacctgcata tgattagtta gcagtttcca aaaaaactct tgtgatcgct cttctttttg    195420
     gttttttcgg gcttgaagtt gcaacagctt actttttacg acctccgcgt atttttttag    195480
     caagagacaa tcttgttcag ttaaagattt ttcaatttct aaagcccaaa tgaatcctaa    195540
     aacgtcttct ttgttccaaa tagatatcgc gactctatcg ccgagaccaa tatcatctct    195600
     tttttttaca cgaataggct cccgattttt taataaatcg ggaataattc cttctttcca    195660
     caggttattg attacttttt caggtacgcg acgccccata atagtaccaa ttctcgctgg    195720
     gtctgtcctt tcatcatggg tactatatgc gagaagacga tgatttacat cctcaatagt    195780
     aatcggacat tgcaaaatct cactaactat atcagcaaat tcatccaaac tatcgaaggt    195840
     aactctaaaa gaatcatttt tcatatatgt caaggtgcct ccatcctaag ttaatataaa    195900
     ttttcgtact cactgtaaga aaattatccc tcgtataaat taacaaaatg ataaaataaa    195960
     taaccggctc cttaacgcat aggaaactgg ttacagcaac gctggtactg gtccctacat    196020
     tgaagtatcc tacatcaaaa attaaacaac tatactttaa ccccgttcta aatttaaaac    196080
     ggggttaaag tatttgaagt tttaaaatta aataacttta ttttcacttt acagcttgat    196140
     aatagctact tacctcatgt ttataatctt tccatcctgc taaatttgga catcattaga    196200
     aatagattgt aaatactgta gcatattttg tttctcctgt ccttgggtag gagtgatttg    196260
     attattacga atgatgtacg gattaaatga catttgttca ttttcccctt taaatttcat    196320
     tgttaacact cctgtttctg cactatgatt tttcacataa tcaggaaaca agaaattccc    196380
     tagagaatat gcaacaggaa ccttattata atattcgaat ccctgcaacc aatgtaagga    196440
     agacctatct tttctacatg agaaatcgta tccattaaac taccttgcca gtaatctttt    196500
     gtacgtttag acacaaatta cctttttgct gtacgctaag agacatttgt tcagaaaatc    196560
     ttatgtttat aaacagagga taaaaactca ataatttcaa ccttttctag ctataatcat    196620
     gttcataaag cgtgtaaata attcaatgtt ccgttgatcg gctgttttaa tctttctgaa    196680
     catataatcc ttctctaaga acgctgttat agtaagaatt tatagtcctt agcgtacaat    196740
     tttccaagaa tgatatagtg atccctatta atcacactga aaaatgacgc agaatatata    196800
     ttctacgtca tttcatgtaa gcacttcaaa ggataagggg accttatact cacattaaaa    196860
     caccaagctt ttgaaaagta aatcgctgag tttcatctgt aaccttttgt aaccttaata    196920
     tatggggagc acccatgctc atcaagttaa gattttgaag tacctttaaa caaaaaaatt    196980
     cacttctcta cagttagtta attataagag tttatctcat ttttttcgtt ttggagaaca    197040
     aagaatttct taagttgatg gcgatgtggc gataccccta aggataatat agctaacgga    197100
     ttgtcgacta gatacctagc aaaagctatg cataatcaaa aattaaattt agcgaaaaag    197160
     gaataaagat gtaaagaaac tttaaaccac ttaatctgtc tttctcttat gtaaatatgg    197220
     taataatgaa attcccccaa ggatagctaa acaagctcca atccatagcg gagatacaaa    197280
     accatatcct ttactgattc caagaccacc tagtgaggaa ccaataacaa tacctagcgt    197340
     aataaaagaa ctatgaacgg tatttatcat tgttccatta ctagctgttt tcattactct    197400
     cgcaaccata gccggattca atgctacacc agttaaacca ataaaaatcg tagaaataac    197460
     cgcaatgtat ttattctctg cacctaaagc aaatgaagac aacgctacga ttaatataat    197520
     taatccaccc ataagtattt tcattgtaaa tttatcagcg aacttgccaa ttattatatt    197580
     cccaattacc gtcgcactac catagagagc aagtaaatat ggaatacttg cgcttgaaaa    197640
     gcctgtaaca tttgtaaaga taggagtgaa ataactaaat gctgcaaacg taccaccaat    197700
     aatgaacata cttgtcacgt acgctgccca aagatgaata ttcttaaatc gcagaagttc    197760
     gtctttccaa tttaattgct ctttatttga agatgatggt aacaaccatt ggatcataat    197820
     tcctgatact agaacaagaa cagaaacagc cccaaagcta atacgccagc caaaatattg    197880
     tgaaataacg gttgttatag gtaaacctaa tacagttgcg aacattaaac ctgcaagtac    197940
     aattgatgct gctttacccc ttgaatcaga gtgaaccaat gttgcagaaa aggaaatcgc    198000
     aactccaaaa gctgaagctg aagcaatacc agttataata cgtgaaatca tcataatatc    198060
     atagttccaa gcaatagctc cgagcgattg accaattaaa aatacaaaca ttaaaaacaa    198120
     taatgcttgt ttgctgcgca ttcgtaagag aattgcagtt aaaatggggc ctcctaccac    198180
     cattgctcct gcataagctg taattaaata cccaatagat gatacagaca cctggaatgc    198240
     aagagcaagt tcgttcatca tacccgcaac cataaattct gatgtagtca tacaaaagat    198300
     tgctaaagct aataaataaa taatcgatgg cataaaaaca ctccttatcc attattgtaa    198360
     tgattggtac aaaaatagtg cgaaaaaaga gcgctctaag cgccaaaaat agactccatt    198420
     gttcctttga taacctgttc agctaacatc cgattttgca tcgatacatt aagaacacgg    198480
     aatccgtaat aactgcttaa aagcagacta gctaattcct cagctgattg cttctttgaa    198540
     atttcacctg tttgcaatcc ttcctccatc actgtttcaa tagcttgttt aagaagctca    198600
     acatgctttg agaaaatttc ttgtaccatt aaatcgtttt tagcacgttc tacactggca    198660
     ttaatcaata aacatccttt ttgatcaatg ttctccaagt cttctttcaa tgcccattca    198720
     aaaaaattac ttaatcgttc tttaactgga attggcgtat ctaacaattt cttttgttcc    198780
     ctaatcccaa tttcatggta gcgttctaat acttgtttat acagttcatg tttactaccg    198840
     aaagtattgt ataaacttcc ttttccaagt cctgtatcac tgcataaatc ttgtgtagaa    198900
     cacccctcat atcctcttat ccaaaatgtt ttcattgcaa catctacaat tgaggaataa    198960
     tcaaactctc ggggtctgcc gcgtttattc aatcgtatcc tcctctcatt ttaaagatag    199020
     cattaatagc atactctttt ttgtaccgta cggtcaataa agttgtttta ttgttacttt    199080
     aaaataaaat ttgataattt tagattacga atttattcaa atacaagtct tatttgaatt    199140
     aacaatttta tcaaccttta ttattaatta tcaaactttg ttataaatga tcaatctatt    199200
     ttacaaagct acacttgtat gaaaatttta aattaaacat gcgtcatcta atatgaatct    199260
     tcggttataa cgcaacacaa cttacagaac aaggggagac agtgaatgta gtagaaagat    199320
     tttcttttta tctggaacag gaaagaaaaa gcataaatac aattaaggga tacacattag    199380
     atattaagca gtatataagg tggtttaaag aatcctatat ttcctaatga agaatcggta    199440
     gaaagattcc ttgtttcaca atacgaaaca tacaattagc gtttcacaac tcgttgtcac    199500
     ttaggtttcg atcaagctcc atcagaacta acagctatgt ttgaagataa aaaataaaga    199560
     accctctcct ctgcaagaaa aggaattctt tatttacaca aaaatattga cggtacctga    199620
     agtagtacat ctctataaaa gaaacataca accttaccaa caaatacaag gttgtatgtt    199680
     cttaatatta tttacatgta ttcaggagca atcctgtcct ttttgtacag tcccttcaat    199740
     tggttgtcct atttgtacaa tcggtccgtt ttgtatgacc ttagcacctt catataattt    199800
     atctgcataa cttttaaggt cctgccagct atccttcgct atcttcagat ctatttttaa    199860
     tagagcaatc ctgtctggat taattttgtc aacatttttg agcaatgagt tatattttga    199920
     tcctattgta tgccactgat tcgatatatt ttgtagcgca tcaatagctg tatcaattgt    199980
     tgcagtcata tgttccgttt tatttttggc atctgtcaaa ataactaatt ctgcctctgc    200040
     tccagaaatt ctggacttca attgttctat ttcttgctgt gcagatgcga tattcttgtc    200100
     agcagtgaca atcaatggta taccaactgg gggcataaat acagataaag ctatatagcc    200160
     accacgttta tcatagtttt ctttaattgt attattataa ttattgattt gttgttgtag    200220
     aagtggaata ccggcgttcg tactttctaa aatagagatc aattgatttg aatcagcttt    200280
     aaaacttctt gtatcttcgg ccattttatt tcggaatgtt ttcaactttt ctagtagtcc    200340
     atccacttct tgactatctt tcaaaatatt attatataat ttctccagtt catttttaaa    200400
     tgtcactgta tctttttgat ccaaagcagc tagtaattga ttataactcg cttgaaaggt    200460
     atcattataa cttacaatat tctgattcgt tttcatcata tggggcttta gatcatcaaa    200520
     ccaatatatt gcattcgttt gcgcatcatt ttgatgctga atcatgtttg cttgtaaatc    200580
     accatttata gaacttattt tacttaaatc tgtcagttgt tgattaatga ttgttaaagc    200640
     atatgaatca attgtaagga tacttgcacc cattttctcc attacttctt tatatttatc    200700
     aggaccaaga gaatagctct tactatcttc ttgctgttgg gacacactat tttgcacagt    200760
     ttgttctgct gcaaaagtat gaagtgggat tacattactc gctgctattc cagtaatgat    200820
     cgttgataat ataactttct tatacaattt tttattcacc tttttcacct attctctcaa    200880
     atatatcacg tattttatta aatccataag cttctattct ttacttcaaa tgaattacga    200940
     ttattgcaaa taaaataaca tattaaaata gaggttttca tactttctta ttttataatc    201000
     tttatcaagt ttcataacta tataggaaat ctcctgctca aacttgaaca ggagactcat    201060
     attatgtgtt cttcaaaagg gaaagtcagt atattatatt tttcattact tcggaaattt    201120
     cttgaagtaa tactattttt tctcttctac gaatttaatc tcattatttt gaatgttttc    201180
     agcatacttg ttaacctgtt cccagctacg tttagctata ttcagatctg cttttaataa    201240
     agtaagcttg tctgggttaa ttctgtcaac attgtcattc aatgatttat attttgcccc    201300
     cattgtctgc cactgattct ttacattttc aagagcagta atagctgcat caattgttgc    201360
     tgttaaatta ttagtattat ttttcaagag cgttaactta cctacctgtt gttgcgcagt    201420
     tgaaatgttt tttgataggt ttataatctc atcttgtgct gtctttatct gctgctgcga    201480
     tgtagtaact ccgtatatcc cgccgcctaa tgcacctgca ccaataggcg caaagataat    201540
     tgtagcagtt aagtatgcac cgagagcagt tgcaaccgac gatgcaatat aaactttatt    201600
     attctcatca attaatgttt gatttgcttc gatttgtttc tgcatcaatg gaattccagc    201660
     gtcttgacca gataaaatat ctgtgatttt gttagtatca gtttttaaat tttgtgtatc    201720
     cagttctaat ttgccgcgaa agactttcaa atcttgcact aacctgtcca ctgcaccttt    201780
     attttctgaa atactttcat ctaaacttgt aagcacagct tttagcgttt ctttgtcatt    201840
     attatttgca gcttctacca aaacatcata ataattttga aattgtgtat tataattgat    201900
     aatattttga ttcgtctgga ttatttgcgg tttcaaacca tctaaccatt gttttgcatt    201960
     tgttttagaa gcatcgtggt tgtccttaat gcttttttgt aaatcattgt taattacagt    202020
     taaaccatca aaattaacat ttgcttgttt aacaatagtt aaagcataca ggtccattac    202080
     caacatattg gatccagttt tctctagcgc atctttaagc ccttctggtc caagtgaata    202140
     ctcagggtag ttattttctg catctgcata aataggtgct ggttttgttg tattttccgc    202200
     tgccgaggca tatgatggcg taatgctacc cgctgcgatt gttgcaatta atgtagataa    202260
     agccattact ttataaggtt ttttcataat atttatatct ccttatatta tattattaag    202320
     attcttttct tcattctact attttgcctc tgttactttt atgtttgtaa cactattttc    202380
     atattccgtt gtttgtttat tcaattcatc cgtaaacgtt ttgagttctt ttaattgtgc    202440
     ttgtaatgca ttagaatcta ttttcgcatc agtactaaga cttctcttca tttgaatcat    202500
     tgtgtcatta aagatgtccc aactacttac tagcttgtca aaactctcaa tttgcttttt    202560
     aactactctt gtaaagttat ttaactgcag atcaataagt gtcatttgag ttgcttgcac    202620
     ttcaattttt gataattttt gtagcaatag aattttttgt tgttgcttct gacgagcatc    202680
     attattcagt tttgttactt catcattttg gacttgtcca acttggttat aaatcacttc    202740
     caagttagac gtgtctaaag tatgatcctt acctgcgtct atccaaatat caataaccga    202800
     ctttccaata tttatagaac cttttacatt ttcttttggt agagctagaa gttttgtata    202860
     atcatcttga atgttttcct caagttgtct aatttccgtt cttgattttt caatttctcc    202920
     gcctgaactc ttataacctt caatcgctct gctaacttta ctagaaaaac tcttactatc    202980
     ttcaaccaat tcatttttaa aattgtttaa gtctactgaa tctcctttca tatcatactg    203040
     aattgcttgc atttgatctt gaagtgcatt aaaagtactt acaaattctt cttttgcttg    203100
     cgaatcgtca ttcatttttt cagctagttc aaccaatata tcataataat ttgtaaatct    203160
     tgtcccaaaa tcctgcatgt cttgatttac attgaatagt tttggattat atgtatccag    203220
     ccagtcttga acatggtttc ttgcagtacc ttgatcagtt gttattccag gtatagcagt    203280
     tacttcaagg ttcggttgct ttaatatgat tagcccatat ccttgaatta atggcgtctg    203340
     tgatcctaat gtcttaatcg aatctgataa tctattcata gcaacttgat tttgactact    203400
     tgttagttgt gaataagttg ttttactttc tgcaaaagta tttacaggta agaagcaact    203460
     tgtagatact gctgtaacta ataaccctgc gactaacgtt tttttcatgg taattcctcc    203520
     tattaattgg tgtttgtcgg taagattcct acaggattag aaaaatgata ttatactgta    203580
     cattgcttat acttttattg cgaaataaaa tcacttttgc tatgtagaaa cttaaaacac    203640
     tttttttaca aatgtgataa tttttgagag tctaaaccct ttgcgattca ctgaatatta    203700
     agatttttaa tctcaacata atgttacttg caactttact acactcctat ttagtgtaat    203760
     ttgctccttt cttagtggtc gtaccagtta tgctatttat taaaacatta aatttccgat    203820
     gcgtatatag taaaattttg tcgtaaatag tagaatttta tcttatgtat tcgataattt    203880
     tattgttaca tacttaatat gattgagagg atattatact acaataaaat taatgatgaa    203940
     ttctattgta gtaattataa tgattataac ttaatatatc taattaaaaa taactatatt    204000
     aatttagagg ggagtagtgt ttattttaga aaaataatta tagaataatt taatggtatt    204060
     acttatactt ttttaccgtt atttaggtat gcataattgc ataaaatgta gatatatcaa    204120
     gtaatttatg ttatatcatt aagttttatg gaataattcc caatattact attagcaaat    204180
     acttaattta tcacgctctt taatttacca tattattcaa aaaatcttta tatggtcata    204240
     aaagacccct gaaatacaat tcattccaac cacctcaata cttaacatga agataataaa    204300
     atggattctt atcgatccgt tataacaaga agttttgaaa catgaaaagg ccgcaaagct    204360
     ttcttgaaaa gcgctttgca gccttctggt ttcttgtttt gcttagaaaa aaatcaattg    204420
     tgttcccttt cgaatcaaaa ccacgatata aagatattca ttcccctttt actttgatat    204480
     atatttcatg gactcttcaa gagccattgg tttgaggtga aatcagattc atttgtccaa    204540
     ttcagaatca tactgatgat ctcaacgcat attcgttgta tgagaaatgg gtaaaccctg    204600
     tttctccatc attctcccaa atcacgacaa ctgatgtcgt accgttaaca aaataatatc    204660
     aggctgataa tgtatctatt tgaatacata ttccttttcc agatcaatca cgtacccttt    204720
     ctagagtact aggatcattc tgtccaagtt ttagagatta cttacacgta tagtaaagtt    204780
     tttgcaccag aaacagatac caagcttata ttacagtata tttttcacga tactgtctag    204840
     gagtcatgtt agttgatttt ttgaaaaccc ttgtaaaata actttggtcg ttaaaattaa    204900
     gccaagcaca aatatctgat aatggatatg tagtgagtgt taataatttt tttgcttctt    204960
     ccactcgtac cctttgaata taatcactta aaggaatccc cacttctttt ttaaataatt    205020
     tagataaata agtaggggta atatccaaat gattagcgag ttcattgagg gatattccat    205080
     cgtaaacatt tttattaata tgattcatac atgtagtaac agcatttgaa aatttttgtg    205140
     cattgaattc tttcacccga tctgcaaaag tacgtaaagc gtctcctgac aatcgcctta    205200
     cagagtccac attatctagt tgttccatgg tttggatata caaaatacta agagcaaaag    205260
     caatgtctgg tgggaggtta ccttctatcg catatcgagt agctaaagta atcgcaataa    205320
     tcccatgatt tttttggttt ctgagtggat ccgctgttaa aattaattca acatcttctt    205380
     gcgaaactgc atacatatat tgcaataact tctttttatc tccttctttg attgctgaaa    205440
     aataattatg tactaatgcc atgttgtggg ttttaggttt attttgttgg cgttttaaaa    205500
     tatatagatc aggtttcaca attttatagg gaacttcctc tagcacttta tttttttcta    205560
     aaacaatatc tacatctaac ttttcattga aaatcatgta atgtaataaa actcccatat    205620
     caattaaagt agtttttttt atctcaggta ggcactgata ataggctagt ctttcttgaa    205680
     tattattatt taagttaaat tctttccgaa gtttaaaggt tatatcatct gagccctttg    205740
     gatgtatagt gggaccgatt ataatagtcc cttttatata atcatgattt gctatatgaa    205800
     ttaggacgaa attttcaaga taactgttac atctgaaaag tggcaagtta ttgggatcat    205860
     tttcttgata aatgtcacta agatgttcat ctttagagga ataaaaagga ctacaaacat    205920
     catcagaagt agaatgatat aagatttttt tgtctgtaga taaaatgtga acaggtacat    205980
     taaaggcttt atgtgcgaga tcacacaagt gttgtatatc gatggaatta ttcattaaat    206040
     tctcctttta attagattaa atgataaatt ttcatattat ccctttgtag attcataaat    206100
     tattttccgt caggtataac tcacgacaaa taatactata aaatatcaaa atagtacaat    206160
     tcacgacaaa atattactat atttttttta tgaaaatcat atattattta tttgtaatta    206220
     acatataaat atcgaagcag atagaaaaaa ggtgaaagac actttatctg tgtggaaaga    206280
     aatagatctt tttcttgtaa ttttctaaac gacactgaaa tgagcgaagg tagtttcttg    206340
     attctacaag atccaattat agaatacgag aaaacagtga agaacctaca aaatacaaat    206400
     gcagagtggc atacagtcgt attctatgcg agggccaagc tggaaaagag attcaaaata    206460
     cagcgagagt cacaggagat actgtaccac tgcaagaacc aacagccaaa atttcaattc    206520
     aatcacttga acaaaataag attgaaaaag cggatgctgc tgattcaaat gtaaaaatgc    206580
     tgtgttccaa atttcagaaa aagatggtaa agaggttgag aaattaacat cagatgaaaa    206640
     tggtaaggct acttctgaac cactatgatt cggaaaatac acagtggaag aaattcaagc    206700
     accaaatgga tatgtgttaa ttagagatcc atttgaggta gaggtcttaa catcattaca    206760
     aaacataaaa gtagaaaaca caaaaaaacg aatggaatat tcaaaatact gtcggtatag    206820
     tgccaactat ttttatctaa ttggcactat attaatggtc gcaacattag ttttattttt    206880
     ccgcaaaaga ggaagaaatg aatagatttc aaaatttata gaaatagcaa aggagacaag    206940
     acatatttaa aagattttta atatgttgtt aatctttgta ttaacagtct ctatgctagc    207000
     tagctttatt accgcatcgc ataacatatt attaattttc tgagtacaat gattgttaat    207060
     taacaaaaaa cagcacctct aattaagagg tgctgcaata taaagccaaa gtaaaagtag    207120
     acattagaca cttagtgcac agtaaattga cctcaaaaca gtagttactg caatacctgg    207180
     atttgtttat tctataacaa aagaaatgtc acctaggaat tattgcttta aatccatttt    207240
     gtattaggca ttctttgtat gccactttat ttttgtaaat atacgaacat ttaaattttc    207300
     aacttcattt tttattaata atcaaattac ctataaatga aattgtatta tataaaattg    207360
     gcttatgtat aatgcactta aaattatgaa cgaaaacaat taaacgttta accatcctct    207420
     tatttctcgt atgggattta ttttcaatca atatctatgg tattacctta accaatcaaa    207480
     aagattataa aggaatctga gaggtcaatt tttggattca tgatcatttt tttgaattta    207540
     atgtaaataa aaggtaaaaa taacccgttt ttatgtaata tttttttatt acctctttaa    207600
     cttagtataa tctatattga ccagataatt gttcttcagc cattcgaatt aagtgttttg    207660
     taatttctcc acctagagaa ttattttcac gtgctgatat ctaagccaag tgtcccccta    207720
     attcactaac catctctaaa cttatctact caaatacatt taattacagg tgaaatttaa    207780
     atatcattgc attatcatca gccatcagcc tatttattta tttttagcac gaataaaacc    207840
     ttatttaatt atgtaaattc acactaacag atctgcaaat gaggtaccca cattattctt    207900
     tcgtttcatg tgcttttcta aataaatctt tgtcgtttga atgttttcat gccccagcgt    207960
     ttgcattaaa tgatacaaat cagcatttcc ttgttcaact gccatgattg caaatgcatg    208020
     acggaatgta tgcgccgtta ctggattctc acgatactgc agaaactcta aatttgtctt    208080
     ttttatcata tctgttacct gattcgataa cgtttttgaa ttataaaagt tccctctttg    208140
     atttacaaat aaaggacttt catctcctcg atccaataca gtttggaacc ctcttcttcg    208200
     tctcatttca caaatacact gatacaaatg ttccgaaatg aaaagttcac gcactttatc    208260
     ccctttgcct gtgactttta accagtactt tccgtcatag tgtaaatctt tgactcttgt    208320
     tgtgcataat tcttgaattc ttgcaccggt acttgccaga gctagtaaaa tggtatagtt    208380
     tactaaatgt cctctttctt tataaaaccc taagattttc ataacttcat cataagatag    208440
     gtcccgattt ggccgatcct gttcatttac atttgcgcgc tgcagttctt catgaagggg    208500
     tttttcgata taagcaaata catgaaggtg ttttaaaaaa gaacgaatga gcactgtttt    208560
     cttggcaagt gttgcaactg catatgtgtc cccattccta ccgttctcta cttgtttcaa    208620
     ccaggagtta tatttacgaa tatgccaagg ttgtaatgtt tttaataaag aagtattttg    208680
     ctgtacctct tctccattca attcgaattc ttctgcatgc tgcaccatac actgacaaaa    208740
     tgataagatt tcagaaacat aactcttttt cgtatcctct tttctattct tattctcatc    208800
     catatctttt tgtaaatgta tgaaatgata aatgacttcc agatcactta aatacgtata    208860
     tttactcttt ccctcttttt ctgcaacctc catcttctct tctactttat ctacataacg    208920
     attattatgc aggaatggaa ccatatctct tatgttttct acatatgtat ctatattttc    208980
     actttgatta tttattataa gtaagttctc tttttcattt tgtttatcca tatttcgaat    209040
     tcacctctac taatgaagat tatgaatata attctcttta ttacccttac ttatcatttt    209100
     attttacttt tattaattat acaaatgata attcatattc tttctgtaag aatactatat    209160
     tcttctccat taaactatac ttatattttt ttataaatta ttagtaaata gatatcgttt    209220
     aacgattaac tactttatat taaaattgct tttataatta aattaactat aaaaacccat    209280
     taaaatataa aataaactac aaatattttt aaactataaa aatgtataag aactttaata    209340
     aattctattt cttattttaa atttaactca tattctgata tgatatatac atatctaaaa    209400
     tactagcaaa caatagttat ggaggtgtcc ttacatgaca caagatttat tgttcattac    209460
     aaaacctact gtaacgacaa aagaggcagc cggcttatta ggagtaacgg tacaaacaat    209520
     tttacaaaaa gaaaaagatg gattaataga atgtgtatat aaagataatt ggaagcaatt    209580
     cggtagtaag attttctatt tagaggatat tgaacgtata aaaaatattg aagaggttga    209640
     gggttatagc acaaaagaag cagctgaaat tctcaatgta gcaacatcta cagtttttac    209700
     atatatcaaa tctggtaaat tacctgcttc aaagattgaa aaacgtggaa aagaagtata    209760
     tatcattgat aaagatgacc ttgaaacttt tcaacttact tatgaaaaaa ctacatcaaa    209820
     agagcgaaaa acattcatta ctaagattca agaagaagat atatatttat atcaattatt    209880
     aacacatcaa cataccggaa aaacagctag agtaatagag atcaatggag cagacggcaa    209940
     gattcttaca gaagacgaag aaattttccc tctatccact tataaggaac atgattactc    210000
     ctttgaacct ttccataaac aagctgtaat tacaaaacga gggtatttat ctttttcatt    210060
     aaaaaaacct cagctattta attccatcat ttataatcta ataaatttat tttataaaga    210120
     gctaggtgtc acaaatatgc gcttgagtat ttcatctgat actattaaat tagaaattaa    210180
     acctttcgta ttacaagttg atccattgca atttcaagaa gagattaaat acttacattc    210240
     tcatatgaaa tccggcacga tacttccaca tgtagaaggg atttatttta aaagtaatgt    210300
     agagccatta acttttcatg cggatcatga atttaaacaa aaagtagttc aaatggccgc    210360
     ggatgctggt atgggacagg aagaattctt attgcaagct gtaaaatttt atataacaaa    210420
     tttagaaaaa gcgtagaatt taattttcta cgctttttta aatcgctcaa tttatacttg    210480
     attctcttct aagcattaat tatctatata aggaaattta gatgttctat ctttaaagca    210540
     ctacagtgtg cacaaatggg ttctagtgcg aaaacttcaa gataattgca agtaatctct    210600
     aaaacttgga catactgata ctattactct aattgagggt atttcttttt attagcttga    210660
     tagcgatggg gcggtacccc tacaagtaaa aaaccaaaat atcttagtcc tccatttact    210720
     attatataag tacgattgaa tatattgatt tttttctata taattactgg tatccattat    210780
     atagaaaaaa ttaacgcatt agtttttttt caattatcac ctcataaatt aaataagtaa    210840
     tcttaaggag gagtaaaaat gaattcatac tcaaataagc aaaaaacagt atcccttata    210900
     atagcctcat ttatcttttc cggttttgta ttaaccggta tatacaattt tacaaaatca    210960
     aatctctttt atgtaaattt aggaggttta gtcctcaaca gtttcatgtt acttgtagca    211020
     gctaaagcat taatgaaaca aattaaaaac taaatataaa gataaaatag atttaagtct    211080
     atttggggta tcgctatcaa gctaataaaa ttaacatgga ggattcaact tgaataatct    211140
     acaaaacttc ttaaaagaaa atccatttat taaatgttct ctatatataa tattagggtc    211200
     cggagtagta aaaataggtt atgaatttgg ctatttcatt gcaaacttca cattataaaa    211260
     taaggagtgg tgttaattaa cataacaaca cttatcagta gtctatatat ttaaaaatct    211320
     ataaaaagtc ccttcagatt aatctgaagg gactttttat tcacataatt ggcgttagct    211380
     aaagttgtta tctattcgtt ttaaaatact ctgagtgttc tactttcata gataaaatgg    211440
     tacagccctc tgtacaaaca tcagcaataa ctcttgaaaa ctgaccagag tgtttacctg    211500
     tattaatcgg tcttaaacat gcctgtgcat ctaatgaacc ttgtccaatc tctttagatc    211560
     cacaattaga gcatatctta attatttgta attccttctt tctaaaaatt tagttcctat    211620
     aaacctttta tttaaataca acaacccgct cctctgttcg gagaggagtg tagtccacac    211680
     ccactaatca ttctcacctg aatacacttt taagtcttcc attgctatgg ctatggcatg    211740
     tttttctgta tcaattaacg ataacccctg tttaattgga gcccaatact catatccgta    211800
     atcctcaaac cacgcaaaaa cttctgtact gaaaaaacca tcatttcgtt tgataacttg    211860
     gactttgtat cttttgcttg gcgaaacaat ctctttaatg atttcttcca ttgtctatct    211920
     ccctctacct tttatccaga ttgtaacaca tcaagaatat agatgatgaa aggtattttg    211980
     attgcataag gtattcatgt taagtttaca taacctatca ttatcagtag tcaacgatgc    212040
     ataaaatttt cgttatgggg gtacttcaaa atcttagctt gatgggcatg tggtgctacc    212100
     cctaatttat ccaacttgca acacgtttgt gatatcctta ccctattcac tctaacttgc    212160
     aacacgtttg cggtatcctt gctcaaatca taataaacat gatatatcca gcagcttaag    212220
     tcttttaata taatattaaa aagtggatat gcttaatcgc atatccacta tcaagaaagt    212280
     atatatttca ccttatacat actttcttcc tatttatata cttaccttcg cttctccagc    212340
     atcctgtttt ttaattaaat ctaagtaaaa atgtgagaca gttgtgttgt aataaggaga    212400
     aatgaaaata aatgatagat taaatgtaaa cattcctata aatacggcta ataaaaacca    212460
     accaataaat gataaccaaa gaacaaataa ctttagcttt tgtcctttca ttattctttt    212520
     actttccctc aatgcttcac ttgctgtata atcaggattc tctactaata tgtaatacga    212580
     catggaataa gaaaaatatt taataatacc tggaacaatt aataagagac tccataaaaa    212640
     aagaaaaata gcttgcaaca gtcccaattt tattgatcta aacaaattgc ttttcttaaa    212700
     ccctagaaat acatcgtcca ctttagcgtc ttcatttttc cctaaatgta aggtgaaagc    212760
     agaatatcca taattaaaga tgccttgtat ggaactgtaa attaagaaac aaataagtcc    212820
     taaaaaaata taacttagaa taagtaaaac tagtgcagta gggtctactt ggggttgccc    212880
     actaattgaa taaacaaaga ttacatccaa accaattaac ccaataaaca ggccaactat    212940
     taaatacatg aatgtcgcga ttgctgatgc actaagagta ggtacaaaat agtttaacgc    213000
     tgatcctcct atacctcccc cccatttacc atctaacgaa ttaagtgctg ctttctttaa    213060
     atttcttgtc atacttgtat tcactccttt tttcttattt tcctttactg aaaaaataaa    213120
     agaacttgta gcaggccccg ctacaagttc tattagccaa atactttagc tcatcaaaaa    213180
     atcatttatt ctacacaatc gggggtaatg cctaaaatat ggtttgttaa catcattata    213240
     taacataatt atgaattttt gttaaaaatt ctatatattt agacaaataa ttctccactt    213300
     ttttacttat tttcatgtag gggtaccgcc acatcgctat caagttaatg ttttaaatta    213360
     cccccataac gaaaatttta tatcactata acagtcactt atgagaagtt aggtcatttt    213420
     atttattgtt atgctgtttt tttgtgacac acagtacaat tatagacaac atctaaaata    213480
     ttaaagaatg tctttttctc ataacagtga aactttcgcc cgtttttctg taggaggata    213540
     aacaggcgaa gcaggatcac ttgagttgga agcttttgat acaattcgat ataggcttcg    213600
     tgaatttcgt gggtttgtcc tggttgtagc tggaatgatt ttgcaattgt tacagaaaaa    213660
     agaaccgata ttcttacaaa tctggaaaat caaaagtggc tgtttatgaa actttctata    213720
     tttatactta aagttggtgc aacttcttta ttgcattaga tagtaatgta atttataata    213780
     cgtttaaatg attaaattct taaacggaag gtaatgttag cgaaatgaac tgtaatgata    213840
     aagtaatgca tattttagaa aatttaagac catgttttca agggttggga gatccaactc    213900
     gtcagcaaat tgtatcactt ttaattgata aagatagctt gaatgtgacg caaattgcgg    213960
     agcatattcc catgtcaaga cctactgtat ctcatcattt gaaaatattg aaacaatctg    214020
     ggttacttca agttcagaaa aaaggcactg aaatgtatta ttgtcttgaa tttaatgaaa    214080
     caataaatct tttaaaagaa cttgtttctt tagttgaaga tgaatgtaag aattaggtac    214140
     tcatttatag tttagggaca ccttttgtcc ctttttttag caatattatg ttgaaaagtt    214200
     taagttttta atcatttaaa cttataatct cacactaatt taaatggagg tttcagatga    214260
     ataagaaaac agtattaatt gttggtgggt atggagttgt tggtagtcaa attgctcgaa    214320
     ttttacatga ccgacatcct gatttggaaa ttagattagg aggaagaacc ttagggaaag    214380
     cgttaccttt tgaatcagag agagtaaaaa tagtcaaggt agacaacaca acagatgatc    214440
     ctttaagaaa tttggatgat aatttcacat tagttgttaa tgcggttaat gaccctcaag    214500
     atagactact tctatctgca gttcgaaaaa aaattccatt ggttgacatt actcgttgga    214560
     ctgaacgatt taagagttct attgaacgat taaaaaatat tgaggtccaa tcccctgttg    214620
     tattagcttc agggtggatg ggggggactg cagccctttt ttctaaaatt tattcaaaag    214680
     atcttcaaga ggttacggtt gatatcaacg cactatattc tcttcaagac aaagcaggac    214740
     caaattcaac agcatatatg gaccggttaa ctattccgtt tgaagtcaaa gctcgagagg    214800
     gaatgcaaca agcttatcca atgactaatc caatcaaaat ccgctttccc aacggttata    214860
     taaccaaatg ttatcgtttg gatacacctg atcacgtaac cctgccagaa tcaattcatg    214920
     ctgtttcggc taactttcgt attgcttttg atagtaaaat atctacatat ggactggttt    214980
     ctctggtgaa tacagggatt tggaaaatga ttagcggaga aaaatttacc aattttcgga    215040
     aaaatattct ctataaaccc ggaaggggaa gtgcacataa catagttatt caccttaaag    215100
     gttatgatgc aactggtgta ttgcatagac gatgtgtgaa catatcagat ccgttaggac    215160
     agacacatct tactgcttta ggagcagctg tccaagcaga gaacatttta caaccatctg    215220
     atattgtggt tccagattct aaaatttact ttccggaaaa tttattagat ttgggtgtga    215280
     atgcatctgc aattttagat ttttataggg aatatggggt taatattacg aaagaaaata    215340
     tataaaaggt atcgttctat tcgtggtagt acacatatgg ctatcaagct aagaaatata    215400
     aatatctcca aaacgagaga atgtgcatct tcatgtaaaa atgtacattc tctcgttctg    215460
     cggtgttata aaattcttaa attgatgggc atgggatacc gccagcattt tggaaaaaaa    215520
     ccacgttaag agtatgcaag attttataca gtttttcggc taatccagta acaaacgaga    215580
     accctaaaac ccctgccagg ataggaatgt ataaaaagat gaataacgtt atagaaaata    215640
     aaaaagggga ttccttctga gagtaaggat tccccttttt ctttgctacc gataataatg    215700
     cgttatgtta actgatattg tatatcgcat acaataaaac acattctatg attcatcgct    215760
     acatattcca ccagtcatac ctaaagtttt taaataaacc tgaacaatag gtaccttttt    215820
     gaataaccta atataccaat cccccccctt tcattaggaa aaccaatcat cttttaggat    215880
     acgatttgtc cactccgcaa gctgaatact acatacaata tataatctac aaaaatattt    215940
     attaggagtt gaatatatgg gatcaacaaa gttaacagga cgagtaatct tcaaagggga    216000
     ccccggctat aaagaagcaa ttaagaattg gaacccttat gttaatgtct ttcctcttgt    216060
     ctttgttttt gcgcaaaatg catgcgatgt aagtaatgcc attaaatggg ctcgtaagaa    216120
     ttgtgtacca ctgcgtgtca gaagtggccg ccatgctcta gataaggagt tctccgttgt    216180
     aaagggtgga cttgttattg atacgagcga tatgaataaa gttcacttag ataagaaaaa    216240
     aggaattgct accgttcaac cgggaattcg cgtgggccct cttgtaaaaa aattagccca    216300
     agaaggtttc atggcggtgt ttggagatag tccaaccgtt gggattggtg gaattacaac    216360
     tggcggcgga tttggagtac tctcacggtc aattggttta atatccgata acctcctcga    216420
     actagagatg gtggatgcaa aaggaaaaat tcatcgcgca aattcatctc acaatgagga    216480
     cttattttgg gcctctagag gcggcggtgg cggtaccttt ggatataata ccgaatacac    216540
     gtttaaagtt catcccgccc ccaaaaccgc gacggtcttt aatattgttt ggccatggga    216600
     gcaattggaa acggtattta aagcttggca aaatttgatg ccgtttgtag acgaacgatt    216660
     agggtgcata cttgagattc tcagcaaagt aaatggactg tgtcatgcaa ctggactttt    216720
     cttgggttcc acttctgagt tgaaacaaat tttagcacct ttactatgtg ctggtacacc    216780
     aacagaaata gttataaaaa cactttcata tccagagtgt atcgatttcc tcgatcctcc    216840
     ggaaccaccc tttgcagatc aaaattttaa attctcttca tcttggagta acaacctttg    216900
     gacggaaaaa ccaattgcgg tcatgaaaca atttttagaa aaagcaccag gaacagaatc    216960
     cgaattctat tttcaaaatt ggggaggtgc cattagaaac gtaccgaaag acgaaacagc    217020
     cttctattgg cgcactccac tgttttacac ggaatggaat gctacttggg ttgatccatc    217080
     agaagaagct agtagtcttg catcagtcga aaaagtgcgt aagctgttaa aaccatatac    217140
     agttggttca tatgttaacg ttccagacga aagtatcaaa cattttggaa acgcctattg    217200
     gagatcaaac tttaaaagac ttcaaaaagt aaaaacaaaa tatgatcccg aaaatgtatt    217260
     tcatcatcca cagagtatcc caccattttg ttaaatcgtt tcttcgtttt gtaaaacaaa    217320
     ataagacctc tgcgtattga aaaataaaaa aggatcttct gtatcaaaga tcctctttta    217380
     ttactgataa cgataattat gtaaataagc tgtccatatg gacagcttat tagcgtgggt    217440
     tctggtgcaa aaacttcagg acaattgcaa taaatctaca aatcttggac atactgatac    217500
     tactaatcta aagaagttgc gtgattggta tggaaaagga aaatttattc aaatggaaac    217560
     attatcagcc tgatattatt ttgttaacgg taagatggta cctacggtac aacctcagtt    217620
     ttcgtgattt agtggaaatg atggaggaac ggggcttatc catttctcat acaacgatta    217680
     tgcgttgggt tcatcagtac ggtcctgaat tggacaaacg aatccgaagt caccttaaac    217740
     aaacaaatga ctcctggaga gtcgatgaaa catatatcaa agtaaaaggt caatggatgt    217800
     acctgtatcg tgctgttgat tcaaaaggaa atacaatcga tttttaccta agcaaaacaa    217860
     gagaccagaa ggctgcaaag cactatttca agaaggcctt gcagtctttt catgtttcaa    217920
     aacctcgtgt tataacagtc gataaaaatc cagattatcc tattgcaatt gaacagttga    217980
     aaaaagaaaa aagcatacct ggtggtatgc gacttagaca acaaaagtac ttgaataaca    218040
     tagtagaaca agatcatcgt tttataaaga agcgaattcg ttctatgcta gggttcaaat    218100
     gttttgacac agctacatcc attctttctg gagtagaagt catgcatatg attaaaaaag    218160
     aacaggttga tttacgggac cagtctgtcc aaaatcaaaa agaattcatc catcaattgt    218220
     ttgggcttgc ggcataagat acgattccgt taggaatcta tgcgctttat tatcttttat    218280
     tctatttttg caccagaacc gtatttttca cctttaattt ttggtttctc agccatgatt    218340
     gtacttagaa aaactctaaa aactagttga aaatctttta gaatctaact ttcttataat    218400
     tctatttgct atttcttcaa tattttcatt tagaaagaaa tgattacctt taaaagagtg    218460
     aaaagtacac gttttacttg tgtattgctc ccattttatt acttgattat atgtagtaaa    218520
     ttcatcattt tccccattaa atataagaaa atcaatatca catgcttgca tattattgtc    218580
     atgaatatat gtctcaacaa ttttaaaatc tgctcttaga attgggagga aaattcccat    218640
     taattcttct gattgaagta ccccggacgg tgtacctccc attgcaataa cttctctttt    218700
     aaattgttcg ttagaaagat tatgtcggat atttttcatt ttactatttg ggtggtttct    218760
     accggacaaa acaagaaatt caggcaatac gtttttagaa tcttgtattt ttctggctac    218820
     ttcataggca atcaaacttc ccatgctatg cccatataga atatagggcg aatgctctat    218880
     ctgcttaact atactagtgt agacatcatt tacggcctct tccatacttt ggtacaagct    218940
     ttcttcaatt ctatatcctc taccagctaa ctctattggg actacttcaa tatatggatt    219000
     aaagtaattt ttccattttg cgtaactaaa cgcagatccc ccagcatgtg gaaagcaaaa    219060
     aagtttagtc ttctgcattg attttctcct tactttaaaa tttgtttata ttttggcaaa    219120
     ttgtataaat atctttaatt attatatcct gcggaaattc ttcccttgtt gcacaagcag    219180
     atatcttata attcggctca atgctatatt gtctaaagta aaagtcttta ggtatattct    219240
     tatatgagat taaagttcgt gactcttttt ttatagaaaa tgaatttaac gggatataaa    219300
     gccctttacc aatcgttttt atatagcttt cttttaatgt ccataaatca aaaaaataat    219360
     tgatttgttc atcagaattc atattagata aatcataaaa ttcttcctct gaaaaaaatt    219420
     catttgctaa tttaagagcc tctatgtctg aaactctttc aatatcaata cctacattag    219480
     aattagcagt ggcacagacc acccattctc ctgaatgcga aatattaaag tgaaagtcag    219540
     aaaatttttg aacaaaaggt tttccgtact cattatatat aaatttaatt tcttcattat    219600
     tcattttata tttttggcaa actagggaac ggattaataa atctcctatc aaagtcctat    219660
     taatatcaca taaatttaat aaacgcttca ttcgttctct cttctcattt gaaatcaagt    219720
     tactaaattg attaaacaaa tgattttcaa tattctttgg tattttcaca gcatgaattt    219780
     gtatgataaa tcacttcctt tttaaaagga tgtcttccta tgtatacgtt atagaaattc    219840
     aatttcattt tctaacttgc atttattcaa gtgcaaatat aatagaaaag gtgcatattt    219900
     acatatcaat gaaaatatac acctttcctc agcaatatca tcaaggcatt cgcttctggt    219960
     acaaaaactt cagagaattt acagcatact atgaacaact catatatgtt tctatgtccc    220020
     tatcaagcaa tttttcatta accctttaaa aagtaatgct cttgatatat acataatctc    220080
     ctacacttga tgtgcagtta ttggactgct ctctttattt acactactac tcacaaataa    220140
     caactttaat aataacaatg ttcgtttata aagttgcctc ttttgtgctc tctacttttc    220200
     cgttagcgaa agggatgtct cttttattcc ttctaattca tttagtagat acttagctag    220260
     cttttcaact gcgggggaag ctactatttc ttcgtgtgat ccagggaccg aatacatatt    220320
     cactcttcct tttaataaag gcttccaatc cgtaaacaat tctttacctt cctcagcact    220380
     aaagtaaatg acttccccaa aatatggtgt taaatcatgc tctgccatta aattcagaca    220440
     tttcctgtga gcattgataa gttgcttcaa attcgtaaga tttgcatcag gcgggagcac    220500
     tccttccaca attaattgct caacaagcat gtcctgttga tgaacaagct cttcttcctg    220560
     atccactagc tctatatgga tgaaatgctc caatatataa gatagcatgt catcctctgt    220620
     cttgtaatcc cgttctgaag gcaccttggt atccaatagt accaacacct caacttcttc    220680
     tccctggttc cgtagcatag ttgcgatttc ataggcaatg gcaccaccca gagaccatcc    220740
     tcccagacga tatggcccct ctggctgagc ccgcttcatt tcctcgatgt agagttgaac    220800
     tacttccgat aaaatcaacc cgttcattcc ttctttctct acgagaggat tctgtaaacc    220860
     ataaaatgag cagtgatcct tgagtaacct tgctagctga atgtaacaga gtacattacc    220920
     cataaacggg tgaacacaga agaaaggtct tttctctgat tcttgtaatg gaaccagaac    220980
     cgataatgat tcttccatac gatgattctc acggatgaga caagcgattc cttccactgt    221040
     cggattctta attagtgcgg gcaccttaat ctcttttcca aatttctctc tgacctttga    221100
     aatcaatttg attacaagga gagagtgacc tcctatattg aagaaatcat cgtttacatg    221160
     gatatcttct aactgtagca aatcctgcca gattgtaatc agctgatact cgatttcatc    221220
     ccgtgggata attggtgtag aaaaggtatt ttctctttga atcgttaagc tgttcagtgc    221280
     ctttcgatca accttcccat ttgttgtaag cggaatcgca tccacctcaa taaagtgtgc    221340
     aggaatcata tgattcggta cttgtctctt gagatgctca cgccattcat gcatacttcc    221400
     ttcacccacc acataagcaa ccaatctctg atctcctggt tggtcctctc ttatcaagac    221460
     taccgcctct ttcaccgatg gatgactttc taaattcgct tcaatctctc caagctcaat    221520
     ccggaatcct cgaattttca cttgattatc gattcttccc agataatcca aatggccatc    221580
     agctaaataa cggactagat ctcccgtccg gtataaccgt tctccttcat taaatggatg    221640
     tggaataaaa cgttctaacg ttaactctgg acgattcaag tatcctctcg ctaggcctgc    221700
     tccaccgata taaagttcac ccgttacacc aactggaaca ggtaacaact tctcatccaa    221760
     tacataggct tgaacatttg gcaacggacg cccaatggtt actctcttac tatctttttt    221820
     gatacgatag catgtcgcat caaccgtaca ttccgtagga ccatatacat tataaaaatg    221880
     gatatggtca ttctctacta gttgttccca cagtgatggc ataatcgctt ctccaccgac    221940
     cagtaccttg cttggaacat gaacactatc gtttgtttct aacaacccct catctatgag    222000
     taattggagt agtgaaggtg ttatatcgaa catttccaac ttattctccc gaatataaga    222060
     tataaactgt tgaggatcac tgcgaacttc tgttgaaata atatacaaac tagaaccata    222120
     caaaagcatt tgtaattgtt taacggatga atcaaaggcg attgaggcat ttagaccaac    222180
     gcgcatgtta tcatgtgccc gatgtgaaaa aacctctttc tgtaaaccat aggatagatt    222240
     taataccgaa tgatgctgca ccataacccc ttttggattc ccggtcgaac ctgaagtgta    222300
     gataacatac gccaagtttt ctcctgttac tttacatatt ggtgaaagag tgttttcttg    222360
     cgaaatcatt gcttgatctc ggtccaaaca aactgtttca acttcttcag gcatccaacc    222420
     ttgtgatact tcgttcgtaa ccaatatttg aattcctgtg tcctccagaa tatatcgtag    222480
     gtgactttct ggatacgatg gatccagcgg aacataggct gatccagctt tcaagattcc    222540
     catgagaccg acaatcatct caactgaacg ttggaaacaa agcccgacca atgactccgt    222600
     tccaatcccc attttctgaa gataatgggc caattggttt gctttctcat tcagctctcg    222660
     atacgtcaac cgctgatttt catccaccac tgccaccgca tcaggtgtac gatccacttg    222720
     atcttcaaaa agtttgtgga tcacactttc acgtggatac gctgctgcat tatcattcca    222780
     ttcttccagc agttgtttct gttctatttc cgtaacatac accagctccg acagagtttg    222840
     atcaacgttc tcgatcattt gctttaacac ctggcttaaa tggcccagca tccgttcaat    222900
     ggtgaggcca ttaaacttgc tacgatcata cttcaacttt aacaacaact ggctttctgg    222960
     aacaactgtc aatcctaatg gataatgagt ttgctctact ccttccaact caccaatttc    223020
     tagatttcct gaggacccct ctttcactgg gtagttttca aacacataca agctatggaa    223080
     cagcggggtt cctctaggaa tttcactcca tccttgaatc tctgtcaaag aagcatattc    223140
     atattgtctt ctttctatct cttcctcttg tatcttcagc aaccaatcca ttacttttat    223200
     attatctatc aactgaattc gcgtcggtga tgtggtaata aaaggaccta caatgttttc    223260
     aacatcaata atctccgtag ggcgtcctga gctagttaca ccatagacaa tttcatcttc    223320
     tccactatac cggctcatga gatacgccca cgcaccttga attactgtat tcaaagtgag    223380
     cctattgcgc ttcgcccagt tttgtaacgc ttgggtttgc tcttctgata aataagttac    223440
     cttctctgtg taaccttttt cttgctcttt actttctaag cccagcaggg ttggagctgt    223500
     aaaaccttta agtttctctc tccagaattg ctccgcctgc tcctgattct gttctcttag    223560
     ccattgaata tatttcttgt atggcgatga attaggtaaa tgcacggctt ctccattcat    223620
     tctcttctgg tacactgtaa gcaattcgtt aaagaccagt ggtaggctcc atccatccaa    223680
     cagaatatgg tgatgtgtcc aaacaatccg atattcttcc tcaccttctt gaatgacagt    223740
     cacccgcatc aatggcgctt tatcaaaaag aaaggcttgt tttcgatcca atgccaaaaa    223800
     ggcttttctt ttctcttctt tttcttcagc agtcagcgta cgccaatctt ctacattcac    223860
     cttaaatgga acactctcat acaccacttg taaaggctct tcaacttcat cccaaaggaa    223920
     agctgagcgg aaaatttcat gccgctgaat taccgatttc cacgcctgtt cgaaagtagc    223980
     aatatccaat tctcctctaa tcatgaaact taattgcact atataaggcg ctacatgttc    224040
     ctccccttgg tcatgcaatg tatggaaaat cataccttct tgcaaaggcg atagtggata    224100
     taaatcggta atcggataat tatttccacg attcatcttg gttaatactt ttgtcaaact    224160
     ggcttggtca agattagcca tcacaaaatc tgaaacggtc agtgcagatt ctccacccgc    224220
     agattgaatc aatttactta gttgatggag catattctct gcaatacttt gaatcgttga    224280
     tttcgcatat tgtcctacat tgtataccca agtgaactga agtttcccat ccgttaccat    224340
     tccaattaca tcaattaaat gcgatcgctt ggaaccagaa gcatgatcta agcgcttaaa    224400
     tccgttctct ggaataagta ttgcatcgtc agaaaacatt tggtcaaatt gtccaagata    224460
     gttaaaacta atagacggtg tatgttgaga cccccattgc tcgcatattg ttgtgttcag    224520
     ataccgcaaa attccatggt caacaccctt attaggaatt ttacgcactt gttctttaac    224580
     tgcttttaat gctgcaattg gcgtgtcagc accggtaata tttaagtgaa caggataaat    224640
     acttgtaaac caccccacgg ttctagatag gtcaacgtct tcgataatct cttcccgacc    224700
     atgcccctcc aaatccacgg tcagcgccgg atgacctgtc catactgccg tagcctgtac    224760
     caatgctgtc aatagtactt cattgatttg gacacgatga gtgcttgaaa tctctttcaa    224820
     taacgtacgg gtctctttct catccagcac cacggtaatc tcctcggttc ctgtgttggc    224880
     tggaacttcg agggtggtat ccactggtag catagccact tcttgttcgg attgctgctc    224940
     ccagtaatca cgcacttctt gcacaatccc agcttcagcg taatgatgca atttctccga    225000
     ccacgcttta aaggatgtac tctttgtagg taattggatc atctgatcct ggctcgcttg    225060
     attatacgcc gtttgcagat cctccagtaa aatccgccaa gaaacaccat ccactgctaa    225120
     gtgatgaatc acccagaata atcggccggc tcttttctca ccttcatcaa aatacaccat    225180
     tctcattagc ggtcctgcgt gtaagtgcaa gcttgcttgt gcagtgtcaa tctccgcttg    225240
     aatcacttga tgccattctg cttgcggcac ttcgtctaat gaaataacgg tcagcgtcga    225300
     ttgttcttcg atcccttcgt tccactgttt ccaagctcca ttcggtaacc gttcatatct    225360
     taaacgcaag gcatcatgat ggattagaag ggtacgcaca gctttctcca gtaatactat    225420
     atccagtcgc tcttttgttc taaaaaacat ggattgattc caatggtgtg ggtttggatg    225480
     atcttgtgca aaaaaccatt gctgaattgg tgtaaggatc agttctccag ttataactcc    225540
     ctgctctgct tgtacacccc gttcttcatt gactacttgc gccaactcag caatcgtttg    225600
     gtgttcaaac atttgctttg gcgtcaattg caaacctgct tgcttcgcac gagagacaat    225660
     ctgaatgctg agaatcgagt ctccaccaat ttcaaagaaa ttatcatgga ttcccacctt    225720
     tttaatccct aatacttgct tccaaatggt ggccagtgtt tcttcgttac cattccgcgt    225780
     ggcaacacat tcactttcga ttttcctctc ctctggtaca ggtaaggcct tacgatcaac    225840
     ttttccgtta gcagttagtg gaatggcttc catcatcaca aatcctgaag gaaccatatg    225900
     gcttggtagt tccgccttga gataatctct ccactcacct acattcccat cacccacgac    225960
     atatgccacc aaccgtttat cacccggctg atcttctcga acaattacaa cagcctcttt    226020
     tatggagaca tgtgcgttta aagcagattc aatttctccg agctcaattc ggaaaccacg    226080
     gattttcacc tggtgatcaa tccgcccaag ataatccaga tttccatcag gtaagtatct    226140
     cgctaagtct cctgtccgat ataatcgcgc tcctgggtca ctactgaatg gatgaggaat    226200
     gaaacgctct gcagtcaatt cggatctgtt taaatatcca cgtgcaagtc ctgctccacc    226260
     aataaatagt tcgccagcta cgccaatagg cacaggttgt tgacaagcgt ctagtacata    226320
     cacttctaaa tctggaatct gttttcctat attacttctt gaagcatgct gcacatcatc    226380
     ttgagtaatt ggataatacg taacatgaac ggtagtttct gtaattccat acatattaat    226440
     taactgtggt tcctgccctc catacctttg aaaccatggt accaagctgg taggatcgag    226500
     tgcttcccca ccaaatatga catagcgcag atgcaagtct ttcttctcat cttcttgttc    226560
     acacacttgt atcaattgtc gaaatgcgga tggtgtctga ttaagaaccg taaccttttc    226620
     ctttactaac agttgataga aatccttggg cgatcgacta atccagtaag gaacaacaat    226680
     caatcttccg ccatggagta atgcccccca aatctcccat accgagaagt caaacgcata    226740
     agaatggaaa agcgtccaag tatctttttc atcaaactga taccaacatt ccgtcgattt    226800
     aaataaacga atcacattgt gatgctctac cataactccc ttcggattcc ctgttgatcc    226860
     cgaagtatag attacatacg ccaagttttc tcctgtcact tcacatattg gtgaaagggt    226920
     gctttctcgc gaaatcatcg ctttatcccg atccaaacaa actgttttga tttcttcagt    226980
     tatccaacct tctaatgctt cattcgtgac caatacttga atccctgtgt cctccagaat    227040
     atatcgtagg cgactttctg gatacgatgg atccaatgga acataggctg ccccagcttt    227100
     caagatcccc atgagaccga caatcatctc agctgaacgc tggaagcaga gaccaaccaa    227160
     tgactcgctc ccaatcccac atttctggag ataatgtgcc aattggtttg ctttttcatt    227220
     cagctctcga taggttaact gctgtttttc atctaccact gccaccgcgt caggtgtacg    227280
     atttacttgc tcttcataca gctgatgaat cccaaattcc tgtggatatg ctacagcatt    227340
     attattccac tcttctaact gtttttgctg taatcctgac agtatcggca acttagctaa    227400
     tgatttatca ggttgttcca cgattaaatt caaccagttc ccaaaatttt ctgctatgga    227460
     ttcaatagtt aaactgtcaa ataaatcagt cctataaaca aaagtaagca ataagccctc    227520
     ttccacttct gcggcagtta aacttaaatc aaatttggcg attgaagcgt ggctgtccat    227580
     tacttctata cttcgtccat gtagctttgg tagctcttgt cccgtatttt gcaaagtaaa    227640
     catggtttgg aaaatcggag aataacttgt acttcgttca ggttggataa cctccacaat    227700
     tttctcaaac ggaacatctt ggtactcata tgccttcaat gcttttatcc gcacttgaga    227760
     caacaactct tgaaatgccg gtgcgccact taaatcagct cgataaacca acgtgttgac    227820
     aaagaaacca atcaaccctt caatttctcg ataatttcga ttcgcaattg ggcttccaac    227880
     aagaatatct gattgtcctg tataacgggc aaggaaactt tgatacgatg ccaataaggt    227940
     catgaaaagc gtggcccctt cttgacgact aagttcgttt aatttatcca gtaatgagcg    228000
     tgacaacaac acattatgag ttaatccatg gtgggtttgc accggaggac ggggacgatc    228060
     catcggcaac attaagactg gtaactcacc agacagttct tccttccaat atgcaagcgg    228120
     ttggtttagt acttcatcta tcaaccattc tctttgccac tgagcaaaat cggcatattg    228180
     aactggtagt ggtgcaaggt ctgctggttt ttcaccaatc gcctcctcat aaaatgccat    228240
     ccattcttgg agcaagattt ccatcgacca tccatccgag ataatatgat gcatattaca    228300
     cagaagaacc cattcttctt ctgaaatttt cacgatttgt ccacggaaca atggcccttg    228360
     ctctaagtca aatggggatt cgacttcagt ttgaatccat tgctccactt ctctttctct    228420
     ctcttctgga gaaatcttag ttaagtcaat ttgtggaagg gaacggaaag tatacggttg    228480
     aatcttctgc acaggatgac cgtccacttc atgaaatact gtccgcaatg attcatgacg    228540
     ctctatcaac tgattccatc ccacctccaa tgcttctagt aaccaatttc ctgtaagacg    228600
     gcataccatc ggcatattat aaagtgcact attaggtgta aattgatcga taaaccataa    228660
     gcgctgttga gcataagaaa gtggaatggc atttcctcgt tccatcggca tcaatggtgg    228720
     aatttctcgt tttttgcctc ccttacgtaa ctgatctaat cgcttcgcca gtgcctcgac    228780
     cgttgaatat tcgaacagtt cacgtaccgg taatttgatt tgaaagactt cttgcaagcg    228840
     tgagaccact tgtgtagcaa gtagagaatg accaccaagt tcaaagaaag aatcctgaac    228900
     acctatattt tctattccca gcacttgact ccacactgaa gcgataagtt cttctagcgg    228960
     agttcgtgcg tgaacggtat tttccgtaga taatttgcta ggtattggca atgcctttaa    229020
     atcaagtttt ccattcggtg taagtggtaa aaattccatc tcaataaagt ttgttgggac    229080
     catataattt ggtaaatgtg tttgtagatg ctctcgccat tcttggacac ttccttcacc    229140
     aactacataa gctactaatc tcttgtcgcc tggatcatcc tctcgtacca atacaaccgc    229200
     ttctttcaca gaagaatgtg cctgcaagac tgcttctatt tctcccaatt caatccggaa    229260
     accacgaatt ttcacttggt catctatacg accatggaac tggagagcac catcagaaag    229320
     ataacttgct ttgtctccgg tgtaatagag acgttctcct gacttgaatg gatgcgaaat    229380
     aaatttttcc tttgtaaggt ccggacgatt agcatatcca cgagcaagac tcttccctcc    229440
     aatatagaga tctccaatca caccacttgg tactagctga agatgagaat ctaacacata    229500
     aacttctgta ttcgcaatcg gtcgaccaat cgatggcgta cctgttgtca ctcctacagg    229560
     tacataacaa tccgtggtaa caacggtatt ttccgatgga ccatactgat tgattaccgc    229620
     aaaaggaata tcgttagatg gatactgcgt taattgatcc ccgccggtaa tgataaaacg    229680
     aagatccgtt ttatctggcc aagataattt caagagtctt tccagaatag gcgtaggtgc    229740
     aaaactagct gttattcgcg aatcaatgag ccagtctctt agtgcttctg gattaattct    229800
     cagttcctct gttgacaagt agagtgctgc accagcagtt agatacggcc aaatctcctg    229860
     gacagccgaa tcaaaagcaa tccctgcaat ctgagtcgca cgatcctctg ctgtaatacg    229920
     ataaacttca tgatgccaag aaaccatatt cattaatgat cgatattcaa tcatgacacc    229980
     ctttggcttt cctgtagaac cagaggtata gacaatgtaa gctaagttct ctggatttat    230040
     ctgccgtgta ggtgctatta cgctttccac tgttaactct tctaacctca ccatttcgac    230100
     ctgttcgaaa aggccttctt gtccttccgc cgtcactaca aattgaattc ctgcatcttc    230160
     aatcatgtat tctaaccttg attttggata caacggatct aaaacgacat aagctccacc    230220
     agcttttaat atgcctagta aacttaccat gagctcagcc gacctcggaa gataaactcc    230280
     cacgactgac tctggagcaa ctccttttcg ctgtaaaaca tttgccaact gatttgcttg    230340
     tgcatccagt tcaccgtaag tccaatcttt tgtttgatca actaccgcaa tcgcttcagg    230400
     acgctttgct acttgttcct caaatctgtc gcaaataaga ccctgtgggg gcatttccat    230460
     tacagtgtca ttccatgttt ctaataacaa agtacgctca ggttccgata gcatgctcag    230520
     actatgcaac ggatttttcg ggtgatggga aacttcgtgt agccatttct caaagtgccc    230580
     tgccatcctt tcaatagttg tagcattgaa taaatcctta ttgtattcaa aagtaaaacg    230640
     tactccctct tccgtctcag ctaccattac acttaaatca aactttgcga ttggactatg    230700
     gctttctatc atttcaatac ttctaccaga taacaccggg aactcttgtt tcaaattttg    230760
     caagatgaac atagtctgga agattggcga atgacttgta ctccgctctg gttgtacaac    230820
     ttccacaatt ttttcaaaag ggatatcttg atactcatac gccttcaatg ctttttgacg    230880
     aacctgagac agaacatcct gaaatgtcgg tctaccactt agattagccc gatataccaa    230940
     ggtgttgacg aagaaaccaa taagtccttc aatttctcta taatttcgat tagcaattgg    231000
     acttccgacc agaatatctt cttgacccgt ataacgtgat agaaaacttt gatatgcagc    231060
     caacagcgtc atgaagagtg ttgccccttc ttggagacta aattcgttca atttgtcatg    231120
     tagcgcgctt ggcagaacca gagtgtatgt cgacccgtca tgagtttgta ttgcgggacg    231180
     cgggcgatcc ataggaagtt ggagtacagg aagctcccca gacaattctt ccttccaata    231240
     ttggagttgt tgatcaagca cttccgcctt caaccatcct ttttgccact gagcgaagtc    231300
     ggcatactga accggtaatg gttcaagttc tgctatcttt ccatccgtag ctttctcata    231360
     gaatgccatc cattcttcaa gtaggacttc cattgaccat ccatctgaaa tgatatgatg    231420
     tagagtacaa aggagaatcc attcttcctc tcccacttgc aaaatacttg tcctgatcag    231480
     tggaccctca cctaaatcaa atggcatttc tgtttcttgt tgaatcaaac gtttaacttc    231540
     ttcttctcgg ccttctggag aaagcatagt taaatccgtt ttcggaatta atcgaaaagc    231600
     atacggttca atttgctgta cgggttgacc gttcacttca tgaaagaccg tccgcaatga    231660
     ttcatgacgc tctattagct gattccatcc cgtttccaat gcctcaggca gccaactccc    231720
     tgtaaggcgg catactattg gcatattgta aagtgcacta ttaggtgtaa attgatcgat    231780
     aaaccataag cgctgttggg cataagatag tggaatagtt tcccctcgtt ccatcggcat    231840
     tagtggcgga atatctcgtt ttctatctcc tttacgtagc tgatctaatc gctttgccag    231900
     tgactccacc gttgcatact caaatagttc gcgtaccggt aattcgattt gaaagatttc    231960
     ttgtaagcgt gacactactt gagtagctag tagcgagtga ccaccgattt caaaaaaaga    232020
     atcctgaaca ctaatatttc ttatacctaa tactttactc catacagaaa cgatgagctc    232080
     ctccactggt gttcttgatg aagtaatatc ttcacttatg aactgtgcct ccaattccag    232140
     taaagctttc cgatccacct taccatttgg agtgagtggc atcgattcaa cttggaaaaa    232200
     gtatgccgga accatataat ttggcaattg cttcttcaga tattcacgcc actctccagt    232260
     atccccttca cccactacat aagctactaa ctgcttatct cctggtcgat cttccttcac    232320
     caacacgaca gcctctttta cagatgagtg atcatgtaaa gctgcttcga tttctcccag    232380
     ttcaattcgg aatcctctga ttttgacttg gttatctatt cttccaatat actccaagtt    232440
     acgatcattc atatatctca ccaggtcacc cgttcgatat aatcgttccc cttccttaaa    232500
     gggatgcgga ataaaacgtt cagtagttaa ctctggtcga ttgaagtagc cacgtgccaa    232560
     gcctactcct ccaaggtaaa gttcccccgc cacaccaatc ggtaccacct gttgatattg    232620
     atccaacaca tacaactctg tattatcaat tggacgacca attggaataa gcataggttc    232680
     tttttctaaa tcacaatcat aataagtcac atccacagtc gcttcggtag ggccatacaa    232740
     gttaattaac tttgtttgct gaacatcgta aaataccccc ttaaaccggc gaacctgttc    232800
     agtatttaat gcttctccac tagtaaaaac ctgatttaaa gacgattcat cccttttcga    232860
     attatattgt tccatataat ccaagaaagt agataacatc gacggaacaa agtgcatggt    232920
     ggtcacacga tatcgttcga tatactcctc aatcaccgca ggatctttct ctcctcctgg    232980
     ttgaagcaaa caaacacgcg ctcctacaaa tgaccaccaa aataattccc agacagaaac    233040
     atcaaatgaa aacggtgtct tttgtaggat tgtatcctcc tcagataatg gatacttttt    233100
     ctgcatccac tgtaggcggt tgataaccga atgatgttca atcattactc ccttcggatt    233160
     tcccgtcgaa cccgaagtgt atatgatata ggctaagtta tttgctgtta ctccactcac    233220
     cggagccaaa ttactctctt tagaaatcat tacttgatcc cgatctaaac aaattgcttg    233280
     aatatcttta ggtaaccagt cctgtagtgc ctcttttgtt aacagcactt gaatttgtga    233340
     attctctaaa atgtatctca ggcgattttc gggataactt gggtccagtg ggacataagc    233400
     cccacctgct ttcaaaatcc caaagagacc aataatcatt tcaggagaac gttcaacaca    233460
     tataccgacc aatgattcag gtcctatacc tcgtttttgt agataatgtg ccaattgatt    233520
     cgatttttca ttgagttctt gatacgttag ctttccaccc tcataaacta ccgccactgc    233580
     atcaggtgta cgtgcaactt gctgctcaaa tagctcatga atcatatact catgaccata    233640
     aactacgtca gtatcattcc attcttctag gagttgtttc tgctctgtgt ccgataacat    233700
     tgacagcttt gtatatgatt catctggatg atacgcgatt tcatttaacc agttctcaaa    233760
     atggcctgcc atacgtgcaa cggtactact atcaaataaa tccgtgttgt attcaaatga    233820
     gacaaatagg ccttcttcca cttcgtaggc agttaaactc agatcaaatt ttacaataga    233880
     catattactt tctaccattt cgatacttct accagacaaa tctagtcgtt cttgttttat    233940
     attctgtagt gtaaacatgg tctgaaagat aggagaatga ctcatacttc gttcaggttg    234000
     tacagcttct accacttttt caaatggtat atcttgatat tcgtaagctt ttaacgcctt    234060
     tttctttgtt tggttcaaaa tctcccgaaa agtaggggtg ccactcaaat ctgatcggta    234120
     aaccaacgta ttaacaaaga aaccgattaa tccttctact cccttatgat tccgatttgc    234180
     aatcggactt ccgactagaa tatctttttg ccccgtataa cgagcaagaa agctctggta    234240
     tgcagccatt aaagtcataa ataaggtaga tccttcttgt cgacttatat cctttaattg    234300
     attgagtaat ctataaggaa aaatcacgtg atgcgtatcc ccagcgtaag tttgcgtaac    234360
     cggtcgaggt cggtccactg gcagttgtaa tataggaagc tccccagaca attcttcctc    234420
     ccaatacgta agttgacgat ttaacacatc accttgcaac cactcctttt gccactttgc    234480
     aaagtctgca tattgaatgg atagtgaact taatttagca ggattcccgc ccgtttcttc    234540
     ttcatagaaa gtaagtaatt cattcatgag tataccgatg gaccaagcat cagaaataat    234600
     atgatgcatc gtacatagta ataaccattc atcctttcct aattgaacaa gctgattacg    234660
     aattaaaggg ccattcatta aatcaaatgg ttcttgcgct tctctcgcaa ttaaactatc    234720
     tacctctttt tcttttactt ctagaggaag ttgcgagtaa tcccttacag gtaatgctct    234780
     aggaaggaat tcgacaattt gttgtacagg ttgttctcct acttctttaa aaacggttcg    234840
     taatgattca tgacgttcaa tgagtcgatt gaatcccttt tctaatgctt caggaatcca    234900
     atttcctttt agatgccata ccgttggaat attatataaa gaactgtttg ggttaaatct    234960
     gtccataaac cacaaacgtt gttgtgcata agacaacgga agtgcttctt tattctcctt    235020
     tttttgcatt cgcttctgaa gccaagctct tttctcagga gaaagtgaac tcagctttgc    235080
     atgtaaatca cttctcattt ttttacccct tcctcaacta aattactctc gaatattcct    235140
     tgtgcttctt cctctgatag ctcttctaat tgcttaagta gttcaagtaa ttcttcatca    235200
     ttactcactt ctgcttcttt ttgaatatag tcttgaagac ttacattctc cttactatca    235260
     ttctgtattt cttgattttt gttatagaac aattgatcaa tctgttttgc caattgttgc    235320
     accgtatgaa acgtaaatag atcatgcaat ggtaactcga ttccaaaagc ctctttaaga    235380
     ttggaaacag cttgtgtagc aagtaatgaa tgcccaccta tttcaaaaaa cgaatcctgc    235440
     actccaatat tttctacacc taaaacttga tgccatattg aaacgattgt tttttccgta    235500
     ggtgtacggg gagcaatata accactcgct atctcctgtc tctctggtgc tggtaaggcc    235560
     ttcctatcaa tctttccatt tgaagtgagt ggaaatgcat tcaatccgac aaaataggct    235620
     ggaatcatgt aatttggtag ctggtccttg aggtaatcac gccacttatg agcatcccca    235680
     tctcccagaa cataggcaat caaacgtgga tcaccaggat aatcttcccg caccatcaca    235740
     agaacttcgt taactaatgc atgcttttgc aatgtcgctt caatttctcc tagttcaatc    235800
     cggaacccac gaatttttac ctgatgatcg attcggccaa gatactccaa atttccatct    235860
     ggcagatacc ttactaggtc tccagtccgg tatactcgct ctccttcttt aaacggatgc    235920
     ggtataaaac gatcttgcgt taagtcagga cggtttaagt atccacgtgc taatcctgat    235980
     ccaccaatgt aaagctcacc aactacacca attggaacca ttttttgttc agcactcagt    236040
     acatatactt ctgtattgaa gactggttta ccaattggtg gtaccctatg catgacaccc    236100
     ttttctaatt ccatatatgt ggaatacgta gtatcttcgg acggtccata taggttgtac    236160
     accttctcaa tcgtacttct ctcgtataaa tcttgaacaa gtgaatatgg taatggttct    236220
     ccagccaaat tcatcacctt taccgatgaa ggaattgttt ttgctcgaac cagttccttc    236280
     gctgccgatg gcacagtatt gaccaaagtc acacccttgg tagacaactt gtctagatgt    236340
     agagcatttt cagcgacaat caccttacca cccatcgtta agggaacaaa cacttcaaaa    236400
     acggatagat caaaggatag cgaagttgaa gctaatactc ccgctaattc cttttgggaa    236460
     tatgtgtgat gcgcccaatg aatcattgtt actgtattcc tgtgctcaat cattaccccc    236520
     tttggatttc cagtggaacc tgaagtatag ataatataag ctaaattatc gcccgtcact    236580
     tcactcgtac acactgtagt tacttcttgt tctatttctt ctcgatcacg atcaatacaa    236640
     atcacggcaa cggatttagg tataaccatt ttttgttgta acttttccag tgtcaccaat    236700
     acctttatat gagcatcctc taaaatatat tgcagtcgac tttccggata cgctggatca    236760
     attgggacat atgctcctcc tgccttcata attcctaaga ggccgacaat catctcggat    236820
     gaacgtgtaa cgcaaatccc aaccattgat tcgcatccta caccatgctt ctgtagataa    236880
     tgtgccagtt gattcgagcg ttcgtccaac tctcgatatg ttagttcttc atcttcgcac    236940
     actactgcaa ttgcttctgg tgttttttcc acttgttctt caaataatgt atgaattgtg    237000
     ctttctcgta tatctacaac acctgtttca ttccattcct ctagtagttg cttatattcc    237060
     acttttgata acatattcag ttcagataat aaatcttttg gatgagagac aatttgatat    237120
     aaccaatgtt caaaatgact tgccatacgt tcaatggttg tatcattaaa caaatcagta    237180
     ttatattcaa aggttagcga taatccttct tccgtctcag aagcaaataa actcaaatca    237240
     aatttcgcca cagaagtatg actttccatg agttccatgt gtctttcaga tagctgagga    237300
     aactcttgtt tcgtattctg taaagtaaac atggtttgaa atatcggtga atgacttgta    237360
     tttcgttccg gttttacaga ttctaccact tcctcaaatg gaatgtcctg atactcgtat    237420
     gcttttagtg ctttttttcg tatctgcgac aaaagttctt ggaacgtcgg atttccactg    237480
     aaatcagctc gataaaccaa cgtatttgca aagaaaccta ttaatccttc aacctcttta    237540
     acatttcgat ttgcaattgg gctcccaacc aagatgtcgt cttgtcctga ataacgagaa    237600
     aggaagcttt gatacgctgc catcaatgtc ataaataaag tggatccttc ttgcagactt    237660
     aaacctttga gcttttcctg tagggaattc gccaccatta aggactgact cgcaccacgg    237720
     tgggtttgaa ccgcaggtcg aggacgatcc atcggtaatt gtaaaaccgg tagctcccca    237780
     gacaattctt ccttccaata ttggaggtgc tgatccaaat tctcttcttt ttgccattcc    237840
     ttctgccaca tgacaaagtc tgcatattga atagataact cctttaattc cggcggtttt    237900
     tcgcttagtg ctccttcata aaaagccatc cattcttcaa gtaagattcc cattgaccac    237960
     ccatctgaaa taatatgatg catcgtacaa aggagaaccc attcttccct gtccactttc    238020
     aatattcgtg ttcgaatcag aggaccttgc ccaaaatgaa atgtttcctc cgcttcgttt    238080
     tgaatgagcc gtttcatttc ccttttccta tcttccaaag aaaggtctgt tagatctgtt    238140
     tgagggatat gtctgaatac atgagattga acctgttgaa aaggttcacc ctcttgttct    238200
     agaattatcg tccgtaatga ttcatgacgt tccaacaact gattccatcc ggcctccaat    238260
     gcttcaattg accactttcc tgttaagcga cacgctgcat gaatattgta catcgcatta    238320
     tttggcatta attggtcaat aaaccatagg cgtttctgtg cataggaaag tggaatagat    238380
     tcttctcgtg tcataggtac aaggggtgga acctctcgct ttttatcttc tttgcgcaac    238440
     tgatctactc gttccgctaa tgattccact gtatcgtgct tgaacagttc acgtagcggg    238500
     attttaatct ggaacaattc ttgtaatcga gagacgattt gagtagcgag cagtgagtgt    238560
     ccaccctgtt caaagaagga atcctgaata ccgatatttt ctattcctaa cacttgactc    238620
     caaacagagg caataagctc ttccgttggt gtccgaggta gaacattaaa atctcccata    238680
     ggttgctcat caggtgctgg caaagctttt cgatcaattt ttccattcgg agtaagcgga    238740
     aactgttcta actctacaag gtgcgctgga atcatgtgat tcggcaattg attttgtaga    238800
     tactctcgcc acttttgagt atttccgtcg cttattacat atgcaaccaa tcgctgatca    238860
     cccgggcgat cttccctaac taatacgaca gcctctttaa taaacgaata cttttctaaa    238920
     gtcgcttcaa tttctccaag ttcaatccga aaaccacgca tttttacttg atggtccatt    238980
     ctccctataa attctaaatt cccatcagtt agatatctta ctgaatctcc tgttcgatat    239040
     agttgttctc ccaatcgaaa tggatgcgaa acgaattttt cggcagtgag attcggacga    239100
     tttaagtatc cacgagctaa accggcacca ccaatatata actcaccctc tatccctatt    239160
     gattgtaagc gttgattttg gtctaataca tataattgcg tgttctgtat cggctgccca    239220
     atagaaacaa attcttgatt aggttgaatg tcaaatgcat ttacataaat agtggcttca    239280
     gttggtccat aaaaattagt taattttact tgtccgctat gattccattg ctgttgaaat    239340
     cgtctaacca accctgaact tagttcttcc ccaccagaaa atacatgacg catggacgaa    239400
     caattcatgt tcaattcaat atgattgagg tgatctaaga aaacagataa catcgaagga    239460
     acaaattgaa caatagtaac ctgatgtttt tcaatcactt cagctataat ggtaggatcc    239520
     ttttctccac ctggaggcaa gaaagatata cttgctccaa catgaatacc ccaaaataac    239580
     tcccaaacag atacatcaaa tgaaaatggt gttttctgca agaccacatc cttttcagaa    239640
     agtggatatt tatgttgcat ccattctagg taattgatta ctgaatgatg ctcaatcatc    239700
     actccctttg gattacctgt agatcctgaa gtatacataa catacgctaa acttctccct    239760
     gttacaccac ttatacatgg gattgattct tcttttttaa ttgcagtata atctttattc    239820
     atacaaatcg tttcaacatc ttcagatata tataaatttt ccgaattttc ttccgtcact    239880
     agtacttcaa ttccagcatc ctctaatata taacgaagcc gactctctgg ataagtagga    239940
     tcaagtggaa catatgcccc tcctgatttt agaataccta ataacgctat catcatttgt    240000
     aatgaacgtt ccatatatac tccgacaaga gactctggac ctacactacg cttttgtaaa    240060
     taatgtgcta gctgattagc acgctcatcc aactctctat aggtgatttg ttcattttcg    240120
     taaatagctg cgattgctcc tggcgttttc ttaacttgct cctcaaatgc cgtatgaatc    240180
     atgccttcag ctgaatattt tacttgagta ttattccatt cctctagtaa ctgtgtctgc    240240
     tcttccattg ttaaatgagt aatttcggag agctttgaat ctaggctctt tgtcatctga    240300
     attaatgttt gcaataagtg accctggatt cgatttattg tttcttcatt aaaatagctc    240360
     cggtcataca tcaactttaa agtaatttcc ttaccaggca ttacaatgag tgttaaagga    240420
     taatttgttt gttccgcact tttaacatct agtaatctta aatcatcatt tctctcacct    240480
     tgaattggat aattttcaaa cacatacaag gtatgaaata aggagctatt ccgcggaacc    240540
     tcactccacc cttgaatatc aaccaacgag ttatattcat attgtcttcg ttccatttct    240600
     ttcatctgta ttttacgaag ccaatctact actaatgtat cattcgttaa tcgaattcta    240660
     gtaggtaatg tgttaataaa tagacctacc atattctctg ctcctatcaa atcagtagga    240720
     cgtccagagc tagttacgcc aaatacgatg tcactttcac cgctatacct actcatcaaa    240780
     taggcccatg cgccttgtac taacgtattc aatgttaatc gactatttcg tatccactct    240840
     tgtaaattct cagtgagttc ctcagatacc tgataaacac actctccata gcccttctcc    240900
     tgttcttgat cttttctttc catcgctaat ggcgtaggtg cataaaaccc ctttaattct    240960
     tctgtccaaa attcctctgc ttgactttga tcttgtttat ttatccactg gatatatttt    241020
     ttataaggaa gaggtttagg aaaattcaac aattctccct ttatcatctt gagataaact    241080
     tccatcactt cactaaagac caatgacaca ctccacccat ctagcaaaat atgatgatgt    241140
     gtccaaatga ttctcgtttc ctcttctgct tctttaatcg cagtgactct catcaccggt    241200
     gcttcatcca ataaaaatcc ttttctacga tctgcagtca aaaactggtg taatttcttc    241260
     tccctctcct catgcgaatg ggcactccaa tcctcttgat gaatagtaaa aggaagacgt    241320
     tggtaaactg cttgcagagg tttttctact tcctcccaca caaatactga gcgtagaact    241380
     tcatgtcgat gaataacata ttcccaagcc ttttcaaaag tagcaacatc caattgcccc    241440
     ccgagcaaga agcctacttg tacaatgtag gaaaaagaat gttcatcatc ttgatcgtat    241500
     aaagtatgaa acaatattcc tttttgcaaa ggtgataatc catatatatc tataacgtct    241560
     cccatcttta caccctcttc tttgttaatt taagtaatac tttgctcaag ctttcttccg    241620
     taagatcctc agcatcagca aaatctgata ctgtaaaagc tgactctgtt gttggtttat    241680
     ttataagttg acgaagatgc ctcaacatac catctgctat cgcttgaatt tttaatctag    241740
     aaaactgttc tctactatac atccaaacaa aatgtaactt cttatctttt accataccga    241800
     taacatcaat tagatgcgat ggcttggaat ctggagcatg atctaaaaat gtaaaccctg    241860
     tctcttgcat aaacaaagat tcctttgaaa acacttgatc aaattggccc aaatagttaa    241920
     agcttattga aggcttttgc tgataaaacg gaagtaattc ttttttcaag taacgtaaaa    241980
     taccataatc aactccacga ttcggaattt gacgcaattg atcttttaca gcctttaatc    242040
     cttcaatagg tgttttagtt ccttgaaaat tcagatgaac aggataaata ctcgtgaacc    242100
     agcccactgt ccgtgataga tcaatacctt caaccatctc ttctctcccg tgtccttcta    242160
     gatgaataga aaccgtttgc tcatttgtaa aatcgacgat agcttgtcct aatgccgcca    242220
     atagtacctc attaatcctt gtcttatgag tcactggaac ttcttgtaac aatgcatgtg    242280
     tttcttctac tcctaaagtc ctcgtcactt gatcaatcga ttcttctgtt gtttcttgca    242340
     ttggatagtc cattggaatt ttcatcgttt ctttttctac ccgttcattc caataatctt    242400
     gtacttcttt tgaaataccc gaatcactgt atgcctgcag gcgttccgac cactctttaa    242460
     aagatgtact tttcgcaggt aggcgaactc cttgaccttg tttcatctgg ttatataccg    242520
     cctgtaaatc ttccaataga attctccacg atactccatc tactactaaa tgatgaatca    242580
     cccagaatat tcgatcattt ccagacaagg tgtcctcaaa gtaaactact ctcattaacg    242640
     gacctgtaac taaattgaaa ctagtttgag taatgttcat ctcttcttgt attactttat    242700
     tccacgcttg ttcattagct ttgttccgtt ttaccacatg aagtacagaa tgctcatcag    242760
     tcccttcatt tctctgcctc cacgttccat ttggtaactg ttcgtaccgg aaacgtaaag    242820
     catcatgatg ttttagtaag tttaagatcg ctccttctag taacttcacg tccaatctct    242880
     cttttactct taaaagcatc gattgattcc aatgctccgg acgtgaatgt tcttgctcga    242940
     agaaccagta ctgaattgga gtaaggggca cttctcctgt cacaattccc tgctctgctt    243000
     gtactccctg agtttctata gccacttgtg ccaactcggc aatggttggg cattcaaaca    243060
     tttgctttgg agtaagtttt aatccctctt gacttgcttg aaatatgatt tgaatactga    243120
     gaattgagtc gccaccaatt tcaaagaaat tatcatggat tcctaccttt ttaacaccta    243180
     atacttgctt ccagatggta gccagtatct tttcgttact attccgaggg gcaacagctt    243240
     cactgttagt ctgctcttcc tccggcatag gtaagacctc acgatcaact ttaccgttag    243300
     ctgttagtgg aatggcttcc atcgtcacaa atctcgaagg gaccatatag ctcggtagtt    243360
     tcgttttaag atactctcgc cacgcaccta catttccatc tcctacaaca tatgctacta    243420
     atcgtttgtc acccggttga tcttctctaa caattacaac agcctctttt atagatgcat    243480
     atgcatttat agtagactca atctccccaa tctcaattcg gaaaccacgt attttgacct    243540
     gatgatcaat tcttccacga taatccagat tcccatccgg caaatacctt gctaagtctc    243600
     ctgtccgata taatcttgct ttcggatcac tactaaatgg atgaggtata aagcgctctg    243660
     cagttaattc aggtcgattt aaatacccac gtgcaagccc tgccccgcca atataaagct    243720
     caccctctac acctataggt acaggttgtt gataagcatc tagtatatac acttctaaat    243780
     ctggaatccg ctttccgata ttacttcttg aagcatgccg cacatcatct tgagtaattg    243840
     gataatatgt aacatgaacg gtagtttctg taattccata catattaatt agctgcggtt    243900
     ctttctcccc atatctttga aaccacggta acaagctaat aggttctaac gcttccccac    243960
     caaatattac ataacgtaga ttcaagtttt tattctcatc ttcttgttca cacacctgta    244020
     ttaactgtcg aaatgcggaa ggtgtttgat ttagaactga gacttcttcc tccaccaata    244080
     attgataaaa atctttgggc gatcgactaa tcaagtacgg aacaacaact aatttcccac    244140
     catataataa tgctccccaa atttcccata ctgagaaatc aaatgcataa gaatgaaaaa    244200
     gcgtccaagt gtctttttca ttaaactgat accaacaatc cgtcgattta aataaacgaa    244260
     tgacattgtg atgctctatc ataacgccct ttggattccc tgttgatccc gaagtataga    244320
     ttacgtaagc taggttttga gaacttacat cagaaaacgg caaggtctta ctttcttgcc    244380
     caatctcatc tctatcacga tccaggcaaa tcgatttaat attttctggt aaccatttca    244440
     attcttttaa actttcttgc gttacgaata actgaatgcc agcatcctct aaaatatatt    244500
     gaagtcgctg ctctggatat gttggatcaa gtggaacata ggctccacca gccttcaaaa    244560
     tccctaaaat acctacaatc atttctagag aacgttcaac gcacagccca actaaagtat    244620
     caggtcctac tccttttttt tgcagataat gagctaactg atttgcatgt tcatttagct    244680
     ccctataagt aacttttcct ttttcatacg taactgcaat agaatttgga taaatcatcg    244740
     cttgctgttc gaacaattca tgaatagtta cttgaggtgg aaaatcaagc ttaggattgt    244800
     tgaactctac taaacttttt cttttatctt cttctgaaat aatttcaatc tcagaaacct    244860
     tttgctttgg gtttttaaat gtattttcta ttactgctaa catggtttta aaaaagcggt    244920
     ttatctcttc tttagaaaat agctctttac gatagtcaat atgtacttgt aaagagtcta    244980
     tatcagtcaa attctcaata tgtactgcaa aatcttgcat ttcttcacca tttggaatcc    245040
     aaagtgagtc accactttca tcacgatctc tataatcaat cgtagttccg aaaagtctaa    245100
     cattgctgtt attctcttta ttaatctgct ttaataacaa atcaaatggg tatttctgat    245160
     gtcgtaatga tttactttgt tttctggaca ccctaccaat aaatgaaagt acttcttctt    245220
     ctggatcgat atccattctt agaggaaccg tactcaccat cattccaatt aattcccgtt    245280
     ccgttttagt catacgattg ccataagcca ttcctaatgc aatatcaagc gatgaggtcc    245340
     accgacacat agacaatgag aaagcagcaa caaaaagaga atatacactt aatttataat    245400
     cgtcagaaaa taactctatc tttctcttca aatgctccga taatataaac gtttcacgtg    245460
     atgctttggt actaacttgg tacgtattat aaggcttcaa tcccgtcaca gatggaattg    245520
     ttttaaattc ctctaaccag aatttttgat ctttttgaaa gcgaatacta ttcaagtatg    245580
     tttgttcatt ggccagaaat tgaacatatg aatttctaat ttcgccttcc tcagtctcgt    245640
     tatgcatctc ataataatat tttgcaatct gactggtaaa tatttggatt gataaaccat    245700
     ccatgataat atgatgaaca ttcccaaaga ctgcacattc attatcgttt aattttatta    245760
     aagcgaaata gtataaatcc gaattaaata atgtaaacgt ttcttttgtt ttctgctcga    245820
     tccatttctc aagcaaatct gaatcctcca cggaactgaa atcgaaaaac tcaaattctt    245880
     gttcttcatg tttaataaaa tattgttcag gttcctgatg cccattttct tttaatctga    245940
     tgcaaagacc atcattttca ctaataacac gattcacaac tcgatttaat tttgaatagt    246000
     ccatttttct atgaagttta aacaaaaacc ttaaattaca tatcccttta ccggaatgaa    246060
     taacttctgt ataccatatt ctcctctgtg gatgacttaa cggataacat tcttcattgg    246120
     ccataaaaaa tcttcccttc aaaaattatt tactcttata ggttcttgct tatgtttaac    246180
     ccatatatat ttctgtagtg aaaccccaat tactccaatg atgatgagcc caatacccac    246240
     ataaaaatag agttcaatta ctccgaaaaa gtgaaccagt ggaccgctca tagcaggaga    246300
     aataatgagg actgcatttg ctaaactgct ttgaatccca aatactcttc cgacctgttc    246360
     ttgatgagat tctatttgta gaatgacttg attggataca agcataagtc cacttccaat    246420
     accagctata aaactaatca gataggcaaa aatgagggat gcaccaggat ttatcagagt    246480
     tatcagacta atgcccccaa agccaattcc cattaaagca atacctccac atattaccca    246540
     accatattga aaatgtttta atttctgagt taagaatgcg ccaattattc ccccaagacc    246600
     aataatagaa atgatgtatc ccattttact cttatcattt gggaacaagc ttttaaataa    246660
     agtagggaac tgtgagtcta ctaattgtaa tactgccata gctattgtaa agaaaatcat    246720
     ggttgataat atcatccgat tggataatac ataaccccag ccttgtaacc aagcagtcca    246780
     agtactttgc tgtttctttt ctatatgttc tcttgacaga gattcctgta accttattgt    246840
     gggcaacaga accaaagcag ctagtaagca gcatattgcc cttataatca gacaaaactc    246900
     tggctgaaac cagctcagta acattcctcc tataagtggg cccagtatct tggttccttg    246960
     ctcaactatc ccattgatac ttaccgcttt ggtaagcaga tcaggagaaa caatctgtcg    247020
     tgttagtgtt tgctgtgcag gataataaaa aacggtgaaa atggaacgaa tcattaatgc    247080
     taacaaaagc caatgaatag tttggacaaa taaaagaaca attgttaata aaccaaccat    247140
     tagattacaa aacatcataa ttggaatttt tctaaagcga tcagcaatca cgcctgccca    247200
     tgaactaaat ataatcccag gaagtgcata cgcaacggga attaatccaa tcatggtggg    247260
     gtctacttcc cattcaaaac taacaatggt cataatggct aacatgtcaa taaatactcc    247320
     gagcataagc agtgaatacg cagagaaaac ttgtaaataa attgtatttc cccatagact    247380
     ttttgattcg gtagttttca taaaaacgag ctccttaagt ttactaaata gggacgatag    247440
     aaactaattg agtgggatac gagacttctc ccgcctcttc aatcccattc tttttttgca    247500
     gttcgtttgt gatggtaatg aaatcaataa cttgcttaga cttcctcaaa gacactaacg    247560
     ctctaaaaat gagatattga ctaacaatta aatcataaca ctcctattaa tgggattatt    247620
     ttctaaaaat aatatagaaa acaatgaata ttccgattat tgttttctga aaaccagaaa    247680
     tatttctata aaacaactaa attaagattg aatcgtatcg cagattttaa cgggttctgg    247740
     tgcaataaat ctacaaatct tggacatact gatactacta atctaaagaa ggtgcgtgat    247800
     cggtatggaa aaggaaaatt tatacaaatg gaaacattat cagcctgata ttattttgtt    247860
     aacggtaaga tggtacctac ggtacaacct cagttttcgt gatttagtgg aaatgatgga    247920
     ggaacggggc ttatccattt ctcatacaac gattatgcgt tgggttcatc agtacggtcc    247980
     tgaattggac aaacgaatcc gacgtcacct taaacaaaca aatgactcct ggagagtcga    248040
     tgaaacatat atcaaagtaa aaggtcaatg gatgtacctg tatcgtgctg ttgattcaaa    248100
     aggaaataca atcgattttt acctaagcaa aacaagagat cagaaggctg caaagcactt    248160
     tttcaagaag gccttgcagt cttttcatgt ttcaaaacct cgtgttataa cagtcgataa    248220
     aaatccagct tatcccattg caattgaaca gttgaaaaaa gaaaaaagca tacctggtgg    248280
     tatgctactt agacaacaaa agtacttgaa taacatagta gaacaagatc atcgttttat    248340
     aaagaagcga attcgttcta tgctagggtt caaatgtttt gacacagcta catccattct    248400
     ttctggagta gaagtcatgc atatgattaa aaaagaacag gttgatttac gggaccagtc    248460
     tgtccaaaat caaaaagaat tcatccatca attgtttggg cttgcggcat aagatatgat    248520
     ttcgttagga atctatgcgc tttattatct tttattctat ttttgcacca gaaccgtcta    248580
     tgagtataat cgatttaaaa aacaaaagaa agctgtataa tttttgaaaa tgatacctac    248640
     ttaggcttat ttggcatgct catttttaag aacaaaaagt attttaagag tttttcgttc    248700
     atatgaacga aatttcattt tgtctccgtt cttaagttat gtggcatgtc atcaggcccc    248760
     tatgtcagtg gattccataa tgccaaagcg aatatccaat tcgggtcacc atttccttga    248820
     tggttttgaa cagcttcata tattttccct tgatgttcta ctttatctcc ctttgtataa    248880
     gccttcttcg gatcccattt ttcataagat tcattttgat tttttgtttt taccggaaga    248940
     atgtcacttt gaattgatgt atttccagct gcatctacag ccttcactgc atatttatat    249000
     tccttattaa ctgttagatt ttgatcagta aacgtcgttc cttgtaccgt ttgaatcaat    249060
     tgtccatcgc gtaatacctg atattctttt acacctacat tatctgtaga aggattccat    249120
     tttagctcta tactgttaga agtaacgttg cttgcatata atccttgtgg ctgtgtcgga    249180
     gcttctgtat ctggtttcgg attaacaatg ttgtctactt tcttcaatcc ctcttttgta    249240
     atctcataaa ctgctttatt cccaaagctt tcctgaatgt tcttttccat atttgtaata    249300
     gtagctcggt tcgcaccttc taaatgtgta aattcaataa aatcgcctac ttttaccggc    249360
     actttaacct gctcagcatt ttgttgctta tttccataaa tctctttgtt atataccact    249420
     ttacctgatg tgttttgcac tttaatactt gcatatgtac tatcaaagta gttatgtggt    249480
     acacctgctt ttagagcaat ttgtatctct tctattgatc tatttaaatt tacttttgcg    249540
     aattcaaaat ctccaatccc tttcagcgac catgcaaatt cgttaccttc aaaaatgttt    249600
     ggagattgat ttttgatttg tacctttttc tcaacagttt gatcaaataa atccgttaat    249660
     acaatctttg cataagcatt tgttggtaat gatatagatt gactgattcc attttgataa    249720
     gatttaatat catcaattac gttaataggt tggcccgtca tattttcatt gttataaatt    249780
     tcaattttcc ccttaaattg cggtgtacta ttttctttta gtttccaaga tacatttaat    249840
     ttttcatttt cataatatat ggattggata tcaaaatcta gttttcctat ttcaggttga    249900
     gtaggttgat ttagcgtgaa tatttttcct gatccaatgg tagactgcgt attacctcct    249960
     gctttgaccc atacatattc tgaagtagct cctccatcat attgataagt attatcatgc    250020
     gtcccagaaa tattttgatt attccaagaa ctccattgtt tatctactaa ctttcggcta    250080
     taaccatttt ttaggcgagc ttcccgaaca ttctgtccac tatccgccca gtcttcctga    250140
     aacattccta atccatgatt aaatgccaca ttagctaccg gaaagtccat aattgcaatt    250200
     agatgccatt tattctttgt tacatctttc atccattgtc caaatttagt atgaccatct    250260
     tcttgccatg aacgcattgt cattctgtac caattgtagt ctttccaacc ataagttgtt    250320
     tgaaccttca gtcctgttcc ttctcctcca aagagtccag cttgtgaatt cggagataag    250380
     tattcggcct ttattgcttc tttagaggaa attggatccc atatggcaaa atgtaaagta    250440
     cgttttccat tttcatcaaa cccactttgt tgttgaaaac cagcatatcc tccagcttca    250500
     ccacctgcat tccagttgtg tacagcccaa tacgtataag gtgcagtctg aactggtgac    250560
     cagtctatac taataatatc tgaggcaggt atattttgag gactcacata aactgctgga    250620
     gcagctgaat gtgtttcggc tttagtgtgc gaaatagacg ttccaaacat agaaaacatg    250680
     ctacatgctg cggtaattat aataacttta ttaaaacttc tcctagtttt ctgaataatc    250740
     actattctac ttccttttct aatttttatt attgaataat aacttagtag agaaatctat    250800
     caaaattcaa gcaacatcca gtaattcttt aaaatactgc cccaatttat gttgttctat    250860
     attcacatct gattcttaca tattacttga ttgtaattgg tttccataac gataatgcaa    250920
     atatccaatt ctggtcacca tttccttgat gattttgaac agcttcatac actctccctt    250980
     gatgttctac tttgtcaccc tttgtatatg ccttcttcgg atcccatttt tcataagata    251040
     cattttgatc ttttgttttt accggaagaa tgttactttg aatcgatgta tttccagctg    251100
     catctacagc ctttactgtg tatttatatt ccttattaac tgttagattt tgatcagtaa    251160
     acgtcgttcc ttttaccgtt tgaatcaatt gtccatcgcg taatacctga tattctttta    251220
     cacctacatt atctgtagaa ggattccatt ttagctctac actgttagaa gtaacgttgc    251280
     ttgcatataa tccttgtggc tgtgtcggag cttctgtatc tggttttgga ttaacaattt    251340
     tatctacttt cttcaatccc tcttttgtaa tctcatagac tgctttattc ccaaaggttt    251400
     cctgaatgtt cttttccata tttgtaatag tagctcggtt cgcaccttct aaatgtgtga    251460
     attcgataaa atcacctact tttaccggca ctttaacctg ctcagcattt tgttgcttat    251520
     ttccataaat ctctttgtta tataccactt tacctgatgt gttttgcact ttaatacttg    251580
     catatgtact atcaaagtag ttatgtggta cacctgcttt tagagcaatt tgcatttctt    251640
     ctgttgattt atttaaattt actttcgcaa attcaaaatc tccaatccct ttcagtgacc    251700
     atgcaaactg gtttccttct aaaatattcg aaaaattcgg tgtatctggt ttaaccggat    251760
     tagaatctgt acttttccaa atttcagccg ttaaatttgg ataccctagt gccgctactt    251820
     tttggattgt atcattattt gggcgtaatc cccatttctc aaaaaacgga attaaatttt    251880
     gttttgcaac ctttgatgat gaaatcataa ataattgttt tttcgtttca tcagtttgtg    251940
     gaatctcatt taaaggcatg tctctataca gctgatgcaa cttaggatag aagtcttctc    252000
     catacgctag ttgtaattgc caaagcataa cgagtttaac aaaagcatca ctaatctcgt    252060
     cataattttt attagattgt tctaagtatt gaaacgcctt agtataagcg ccctcttgtt    252120
     gcaatctaaa aggttgatta gatgtaaatg ctttttccac agcaaggctg taaagattga    252180
     cttgtacctc tgtcatattt ttaaagttcc aaggtgcttg ttgtctcata tgccctgcct    252240
     catgccaagg tccccatcca tcatttgtaa atttattaat gtctaataca tgttggattg    252300
     catctcctac atatgcagtt ctgtgaggat atgcatacat ataataatcc agagaatggt    252360
     tatcctccac ataatgcaga taatgtttat caacttgttc ttcagataat ccagatattt    252420
     tatcttgaat tctagtagcc tcatccattt tttttaagag ttgtacagga tctgtgttag    252480
     aacctatcaa atacttttta acacgagctg ggctagcagt aatcaataca cgctcccctt    252540
     ttaattccac cgcatgtgca tttggatatt gattgagcat atttattaaa tcttgtttcg    252600
     tatgctttcc aagttcaaag agaggagtag ccgctccgcc tgttgttact gttgtttgaa    252660
     tggtaccacc ttgttgttta ttataaaaat aaatcattcc tccatttgga gattgaattg    252720
     tgtttgtgcc tggatttaaa gtaaatgatt taattttgga atcttccctc caagaagcat    252780
     cgaacgagaa agttccaata tatgcttgta tactttgatt tccttgtacc tgaattatta    252840
     tttgttcatt tggcttagca tataaccctg ttggctcgta tgcactaaaa tttctttccc    252900
     ttctttcaat attttgaagt tgggagacat ctccttttcc tggaactaca aatacacgat    252960
     tttccacatt aacagaattt tcattctgta ataacgttgt agatactttc ttttgctgtg    253020
     cttgttcttc cgcaaagact tctaatgaag gcgttactcc agtggcaaac atagataatg    253080
     tggcagttat catcactaaa ttttttgttt tttgtttttg aacccttttc ataatatccc    253140
     ccgctatatt tctagatatt tatattaact atttacacat ttttacacaa tttaacatga    253200
     atatacttac ttatatgaga taatggacct atttcaattc acttgatacg aagaataatc    253260
     aaatgaatgt aggataaaag gaaagatttt aatacgttta ttctaaataa atacataaaa    253320
     tatataaaaa tgtcgaaata ttgacatttt atattctcgt gtaaaaattt ccagatagtt    253380
     gtaactaatc accttaactc ggatatacca gcactttaaa aagaacatga taatccttga    253440
     ttttattgga atataagtaa taccacctgt ttgtaaaggt ggattttatt aatttataaa    253500
     cgtttacttt taatgaatac ctttataaac gaaagtggta taattatggt aacaaatata    253560
     aggggaatac caaaattggc taatatttat ggatatatac gtgtaagtac aaaagatcaa    253620
     aatgaacaac gtcaattaca taagatgatg gaacgagggg tggaaggtcg acgtattttt    253680
     gtcgacaaag caagtagacg acattttgat cgtcctcagt atcaattatt acgaaaaata    253740
     ttgagtacag gtgatattgt tgttttagaa aatgaaacgc tgtttgatag tcgtaagttc    253800
     cgtgaaatgg gtgatatggg acgattaatg gaagatcaat ttttatcttt gttgtcttat    253860
     gttgcagatc aagaacgaaa aaaaattcat cagagacaag cggaagggat tgcgatagct    253920
     aaatctcaag gaaaacattt aggccgtcct ccagtgaacc tttcgacctt aagcaaacaa    253980
     caaataaaga taatagaaaa aactcattca aaatggaaga gtggcgaaat tactgctgtt    254040
     atgtttatgg aaatgttaga actaaggaaa aacacgtttt ataaaataat gaaggaatat    254100
     gaagaaggaa agtagcatcg ctcctataat aaatgctact tttcccctag ttgtaagaac    254160
     gctggtacta ccccatcgct atcaagctaa gaaatgtaaa tacccccaaa acgagaaaat    254220
     tcacatttta ttgtattggg aagtttttcg acaaaataac atcaaaaacc tctcgatatt    254280
     tgattgtccc caaaataatc ggttttggga tactaattta caatagttca aaaggtctat    254340
     gtatttatga agtactgcaa aatgttatct cgaacttttt gacacattgt ttttcataga    254400
     aatcacacca caacaaaagg tgtacctttt gggacaaaaa aatagaatcc ttatgataag    254460
     gattctgcaa caagaaagaa caaacatata ataataaaaa gaattactta tattataatt    254520
     tgataataaa actaaaatat tgagaaaatt gagaatggat tgaatgtcac tacacgctta    254580
     attataattg attaggagtt ggagtagtaa tctgtcatct gttccttttt taaagaagat    254640
     tgatctcaat cttctttttt ttggtgtctt ttcctcttcc ctcgaaaaag gaaaaagaat    254700
     tacttaagaa ttgtggaaat tgcttgcttg tagactagtt gttgcttacc atgaaccatc    254760
     ataagaacag taaatttatc cgttgtaagg atctgcccac gtatgggaac cccattcttt    254820
     aaaaatatag tgatatcccc ttttttctct tttaattgtt catacatatc ttcttgtaag    254880
     ttatacatga aatgcgcccc ctatttttat ctgcttttct tttaatactt gctactatac    254940
     aacaatagta tcacatttaa atttaaatac cgctctaggt acatatttcg caagaaatct    255000
     atcaaatgta gttaaataaa aaagattgat cgtataaaac aaagtttgat tatttaaaat    255060
     aaagatcgat taaaaatcct gtgttaatat gcaggatttc ttcttgtttc acaaacgggc    255120
     cagattgttg aagaaaaccc gtttatgcta taaactacat ggaatactaa tcataaaata    255180
     ctttaaaaag tggggatatc aatggttgta aagaataaag aggattttaa tggcttaaaa    255240
     gtaattggtg aaatctgtgg ggcgattcga gatgaattag tccatagtac gaaacctgga    255300
     attaccacaa aagaactcga tgaaattgcg agagagatgt ttgaaaaagc aggagctcaa    255360
     tctgccccaa aaggagaata caattttcct ggatatacgt gcattagcat aaataaagaa    255420
     gtagcgcacg ggattccgaa gaggacacgg accattcaag aaggggacct agtaaatatt    255480
     gatgtttcag gttcaaaaaa cgggtatttc gcagataccg gaatttcctt tgtagtaggg    255540
     gaaggagagc caactttaca gaaaatatgt gacgtagcta aagaagcatt ctatgctgga    255600
     cttaagaagg caaagccagg ttcaaaaaaa agcgcactcg gaaaagctgc acacaatgta    255660
     gcgaaacagc atggcttaac agtcataaaa aatcttactg gacatggtgt tgggcgctcg    255720
     attcatgaag aaccaaaaca tattttcaat tactttgccc catgggatga cgaaatttta    255780
     aaagatggta tggtaattgc ctttgagcct atgatctcta catttgaaga ggaagttttc    255840
     caatccgaag atggatggac ctgcctaacc gatgaaagct ttgtggctca atacgaacat    255900
     acggttattc ttaccaagga aggaccgatt attacgacat tgtaagagca ctaacaccat    255960
     aatcgggtgc ttcagcgttg aagaagggta gttaaaataa tcaaactttc ttataaaaat    256020
     tttatacgag atttttaaag gtaactccat tttgatcaat ctttgttcaa aatggagttt    256080
     ttatatttgc tgaaaataag gggtcacggt aagctatttt aatcaaactt tattttaaag    256140
     ctacatcaaa aatataaata aaatgtccat tttacatgaa gtagtacccc taaaaagtaa    256200
     aactaagttc atgttttttt ataattagta aaatagacag ttaaatattc atataaaaac    256260
     cctgttatat cagtacatac acatgataca acggggtttt atgggtttaa cattttctta    256320
     gttttgtaaa actcatttta tcgtcttcat atgtaatact ttcgcaaaag tataccttta    256380
     cgaacaaaac aaaagaagaa tccaacttgg attcttcttt tgttttgttc gtttagctga    256440
     ttaggcggta atctactttt ataataatag taatcagcct caagaaatgt taattgcgtt    256500
     tttatagaag ttttcagctt catcacgaat tgctttccaa tcttcaaagg ccaattcaag    256560
     ttctaaagca gcaatgaact cctctaaatt ttcgatatca tcaatattat ctgccagttc    256620
     ttttaaatca taagatatag cgctccatat cctatggact tttcgaataa cagggaacac    256680
     gaactcttta gactgaacca aattcatgac tggagctact aaatagacaa ctgtgttttg    256740
     tgcgacaacg aaatcatttg agtcatgcag tgataaatat gacatccgat gcgaccacgt    256800
     ttgtactgtt tcttcgtatt tttgaatttc cgaataaaat tcggagagag atgttgccat    256860
     agattgtgac tgttgataat atgtctgtgc gtgattagat aaatctttac atatatttat    256920
     gaatttagat ttagtatttg gagttaattt accattttga gcttcaaata ttacttgatt    256980
     aagatcatta taatatttaa tagagattaa atctgcaaag gctacaatgt tttgagaaag    257040
     gattagtatg tctttatgtc ctccattgtc ccagaaccta catttttctc taacgtttaa    257100
     cttagttgca attgcttctt caactaattc acgaaaaata gaagttgtta tgagtctatc    257160
     ccaattattt tttactttcc cgtcgagtat gagatacatt ctttccctga cttgatcgat    257220
     actagttggt gctgagatcc atctgttcaa ataatgagcg aatgaacgcc attcttctat    257280
     tgtaagaaga aaaggagaac ttttccctcc taattcacgt ggagaaaagg ctaaatggtt    257340
     catatgaaca cccctctaga tgatttttag ttgtatttac ttattctttt ttagaaagat    257400
     tccattaaac catttaaaac aggattatgt ttcttgtaat tagcaacaag agatcctgct    257460
     agttccattc ggatttttgt aaccttagaa agatctggcc catcctgtac tttaattgtc    257520
     caagttgtaa aaggatttgg aataaagtaa tcataagcaa attcctctgc tatcgtgcca    257580
     tcagtaataa tcgttgcacc tacatagcta aaacctcgat taaagggctc tgtattaaat    257640
     tgaaactttt tatttttata atcatcataa taatgtcccg aattcgtaat ccgtatttgt    257700
     actttagaag tagcgtcaac tccatctaac caaattcgca ttaatttaag tcgaacacgg    257760
     tactcgtttt caaaaaatga atcatttagg ttgatttccc aagaagcttc tcttgtctcc    257820
     ttcagggttt tcaaagcatt agaatctgta atctctattg ttcgattttg aaatggttga    257880
     ggtggtggat taaactgttt taaggcctcc atacagtcct tttgtaatgt agcaacatcc    257940
     acttttaatt ctgatacatc ttttaaaata ttaggattta catctgaatc gcgaagagcc    258000
     caatacttat aagcatgttt ataatttgct aaagctacaa atagaatttg cttcatatct    258060
     aaatagcgtt gatataattt ttgttccatt tcttcgtttt cagattcttg cccttcaaga    258120
     ttcttaatat actctttcaa tctcgcaaga tctgcttgat gaatatgttt ttctagcaac    258180
     agacgaaata gctcttgact acagcgaatg ataataactt gattcgaagc aagtgtttga    258240
     ccatagacag ctagaatatc taatgatagt agatactctc tagccccctc aacttctttc    258300
     ttaatagcat cttctaaagc agcggctatt ttcaactgaa atattttcca cgttgcctct    258360
     ccagtcagat cctctttagg aagttcccac tcattttctt gaattttttt taagagttct    258420
     tctgagaaat ccatatccgt agatgctttt gatatctctg cagctagtgc atatatttta    258480
     ttaattaatt caactaattc attaagtttc tccatacatt cttttaatga ttgcgctaat    258540
     gcagctagtt gacctccagc ttctattact tcttttaaac tgttaattat atcgataatt    258600
     tctccaggtg ctgcagtccc tcctgtagca attatcgatc ctatagattc tgcaaaattg    258660
     agaacagcgg tcaacatttt aaaagccatt ttcatttgtt gttcataatg atacttttta    258720
     agcccatact cgaaatcaat tttagctatt gttacaacat gttgctgttt ttcgaattga    258780
     tacaaagatg attcaacagc attttgagca cttcttagat tatcttttgc ttgattaatt    258840
     agtgtttctt taaataacag tgtatcttgt tcatgctgga gcataagagt agctgctgct    258900
     tttcgatctg caattgctag gtttctatct aagtaacggt gatattgttc ctcaaactgt    258960
     tgtgctgccg ccaagaaagc agcaatttca tccctataaa gatctttatc cagaagtgga    259020
     acaaacgtat tctcaccatg gttagcagtt aaaatggtaa gtaacgcagt gctttgtata    259080
     cacaatgaac ttaaatcttt atattgagct gtaaaagctt tcaaccagtt taactgatca    259140
     gctgcaatat ccggctgaga ttcataaaat agacaagcta cttggaaaac agacataaat    259200
     agttttggga attgaggtgt aggaactaca tacgtaattt cttctttggt gaatgtacca    259260
     tctttatcgg acaaacgtac gcctttattt ctcagttcta ttggatatgg cgatggggaa    259320
     ctttgattgt agataggaat agcatgtaac gttccagaaa gctcaagtcc ataaatcgtc    259380
     aattgtgcga gcttacttcc atctttgtaa tctagtcgaa tctctgcttt tccatctgat    259440
     tcaatttcca cacgtcttgt tcggatgact agttgcatat cttttaaagt acagttaaat    259500
     ttatcaggaa ttcgaacaac atctgcaaaa atcgaaatca tatttggcgc tagttgattt    259560
     tcctcaataa atttatatac ttcacccaaa tcaacaaata aactgcgaat ttcatatttt    259620
     gttttcgtag tacttgagta aaaagttcct gggatatgct gattattcaa caattcttca    259680
     tatagttttt tataatccac tttatgggct aacatgtatt tcccccatct acataaaatt    259740
     agggacaaaa gaagttaaat attacacaag cgagaattca atctctgttt ctttagctcc    259800
     ttttatccct atattaacgg ttaagttatt tgttatactc gctcatttgt tatacttacg    259860
     taataaagct tatttatttg agataacaca tagttatgtt ctagttgctc cggcctatta    259920
     atttctttca atgtccttat acttatgcaa tatattgatc aagtatatat cctacatctg    259980
     cattaattcg gaaatcatct gcttgtttac ctacttttac ccattgcata attgctaatt    260040
     caattccaag gtcggcaaat tccggatcat catgaatatc tttcattgta atagttgaaa    260100
     gtgttaaaag gtccttatga agagcagacc aaatcgcctt gattttatta attactggaa    260160
     gagcttcctc aatttgtttt tgggttttat cagttccaac atctgcctta tcgagtaaag    260220
     acattaaata aacatttcgc tgtatagttg cacatgttgc ttcgattttt tgtcttgtag    260280
     catcaacttt agcctttaac atttgcccat gcgtactgtc gagaattccc tttaatataa    260340
     aaccaaaaac aggaccaagt aataaagaca accaagattc cgattcgtaa tcttcgtaat    260400
     cttctatata tttctctaac tcttcccgca acttttttac ttccgctcta agttttattt    260460
     cttcttcgct attttttcca tacaatgcat catatttaac cttaacattt attaagtttt    260520
     tataatcatt tgttgtatca tcagcgaact gtttaacggt cttcgctaat gtttcagcat    260580
     ggtcactgaa agctttcgcc tctttcgcta atttttcgca aattttctga aacttttcta    260640
     aggccacagt atcaccttct aaaatatccg gtaagtaatc aagtaagggt gcatagaaaa    260700
     cttccgctct tcttgaataa ttaacaattt gattcgcaac atcaagaatt tctctatagg    260760
     tagtatcgtt ccagttttta caatgtcctt taatgcttgt attaaccgta tacagctctc    260820
     cgaagtctgg aagctccgct gtgttttcta acgctaaagc tttacgcatc tcattaacat    260880
     ttacaggtaa atatgcacca tcaccggtgt atttttgaat tctaatccat tcatcttttt    260940
     ttagtaaaaa aggattatcc tccttacctc caagatctct tgctgaaata tctcttttta    261000
     ccataacaat acaccctttc tattttataa aatgaaatga aattatatta ttgttcgcac    261060
     tccttctata gcaaaaaata tgtccaatat ttcgaacttc aaactgtaca tagtaaagta    261120
     gaatacaagt tcaacaatca atccatctct cccttaattt ggttattttg atacccactc    261180
     agtataattt acaaactcct aatctagaat tgagaaatat attttttagt gtaatttcta    261240
     gcgtgttccc ccaattttta agtggcatat attccgtatt agagaacact atattcagaa    261300
     tataagttat attagaagtc cgttttattt ttatatttaa gtggtatgtg aagcgaacag    261360
     ctaataggga gctcatctag aatttcacta aaaaaataac caaattacga ctgatccaat    261420
     ttaatgtatt ttcatattct tttattacct tatagaataa atttttcttc agttctacaa    261480
     tttctataaa cttcacttct ggtatttctc catttttgca cataggttga atatcatgag    261540
     gtgcggtttt tgattcataa ggttctatac ctctttatta gcagtgtttt gaatgtataa    261600
     tttctttgtt gattttgagg atatcaggac atttggtatg agttcaatga tttaagggta    261660
     tcaaatgtaa actaattggg taaaagttta cattcgggtt ttggatcatt tatagctaat    261720
     ttggtaataa atttctcaat atagatatag atgttaatta tggttttaaa attcgaaatt    261780
     aacaaaattt aaattataat aacaatatga tggttatctc ttttgtttac tccttgtact    261840
     aaagataaga tcgtgttcgc caatcttatc ttttttcttt gtagattttt tgatacaaaa    261900
     aaggaatcct tataatatta taaggattct acaacaggga ataacaaaat ataaacaata    261960
     aaaagatgtt tttgcccatc cccccgaaaa gagggtacat ccgagatacg tgtaaaaata    262020
     ggtcatagcc ttacttttat ttccaaatgc gatttattga gattatatgg ttgtttcatt    262080
     aaaaaagatt aatcaaaact catttagaat tctttgattg aagagataaa gcatcgcaac    262140
     tttattcaaa acttcgcgtc tttcttacaa acatcgtgac tctatttcaa gcgcacaaaa    262200
     agtttgatta aaattgaata tttttcaaat ccgtacttac tgccataatt ttgttgtaaa    262260
     caagaatacc tgggttaacg atttcatcat atttctcttt atgacgttga ttacattgtt    262320
     ctcgtgctct ctcaatggct tgatcatcgg aaatcgtcac cgtaccgtaa ccaaacgata    262380
     acggttcatc atcaacattg aattgacatc caagggtaag ttttgtgggt ggaattccac    262440
     cgtcaggaag cataccgaat tcaggtggtg ttattctaga cttgacgtta ttcaaaaatt    262500
     cattggcatt atgactaagc atttctgcat attctttagt tgatgtttca aatggtactt    262560
     tccagttatc aggattatga gtagccaatg tttttagaat aactagatgt aaactacaag    262620
     caagttctag tgcgccgatg gctatatccc ctagtctgta aaaacgttgt actagcctcg    262680
     aagcctctga ttgaatatct tcgattaatt ttatgttgtt tccgtttgaa cctgcgaagt    262740
     attttaattg ttctttaaca ttatcggtat cggccaaata ttctctgata aaagcctcat    262800
     cgatagcttt gttaatgtag ttacaaattt gttctactgc ttctttaaac aaatcacgag    262860
     tttggtcagc ttcttcctta ataaaaaggt gttttattaa agctactgca gcgaatcctg    262920
     cgactccact tatcacacca cctgtagctt ctactgctac ccattcccaa gaatatggtt    262980
     ctggagaaca tgaagaacat gttgaagttt ctggacacat tgtatcattc atccttttct    263040
     tttttttatc atatgctaaa tccctaaaat ttattttctt gataacataa acataatatt    263100
     ttcttaacaa atatgtctta gcgtacaggg ggtacagcaa cgattacttc ttttttgagt    263160
     cacttgacaa tttctatgtt ttttatggaa ttttactata ccgaatatga cttcggtata    263220
     gttatttaat gaaaaatcag tgattttctt aaccgaacac gtaatttctc attctaattt    263280
     cactttaccg aatacaaaaa aactataaaa atgggattat tacgtacatt tttcttgagt    263340
     ggctccaaaa gtaaagaatc gttgccgtac cccatgccca tcaagctaag gttgggtctt    263400
     ccatgaactt ccgttcttgt tgcctacatg cttgataatt tgtttatttg tttttaaaaa    263460
     tacgcatacc aaataaacct tgatacggtg tatttttaaa gattatgcag ttttctgctt    263520
     tagattggat acagtaaact gataaacgac acctaaaata tcaaagactg tctttttctc    263580
     atatcgatgg gatttccgtc cgtttttctg taagaagtca aatagacaaa ggaaaatttt    263640
     tgatacttct tgggtgtctt tttgtatagc ttcatatact aagtacagat gatcttgaat    263700
     tatataaatt gctttatatt cacttaattc tttttgtttt ttctgtagta acagctgtcg    263760
     cattttgaac atagtggaag aacaaagaaa aatagcgatt aactgtccat aaagatgaca    263820
     ttctagacgc tctcgcttaa tattgtgaca atgattaata ccaaaaagag atttccatgt    263880
     tttaaataca atctctattt gccaacgtag tgagtagata ttatgaacct gttccatcgg    263940
     aacaatttcc catggtatgt tggtaatata aacgttgatt tctgttaatc gtttactttt    264000
     ttcagagtat gtaactcctt ttttcttttc aacataggtt tgctgtttcc tacgtttatg    264060
     agtttgagtt gatgtcagtc tgtatattac aactcgtgag ggtaattttt gttgtccaat    264120
     ataggcattc cgaatttcat aagtatctcc tggttttatc tgatgcataa tatcttcaag    264180
     gttaagtaaa acatatagag attgcttttt tactgtccca tcccgaaaga attctggaga    264240
     atcatttttt acatatactc tattatttaa tttcaaccgt gaaacataga atacaccgcg    264300
     ttgatccatc tggtctaaat cttttagaga aaagtatcct aaatctcgaa tacataaatc    264360
     tcctgggctt aaggtatcta aacaatctgt aacaaaggtt ttatcattat ttttacctgg    264420
     ctccatttga aaattaagga attttccact atgtaaatca tactctagct gaattttgat    264480
     accagctgtt tgtgcacatc ctcctgaacc aggataaata ggagccaaat gattagggac    264540
     ttgaaaaata gtagcatcta aaatacgtat acgttgaaaa taagaagtat attggttttt    264600
     gatttgagac gaatcattta gttgactttt gactaaaaga gaaaatatac gctgtagaaa    264660
     taaaacagcg catcggttaa aacgttgatt aagtccttct ggactcataa gtgtagctgt    264720
     atttgcataa agttgactac ataatcgagt gagggaatca cttgctacgt gttgactaat    264780
     ccaaatacat aaagcgtcca aatctcgtgc gccatactta cttttacgtt ttacgaaacc    264840
     cgtctcctgt gcgagctgtt gaaggatgtt tggagataga tatcgctgta gttcttcagc    264900
     gaataaatga aactcatctt gaatcgatag agtcatacaa aacgccatcc tttctgtata    264960
     tttctacaaa aagaatagcg tttttttgat tatatggata caaatttatc ttagtttgat    265020
     agcgatgtga cggtacccct aaaagatatt aaagaaatta ttaatatact tacatcgact    265080
     ataagagaaa atatagtcat aaaatcattt aagggcataa acataacaaa gagtgaaaac    265140
     attgcagaaa caagcgggat agaaatctgt aaaatagtta tctctccatt tttgtaaagc    265200
     tgataagatt ttaaagagat gattaataaa acaaaagatg tcagtactag tcctaaatat    265260
     ccccaaccat cttcaataaa ccaaggtaaa aagggcattc gtgttgtgaa aacaaataaa    265320
     ttaaatatta acataccaat tattacgata tttaaaaaaa agaaaagggt tgcttttttc    265380
     ttcatttgaa tcactctcca aaacttgatt ttgtattttt actttattta agatttttgt    265440
     tataacatcg attagtgatc atttaatacg ttttttctgt gaatctattg taatgatttt    265500
     gttacttcta taaatctttt ttcaatttca tctaattcaa atgaactaca tatcctatgg    265560
     ttttctttat ttaaaattcg ataatgttga gaaagaatat tttgttgtat tttataacca    265620
     tttaactctc ttatttgtct ccaccatagt tttcctccta aagtttttga ggaactatta    265680
     ttataatgtg taaaagcaat tgttttgata atctcgttaa tatcgtctcc aaaagtcatc    265740
     tggattatat cgctatcttc aaaaagagtg acaacacaca ctgcgcctgt ccatgtgaga    265800
     ctacgtctac ctttttctat ttctactaag gttttttttg ataaaccgat aacttcagac    265860
     attttatctt gtgataaatc attttcaata cggatgagtt ttaatttttt atttactaat    265920
     tgaataaatt cttgtttatc cataatatct ctccttctct tgtggtgtaa ttttacactt    265980
     tttttgtgat atgtattttt aaaaatataa gtagaaaacc cttataaaat tggtataaaa    266040
     ctagtagaaa aatagtataa cagttatact catcgcactc acacttaaaa acaaggggaa    266100
     aaataaaaca acaatatcct ttgtatctat ggttttattt tttaattaga atttttccca    266160
     aaagatatta aacaaattat taatatactt acattgacta taagagaaaa tatagtcata    266220
     aaatcactta aggttaacat aacaaagaat gaaaacattg cagaaacaag cgggatagaa    266280
     gtctgtaaaa tagttctctc tccatttttg tgaagctgat aagatttaaa aaaggtgatt    266340
     aataaaacaa aagatgtcag taatagacct aaagttcccc aaccatcttc aatgaaccaa    266400
     ggtaaaaagc gtattgatga tgtgaaaata aataaattta atattaacat accaattatt    266460
     acgttattta taaaaagata atggttgctt tttttcttca tttgaatcac tctccaaatt    266520
     tttatttact aattgaataa attcttgttt atccataata tctctccttc tattatggtg    266580
     taattttaca ctataataga agatttgtct atataagtgt aatttcacac ttttgttttg    266640
     tgatatgtat ttttaaaggt tctggtgcaa atatatgaag aataacacgg agaatagtag    266700
     actactaacg gaatcgtatt ttatactata ggtccaaaca cttggtggat gaacactttt    266760
     tgattttgga cagactggtt ggtcttaccc caggcccatc aagctaagac tttgagacac    266820
     ccccataacg aaaactttac ctttttacag ttatttatga gaattcggct catttttttc    266880
     gttttgggga acaattaatt tcttaagttg atggcgatgt atggtgaccc ctaagagaaa    266940
     gaatggtttt gattagccca ttaaatgaag ctttatttca tacagcacta tattccgaac    267000
     taagatgtag ttataaatcc gtttttgatg aatacatttg ccatcaagaa atagacataa    267060
     aagaaagctt agaatttcaa agtatagaag cgataaaaca atgcgtaaaa agtggtttag    267120
     gtgtatcgct agtcccgtac ttttcagtca aagaagaatt agaaagcaat aagttgaaag    267180
     gggaatttgt ctcacaacaa cattcatcca tatcaacata cttgacttac cacaaggata    267240
     agtggctttc tccatcaata atccgtatga ttgaactcat acaaaaccat gctaaagcat    267300
     ggcattatta aattgtaaaa aagagatgct tgagttttat tgagcgtctc ttcaattttt    267360
     gaatactcta catttttttg ttattgaaca atctggccca attgttgaat aacatgaccg    267420
     gcgtttttta aacgacttta ttgtaaatta agcagcttta ttatctctgt acaagtgttc    267480
     aattgtccgc ttagttaatt tctcatttag tatataaatt ttatatagca aaggaaaaag    267540
     catccgctat ggatgcttcc tctaaaaact tatagctaca atttcttttt aacggttttg    267600
     ctaattaatt tttttcatag cagcccctca tacccaaaat cgtcgccgta cccctatatg    267660
     ttgattattt ttctcttttt taagcttgct tttagtcttg ttgattctta tcttgttcac    267720
     cctgtttttg ctcttgttga tttttatctt gttcaccttg tttttgctct tgttgattct    267780
     tatcttgttc actttgtttt tgctcttgtt gattcttatc ttgttcacct tgtttttgct    267840
     cttgttgatt cttatcttgt ccactttgtt tttgctcttg ttgattctta tcttgtccac    267900
     tttgtttttg ctcttgttga ttcttatctt gttcactttg tttttgctct tgttgattct    267960
     tatcttgttc accttgtttt tgctcttgtt gattcttatc ttgttcattt tgttcctgct    268020
     tttgatcttt ttcaccagtc tccatctgta taactgtgtt tgtattcaca ttaggagaag    268080
     attcttgctt ggcgcccttc acacgcaatt cgctattgtc ttggattaca gttttcggca    268140
     ttttaaactt agatttattt gtgccaaact tatgcatcat ttctttgaaa atctgttgtg    268200
     caattttcgt atttttacta cttatataat cttcagggcc atttttcata tatccagtcc    268260
     acaccgccat tgtatattgt ggtgtataac cagcgaacca actatcacgt gatgcactag    268320
     atggtatacc atatttcgct acgtctgcag ctgaatagtt tgtcgttcct gttttacctg    268380
     caacatctaa agaatctaca tttgctgctg taccagtacc tgaggtaacg acagagcgca    268440
     acatatcagt tactatatat gctgtgtagt cttccatcac acgcttagat ttcggctcaa    268500
     aactttttga ttccccatca gggtaaacca cttttttaac aaaatgtggt tttgtatatt    268560
     taccatcatt accaaatgca gcatatgctc ctgcaatttc ggttggtgat ccttcattcg    268620
     taccaatcgc tgttgattca ggtacctctt ttccgaattt aatacctaaa ccttctgcga    268680
     agccttgagc tttgctaatc cctacttctt ttgcagtttt aattgccggt atgttgcgag    268740
     acattttaag agcatcacgc attgtcatca tacccttata cgttctatca gcattttgaa    268800
     ccttctgccc tgttgaatat ttataattcg aatcatctag ttgatgggag gttggccatt    268860
     ttaaatattc aatcgctgga ccataatcaa atattggctt cattgttgaa cctatggaac    268920
     gctttagttc gatagccata ttctcccctt taaaagtcgc tttattttca ccacgcccgc    268980
     tacctatggc acgaacttca cctgtctttg tatccataaa tgtaaaagca ccttggaagt    269040
     tatcatttgg ataactaata atatttgtgt ttaaaatatt ttcagcaaac ttctgtgctt    269100
     ttgggtctaa tgttgtgtaa atagataagc catctgactc gatatgtgca tctggcaatt    269160
     ctttctctac ttctttcaca acagcatcta taaatacagg atacggcatt tcgtttactt    269220
     ctttaggagg catcagtcct tctttcacag ataccctaga tgcttctgtc atttgttcct    269280
     cagaaatata tttattttgg tacattgccg atagtactac atttctacgt tctgttgcct    269340
     tttctatatt ttgttgtttt gttggatcat agatactagg tccttttggt aaccccgcaa    269400
     gcatcgcaac ttgcggtaaa gttaaatctt ttaactcttt tccgtaatag ttctgagctg    269460
     ctgttctaat accatatgaa cggtttccta gataaatttt atttaagtac atttctaata    269520
     tttgatgttt tgaatatcgt ttttctaact tatgagctaa atatatctct tgtaccttac    269580
     gcttagctgt tttttctgtg gacaagaaat agtttttaat cacctgctgc gtaattgtac    269640
     taccgccttg cgagccgtaa ttacctgtaa ggctgactaa aactgcacgt gcagtcccct    269700
     tgaagtcaac accactatga tcataaaatc gtgcatcctc tgttgctaaa aatgcattct    269760
     ctatcaattt aggtaattga ttgtatgtaa tatttgttcg tttttccttc ccatattcat    269820
     atatcaattt tccatcttta tcatagattt ttgccgatag tggatttacc agctttgatt    269880
     tttcaagtat tggggcatct tttattaatg taaaaaaagt agttgccacc cctataaggc    269940
     ctagggttcc aagtactaaa catccaatta ataatttgcg aaaaaacgac gtttgttttt    270000
     tgtttttttt agtgtttggt ttctcgtttt tgtgaacttg ttttcgttct gttctagata    270060
     gataattttc tgacataata tgttctcctg acgttcaata ttcccgcatt ttacataaaa    270120
     atgaaatata gtttccttct gaatgggata gaaccaacaa tacgcgaatt tcatacgcta    270180
     aggatattca aatttttctt agtggaatac ttcgttataa tgcgatttcc ttttactttc    270240
     acaactaaat cttctttttt aatttcttca taggatttta cgtctatgaa tttcttaata    270300
     tcttaattaa cataaagata caaaaacgca tgtcctttat gtttcccatc atttctatct    270360
     tgattgtaag caggtaaatc gtaaatacgt tgctggtctt ctaccacacc ttcatctttt    270420
     attaatacgt aatatctttc ttttccaatt ttatttagga ttgatctatt gcaaccaaaa    270480
     gaaaaactag taaatatgga aaagtttttc tcatcatatt cacttcttct caagcaactt    270540
     ccactgtaag tatacttgtt ctattatatt agtaatattg aattagatta cattagcctt    270600
     acatttatgt aaggtagatt aagaaatata aagtcatcca agttcgtgat tgaattagaa    270660
     ggacatgaat aatataaata tgtttatttt gaaatcaatg actctactaa agtagctcca    270720
     aatactagaa agcatataag ggatttgtaa ttaaattttt gtatctagga gcgtattgct    270780
     tacgctgatg taattaatac tctcctagat caactctgac ttgtttcttc ttgtttacag    270840
     gtactacaat ttctttatta ataattgttt tgaatgtatt gttgtataaa ttgagaatat    270900
     cgggtgattt ggttttgagg caatgatttt ggggtattga aagtaaacta ctggctaaaa    270960
     gtttacattc gggtttttaa acttttacaa ctgattttgt aatgaatttc tcaatataga    271020
     tataattgct aatttcggtt ttaatattca aaattaacaa aaaataatat ataataaaaa    271080
     tatgatggtt atcactattg tttactcctt gtgctaaaaa taagatcgtg ttcccgatct    271140
     tattttttta tttgtagatt tttgatacaa aaaaaggaat ccttatttat aataaggatt    271200
     ctgcaacagg aaataacaaa atataaataa taaaaagaat tacttatatt atagtttata    271260
     tagtaatagt ataatattga gaaattttta cataaatcca gtatgtatta cgtagcaatt    271320
     gtagaaatgg cttgtttata gactagctgt tgcttactat aaattgtacg tttagacaca    271380
     ttttggacac aaaataaccg attccctgta cgattaagga atcggttatt cattttattg    271440
     tttttttata gagtttttct ctaataatgg tcttaggtta ttgaaacttg ctttttggtt    271500
     taaattccac acatttgtag aagaccttct aactggttat aatacatagt tagcgtatca    271560
     gcccatccga taactggatg ggcgtttttt tttacattta ctccacctgt tccttaatca    271620
     cctgctcgac cccgagcaaa atcaaattca aaccaaattc aaacgctctg tcagtaccca    271680
     tcagctcaaa cagtccgttc gtgaacatcc tccggaacag tcccgcatcc gtctcattca    271740
     tagagtctag aaggcgaatc atttcttctc ctggaatcat ttcttctcct ggaagcgttt    271800
     cattgacctt aaggatagcg gagacattac gttgatgttg ataatcgtct agaacgaagt    271860
     agtagacata gttaacaagt gtagtaacca cttgcatttt ctgctcttgc tcaagcggtg    271920
     ttgattccac gcatagcagc atccggttgg tgaatcggat gatatctggt tcgtggggca    271980
     gtgtcatcat cataatttgc gtagagcatg gatagcggct gagcacactt cttaccgtta    272040
     ccgcaagctc agacaactgt tccttccaat ccccttcgga gtggaattcc tccaaaatta    272100
     ttttagatac ctggttggct agacgctggt agagattttg tttgctcttg aagtaccaat    272160
     acaaagaggg agcctgaatc ccaagcctgt ctgccaatct tctcatactg agtttctcaa    272220
     taccctcctc tccaagaagc tcccatgagg cttctaaaat cttatcctcc gaaatctgag    272280
     gctgctgttt tttcattggt atcctccatt tcatctaaca ttgtaagttt atgctttaca    272340
     gattcataag ttcatgatag catctaacac tgtaagattc aaactaacac tgttagacaa    272400
     ttattcaaaa gaaagaagtg atccatatgg atgcagaaaa cctctattac tttgaaaaag    272460
     catcggtcag taaagctgtt gcccatttcg ctgtaccaat gatgctaggc acgtcaatga    272520
     gtgtcatata ttcaatcttg aatgcctatt tccttggtac gctccacagt actgccatgt    272580
     taaccgcact cgcattaacc ttgccgttat ttgcaatcat tatggcgcta ggaaatttga    272640
     ttggcatggg gagtggtaca ttcatctcac gtttgctagg agagaaaaaa tatgatgatg    272700
     taaagcatgt gtcttcattc gccttttaca gcagcttagt tctcggtctt atcgcgatag    272760
     ctgtcggcct cccattgatt gatcaaatcg tttatggcct tggggcaacg tctgactcct    272820
     tcgaatttac aaaggactat gtcacaatta tgatcatagg ctcaccattt gtcatattgt    272880
     tcttcacact ggagaatatc gtgcgctcag aaggtgcagc aatcacgtct atgattggta    272940
     tgattctcag cgttgtcgtg aatattattc tagattcact agtcattttc gtcttccatt    273000
     ggggcgtaac tggggttgct tccgctacgg taatttcgag cgttgttgcc agtgcatttt    273060
     acgcttttca tataagatat aaaagccaat tcttaaccgt ttcagcaaaa tggttcaagg    273120
     ttactaaaga gattctgagt aatgtattta aaatcggagt tcccgtcttt attatgagta    273180
     tctttttggg tgcaatgtcg ctcatcttaa accactttct tatagaatat ggggatcagg    273240
     cagtagctgc ttacgggata tcatcacgtt tattgcaatt tcctgagttt atcctgatgg    273300
     gcttatgtga gggaatagtg ccgcttatcg ccttttcttt tacagccaat aaaatgcgca    273360
     tgaagcatac aatcggattt acaattaaaa cgatagtggc gttagccttc gtattcggcg    273420
     ttatcgttta tctgatatct gataacttaa ttggtttatt tacgaatgac ccacatttaa    273480
     ttgaaatggg aagttacatt ctgcatgtaa cgttcttatc cttgtttatt accggaatga    273540
     ccgcgttgtt tacgggtata tttcaagcaa cagcacaagg aactgctgcg tttattatgt    273600
     caattattca aggaattaca ctaattcctg tgttgtttat cgccaatcat atgtacggat    273660
     tccacggagt aatctggtcg cttgtcattg cagatgccgt ctcattcctt gtgggtgcta    273720
     tcatgctgta tgttttacgg aacaaattgc agccggattt ggatagttta gtacagtaga    273780
     aaaaataaaa cttataaaaa gcgttgggag aaaccccgac gctttttgct ctataaaaca    273840
     tgtttgtttt acgttccgga gaggcaaaca gctctatctg aaaaatagct cagcaaagaa    273900
     gctatacaag cccttgccct tgggatttaa cgagggcttg agtgaaacaa ggatttataa    273960
     agtatacaaa ataaacctaa taaacgttcc caaatgcaag tttggcaaca catgaaacag    274020
     ccacgaacgc tgtgatatca acgtttcgtg gctgtttgta tgaacattgt ttatacagct    274080
     ttttatgcag ggagcgcaaa cacttgatac atcaacattt tcacgatcat ggcttgccct    274140
     ctagtgtgca taaaatcgtg tatatttctt aacgttgtaa atccgcataa atctgacgag    274200
     accccatcgc tatcaagcta atattttaaa gtacctccaa aacgaaaaaa acggtattct    274260
     ttctatctaa gatgtaggag gattatcgtt ttttttaaaa tgtaaaaaac ttttgacatt    274320
     cataacggaa ttatataaac taatactgta aaaagttttt gacaaaatta ggggtgatgt    274380
     tcataaaaat gaagaacata attcgtattt tacgtaaaga gaaaaagctt tcccaagaag    274440
     atttagctaa attatgtcat gtttcaagac aaacgattaa tgcgattgag aataacaaat    274500
     atgatcctac attggaactt gcttttaatt tagctaaatc ccttggtgta acggttgatc    274560
     aattatttat ttataaaatc tagataagga gtagagacaa atgaaaaatg gaattaatat    274620
     cttatttact tgtttataca ttgtgattat gggtttactt gcttttgaat ggtatgagaa    274680
     acaacagatt tctataacct cgttatttgt agcaacaatc attttgcaat cattatttat    274740
     gaagagaatt ttgaaaggta aaaaagagag cgagaatttt attgatgaaa tgtttttaca    274800
     tatcagacag aaaagcttat caatttgttg ttttgtaatg tatgtattaa ctttaggtac    274860
     tttattttta tcagaaggaa catggaattt tagccatatg cataataaac cgttaatctt    274920
     tctggttttc ttatatccta tagtttacca aataagtcat atattcgttt caagaaacaa    274980
     ctcttaatag actatttaaa agtggaaaaa aacgctattc tttcggtata agttcaaaac    275040
     gagaggatgg cgtttttgta tgtctatttc tatatctgat gaattacaac tatttggggt    275100
     accgccacat gcccatcaac ttaaggattt tttaacaccc aaaaaacaaa aaaaaatgta    275160
     cattttcacc tggagatgtc aatttttttc gttttggagt atttgctttt cttagcttga    275220
     tgggcatctg atgctccccc atgtataggg ataagaattg aatgtggact agttttttgt    275280
     tttatatatt ttttattaat aaatacggta cgtgaaatta ttataaattc taattaaaag    275340
     cccccataga ccataaatct atgagagctg cctaaggcta ttttacattc gacttgattc    275400
     tattgtagca agctttcacc aaatagcaaa gacataacga tccaaaacca aataattaac    275460
     ctaaatgcac tcttgaatcc tccccacaga gaaaatgttt cctcttgcat tattatcccc    275520
     ctttcctact tgtcttttgg ttctccaaac cattcataca ttgcctgtcg gcttataatc    275580
     cattccttac gcttcccttc aggatgcaaa aagtaacatg gctgcaagat ttgggtgtat    275640
     gtcagcagat taaagcacga agacatggta agattgcccc ttccgtttac attttaacct    275700
     tacatactaa ttatttaaaa atcgtcgaat acttcaagat aaagtggact gtagcaattg    275760
     atatctgctc tacttttatt agctttttaa caaacaagca tagtaaaaag aatatacaaa    275820
     cttcatcttc tgtagacctt ttcagtttag aagagcaact caaacccaat acggatattc    275880
     aatcaaaaga agataaaaac agattgcaag acttaaacga ttacttaagt gatgatcaga    275940
     aaaaagcata ttattacatt ttgagtcaag aattaacata cctttccgaa aatgatgcgt    276000
     acataattgc tttaagactg ccacctgata tcgatcgcta cacaagatgg gatattgaag    276060
     aatgtgtgca atggtttcag tttaatacag ctgaaatcag caatcctgcg catttcataa    276120
     agatgtttaa tcaaaaatct aaacagaatc aagaacgtag aaaacgtcat accaaaaaaa    276180
     caaactcgtt tttgggtgca aataataatc gtaagtttat tttctttaac tttttagaag    276240
     agaacagcta aatttttaaa aaaatccaat gacaaatagc cttgctcaaa ataatcatat    276300
     acagcaaggt tatttgtcat gtcctcttat agttttctag aatcttagta tttttcaaca    276360
     caaaaatctt caatagccgt actcgttttc tgtgaactgt tatcagtttc caggtaactc    276420
     tactatagaa attacattta atagatactg aatattcatt tatttaccaa tggattaact    276480
     ttgaaattta ctaagcttaa atcttcaata gcttgctgca gtaagtatga aagatcaaaa    276540
     attaattcta atgtttttat ttattttaat ttctaaaaca agatttatta aatatagtat    276600
     tctatatttt ttgtcatttc tttagaaagc ttggcatatt ttcaatatac aaagggaatc    276660
     ttgtaaactt caaatggttt ccataatttt tataatttaa ttttggatgc ttctgataca    276720
     aaattaaatt ataaaaacat agagtagaaa ttttttctac atttctagct tatgaagcta    276780
     aaccaaacac tgtataaata aagtgttttt gatcttagac agacttgttc gacaaaataa    276840
     gttttctttt tactctaata taggttttat cgactcctca tgagttgttt gttcatttaa    276900
     gatgatattg tattgtctct tctaattaag gcctatatgg ataaactcag cgtataattg    276960
     ttgtctgagc aattaatata tctcttccct ttagttcata ctgataatgc ttctatttaa    277020
     actaattttc cttttcatac tgattacaca tcttttgtaa aataatacca tcatcttcaa    277080
     gtatttaaat gtatttttta cttagtgaaa gactattatc ttttagataa tcaagagatg    277140
     cgcatttttc ggatagtacg ttaaaaccta atataatata tatcttttat ataaaaagaa    277200
     tataaagata aaactattat acttatgaaa aatggcctac aaactcagta ataacagtgt    277260
     ctgcaaagtt atagaaccat aaaaaatcga aaaaaacact tattggaaat gtatttattg    277320
     cgttttacgc cgctctaaat atacaaaata tcataaagtt gaattactta ccctacatat    277380
     aatcagcatc attttgatga gtgaaagtgt atataagatt aatggtagtc tagcttaaat    277440
     tattaacatg atttccacat acgctataaa ataacccaca ttttattaac atttagtagt    277500
     aagttataga cagaattcag taaatcaaca ttattaacaa aaaacattct gattttaagt    277560
     agctttatat ataaaacatt tatatataaa gctttgagct attttattgt acacatttgg    277620
     acaatattat taagatatcc actgaattaa tatatatatt tacgattttt agtagattaa    277680
     atgccagtaa gagaacgaat gttcagaaaa aagtaaagta aaattgtgaa ttactgatta    277740
     tattttagga attttgtata gaagtgtata aaaaaagaga ggtattctaa ctcgaattta    277800
     agaatctctc tcttttatgt ttggatagta cgaatataat ttctaatttc agcacgaata    277860
     gccctccttc tttgattttt caaaaaagga gagcatgtaa ttttacattg caggaagcag    277920
     ctgatctacc gtgcatggtg tttcactatt tttacggtaa taagcttcta aggaatgaag    277980
     aaaatcgatt aaattaaagt ctttaggaac ttcaattacg cggatttttt ccttaggcaa    278040
     tctatctatt ttttcaatga acagttcgcg aatatcactt ggaatatgat gttctttatg    278100
     gccatgagat tttaataatt cacgaatttt aatttctaat gcaatatatg cgttaacatt    278160
     tactccttgc tcaaaagcat acttcctaaa tagtgtttct tcttgatact gcatataatt    278220
     acgatggtat gcttcttcag tcacaggaac cgcatatgta gcatgaagaa ggtcatgcgc    278280
     tttacagaat aacttcttaa cattttgtaa tgaatatata gcgaagtgag taccaaattt    278340
     aaataccgca tcttcttgtt tctctctcgg cacattatgt gtaatcagag aataaatacc    278400
     tgttttagca gccgtatcta atacgcgata ttgagaagac tgctttaata atttgcttag    278460
     tgtataaaca agatttttag ggaaaccctc ttgtctatca atcatttcac gtaatccacg    278520
     aatcacttga cggatttgac gatgacagga atgttttaag acatttacaa attggtttat    278580
     atcttttgta aattctgcaa tattcatttc aactaatgat tcttcaatga acttagcttt    278640
     acgtttatat gtaagtcttg gtgtaaatgg atcgcgatac tcttccccta tttccttatt    278700
     acacaggaaa tcagggtgta cagataaatg cagtgttgta tactgctttt tattcttttt    278760
     ccctttttct aatttgcaaa ttttaaacaa agaagatcca gtagcagttg atttagttgt    278820
     taattcagcc attacagaac gtatctgatg tgggtatttc ttatgtaaga agcgatatat    278880
     accgccaaaa tgagtctgtt gtccttgttc atcaaatttg tatagtgaac gtttcaaagt    278940
     agtttctcgt ttttgctgca ttgcaatatc aataaatagc tttttagcag caatggataa    279000
     atcgaagaac tcttttgtaa atacaattgg gctgataaac gtgtaaggat tcgctttatt    279060
     cgtttccttg ttcataaaat cagttaatgt aattttatat ttaccactgt attcattctc    279120
     aatttcaatg atgttgtgta agctaagctt tttcaacgca acatagaatt gcgaatgatg    279180
     aatatgtgca aatacttctt tatagttttt gtagtcctcc caaagcatgt gaatggaaac    279240
     atgagaaagt tcaccatagg tattacattt tttatgtaga aatagaaata cttctagatc    279300
     tgcattagta ataccatata gcttatgctt tctaccattt gctttagtga agagattttt    279360
     catttgaagt gaaaaagatg gtttggcttt ttcaacaaac ccttcttcat ctgcaattcg    279420
     ttcctcgtaa gacattgaat ttacgatatc ttctagatat gtatctttaa agctatagta    279480
     tttgccttct aaagcttcca ctaatttttg ccatgcttta attgttacta atactggagt    279540
     tgttgtttca ccatttaaac tacgtttgtt ctttataacg aaaggtttag ccatcttttt    279600
     cacctcctct tattatgagt ttcagttttt acctaaatag gatataaaaa ttcaattttg    279660
     attatatcaa atcgaatctt ggtgaaatgt gtctctttaa gaggaaaatc aaaaatgtga    279720
     aacgcagcct cagccttaga ggcacaaggg attcaacgtt tcacaaaaaa aatcttttgg    279780
     ccaccataaa gctataaggt attttgaata tgaaacgtat ctgaaatgaa tgaaacagca    279840
     cctaaacctt gatataatag gttttttagt gctttgggtt aaaagttgtt gccaccatat    279900
     agctataacg tttcatgttt tgaaatgact aaataatgtg tagaattcat tcataaatgt    279960
     tgtcgtatag cgttttcatg ttaatttacg tcaagggact attgccatca tatagctata    280020
     tacgtttcat gtttttttta gattgttgcc atcataaagc tatgccgttt catgtttgaa    280080
     atcaatattt cattgcgctt gaaatgtacc taaacccttg ttacatatgg attcataggt    280140
     tttttttaaa aaaagttgtt gccatcatat agctatagca tttcattagg attttttaat    280200
     ttttttaaag gatggctgta tatcaatgtt tatcactaat ttaaataaaa aaaatttttt    280260
     ttatttgaaa agattttagt gtgtttatgt ttcatattta aagagttgtt gccaccatat    280320
     agctataacg tttcatgttt tcaatagtaa ctgccacaat gtagctatga tgtttcataa    280380
     aagtagaggt atttgtattg aagtatgaaa taacgttaat tcgtgttaaa tgaaacccaa    280440
     caattcatca gtattttttg ttcagaataa acttgccacc ataaagctaa aacgtttcaa    280500
     gttctaagta gtaattgcca caatgtagct atggtgtttc ataaaagtag aggtatttgt    280560
     attgaagtat gaaataacgt taattcgtgt taaatgaaac ccaataattt atcggtattt    280620
     tttgttcaga ataaacttgc catcataaag ctaaagcatt ttaagttttc aatagtactt    280680
     gccacaatgt agatatgatg tttcataaaa gtaaaggtat tcgtgctgat atatggaata    280740
     gcgttaattc ttgttaaatg aaattaaaaa attcattggt atttcttgtt cagaataaac    280800
     ttgccatcat aaagctaaag cgtttcaagt tttcaatagt aactgccaca atgcagctaa    280860
     aatgtttcat aaaagtagag gtatctgtgt cgaagtatga aataacgtta atgcttgtga    280920
     agtggaaatc aacagtttat cggtattttt tgtttcgaat atacttgcca ctataaagct    280980
     aaaacgtttc aagttctaag gagtacttgc cacaatgtag ctatgacgtt tcataaaagt    281040
     aagggtattt gtatcattgt atagaatgat gcgaataatt ttttagatga aaccagcaaa    281100
     tcatcgatgt ttcttggtaa gaaagtaatt gttatcataa cgctataatg ttttatttca    281160
     tttgtaagaa aagggacaat tacgtttcac tttaaaagta tgatttacac tatttaatac    281220
     cgaatgggtt tcccgcatgg agattgtagt gtaaagtagt aattttacaa ataagtacag    281280
     tcttatataa tacaagtaca agaatgttta cttgatagga caaatactgt tcgataaatc    281340
     atttctcgat atagattatt ctgataacgt ttcaacttat atgctatgtt gccaccatat    281400
     agctataacg tctcaagttc tataatttat aattctaatt ggtgggaact tagtaaggag    281460
     gtttttgaat atggagaaag tattagtgtt gtttagcgat gcccttttac ttgctgcacc    281520
     aatgtatgaa aagaacacgc agctatgggg aaagtggaat agatattatg aggaagtaca    281580
     gggaaatcat gacaaagtag taacttcagc taatatatcc ccttcatttt cagctcttgt    281640
     ctcttggtta ggccagaaac aagaacaagg gatttcatta ttgcatatat acgcaaatct    281700
     agataaatat aaaattgaga ttcgaaatgt actcgataaa ataatagagc aagaatttgg    281760
     aggtacgtct gaagaagttg aaacagctat aatatctaat acaacagatg aaaagttaaa    281820
     agagcattca attgatctac aagaggatta ctatcctgta agtaatgatg cggtatatta    281880
     tcaactacga gatggtatag ccaagaatca ctttgaagaa gatgaagtag gagcagtatc    281940
     tgttttacca ttagaaacta aaaatacaag cggagttgct cagctatcat cacacaagga    282000
     tgaagattta aggctagtaa acaccaatga agcagaaaga tggtcaatac tagtcgatgg    282060
     tgttattagt aacatggatg atcttaccgc agactgttta gatacaatta caatacagtg    282120
     gttgaatcaa gcgaaatctc cagatgattt tattgatttc agctatgaaa atgtactaga    282180
     tatgtgtaat attccaaaag catcagcaaa tggtatagag tattatcgtg cagaagataa    282240
     aattaaaatt gcacaacgta tagctgcttt ggcgagtatc tttatttatt taaatgacga    282300
     taatgaagtc gtggttttaa atgatcgtgc agaaactggt gagcaatttg aaatgaaacg    282360
     tgaaataatt aaaagacttt tcgttttaga ttctgtagtt ctttggagag ataaaaatac    282420
     caatgattac gtaggtattg aatcttgtag aataaagcca ggtagctttt tgtcgatgta    282480
     tttatacgga tctagtagca caacagcgtt attatctaaa aaagcattgg agtataatag    282540
     ttatcgacac aaattccaca agcgactaat tcgctattta tcttggcaat ggagaattcg    282600
     acaacagtac agtaatttaa aaagaccata ttcaattgat ggagaaaaag gactattgtc    282660
     tgttatgggg attaatatag ctaagggacg cccccaccgt attcgtgagc aattagaaaa    282720
     tgtattaata gatttagaaa aagaaaaagt tatttcacat tgggagtacg ctgaggaaat    282780
     tgatgaatca agaattggag aacggaactg gtttaagaat tattactcaa aattaggaat    282840
     catcatttta ccaccaaaag agttaatgga taatatcggg agtttggcaa agaaaaaggt    282900
     aattgatact ccggataagc aagaaaataa tgtgattata aatacgatag ctcatagtac    282960
     agtaagtact gaggagctaa ttagagagaa aattatgcac caacatatgc atcaaaatag    283020
     aacaatgcgc gaaatagcag atgagttagg cttatcccct gctacactat cgagattctg    283080
     taataagaaa atgaaacgga tttcaaacag tgttaatgat aagttaacaa aatggtatga    283140
     aagacaaatg ataatcgagt ctatgtaagc aaaaaagagg aaaccacttt gaaaatggtt    283200
     tcctcttttt taatgaatct tattgacgga aaattcaaac acgttatata atttttggta    283260
     ttaccaatat cttcaacatg tattaccaaa aaataaaggg gacgatggct tgaaagaaaa    283320
     ggaacgctcc tcagataaaa ttgagaatga attaattaga tccatattgg ctggtgttta    283380
     ttctgtagga agtactttac cgccggaaag agagcttgcg aaagaatttg gtgttggtcg    283440
     cccaactatt cgggaggcgc ttcaacgttt agaaaggagt ggatggataa caggaagaaa    283500
     aggaatgcca gcgattatta atgattattg gagcaatggg aatctaacga cacttattaa    283560
     tattgttgag aatcatcata ccattacaga tgaatttatt atgtatttat tagaatttag    283620
     aagttcgttg actccgactt atattcgtga tgctgttacg tttaatcaac ctaaagtggt    283680
     tgctctcctt gctaatcttg agcaacttga agatagtgca gaaagctatg cagcatttga    283740
     ttggtatttg caaaaaaggt gtgctgggct tgctgccaat ccgatctttc tactcatttt    283800
     aaatagcttc gattccattt atgtagatat ggcgaaaaga tatttttctg taaaagatca    283860
     tcgtgggttg tccttcaact attatcacga cttattaaaa gctgcattaa agggagatgc    283920
     aattgaagcg gaaagattgt gtaagacaac attggagaaa agcttggctc tctggaaaga    283980
     tagaaaaaaa taaagaaagc tggaggcgtg ataaatgaaa ctaaaatatt ttaaagaata    284040
     tttttcctat cctgatattt tgatcatgag ctgtcttttc ttcgctagtt ttggatttat    284100
     gattttacat ttaacctcta tcggaatttg gggtgctttt attttgggaa tgattatgta    284160
     ttccttagct gagtacgcta ctcacaggtt tatttttcat ctaaagccac caaagaatgc    284220
     attcttatta aaaatactta agcgcctaca ttatgatcac catacaaatc cgaatgaatt    284280
     acatttatta tttttaccct tatggtatag tgtgccaaac attgcaattt caggagcgat    284340
     tttttatttt ctttcatcca gctttgtcat gacaaacgca tttattgcag gtattatgct    284400
     ctttttatta ttttatgagt ggaagcatta tatcgcgcat cgccctcttc aaccaatatc    284460
     accatggggg cgatggatga aaaaggttca tttatggcat cacttcaaaa atgaaaatta    284520
     ctggtatggt gtcacgaacc cagcctatga ttttctcatg ggcaccttta aagaccaaaa    284580
     ggatgttgac caaagtaaaa ctgctaaaaa cctagaaaaa cgtggtgacc agaaaataga    284640
     attataaaaa ataatccatt gtcatcatcc tggaaatgtc gaatgaattt tgtagcttcg    284700
     acatttctca gggagtgaca ggcatttttt cctattgaat agtaagcatg ataatagatt    284760
     gcataaggct cgttttaaag tttttcttac cgaaaaatgc acccgctttt ttctctattt    284820
     ctcttagcat tgcttcattt ttcacgaagt gtttcgccga tgctatctac aatctgtatc    284880
     gcgtttgccc cagtgatttc tttagcgact cattccagaa gaatcttcgt atcaaaagaa    284940
     aattttcgcg caaagctatg gcacctgaaa atattattgc ggagaaactc ggaatattca    285000
     ggcgtgaaag cacgacgaat acagcccctc atcatctctt tcatctagat acctttttaa    285060
     ccaaatggtg caacacatcc ctttctttat catctttccc ttgtacaatg acagaattcg    285120
     ttaaaaaaga agaggtgaga ctaacagtat gctttctcca ataaagatgg tgtacatatg    285180
     agattaacaa gtgaatgtgt agagtctaac acttgagata ttgaacttgc aattatgtga    285240
     gttaataact gaaaggagaa cttataacat gacattgaca gatctccttt atcaatggtt    285300
     ttaaatagaa gaaaaatcgt taataaatct agttgaatac gaaggtctct ttattaaact    285360
     aaaatgttca tatcaaacca tatgatatga aaagagcaat gattttagta tgttttatac    285420
     acactgtaca tatacacttt atatatagaa cttgcatata agttgtatag aaatgaaata    285480
     tgttaaatat gttgatatga aattgatata gtagccacaa aacctttatt ttaaagggtt    285540
     tatatatacg gcttatatat aaagtttatg aatagagcgt atggatgctt tgtgaagtgt    285600
     tttaacatga aatgtttgta atttgatatt ttttataaag gattattcaa aagaatgtca    285660
     aattaaatat taaatttata gttttataga aggtattgtt aattatatga aacctgaaat    285720
     tgatatatat tatatacagc gtgcatgtac gctgtatata ttcgtgttta tatatcaaca    285780
     ttttaactaa ctttaatact tgtacgcttt atatgtaagt tctatatata atcacttgat    285840
     atacgtctta tattaatgta atatattcgt aggaataatt aaccaacgtt ttaaggggga    285900
     ggaaacttga acgaggtatt gagcgaaaag tataaagtaa ttaaatttcc tgctgaagtt    285960
     gtgaacatgt ttgcagacat tcttgaagag gacgaaatac tttataatgt atttcattac    286020
     ataggatctg aggtaaataa acaataccaa gagacgaaat atatgagagg catctcaata    286080
     aatgaaatag taggtaatgt tgtaattgat aggagagtta agaaattaaa gggaaaatca    286140
     tactcattag aggttgaacg aaccaatata tcaagaagat cagctgaagt aagtgttagt    286200
     acattatctt caatgtcatt aataactgaa aaaattatgc acccttataa atttttaatc    286260
     tcaacaatta gagggcagca ggtgttaatt gaacttggaa aacgtaaaga aacgaataga    286320
     taagaaaaag gagagataaa ataatggcga agaactttct gaaaaacgaa gtagcagtaa    286380
     aaatgacaat ggttggtttt ggtcaagccg gaactagaat ggtagataaa tttgctgaat    286440
     ataagcatac ggatggaaca tctgtgtaca actgtcttgc tttaaatagt aacgatggtg    286500
     atttagccga attaaaaaat gtgcctaaaa gtaaccaagt atcactaaaa ttaggcggac    286560
     taggaaagaa tccagaacgt gctgtaaaag tactagaatc aaatgatgaa gcgaaagcaa    286620
     agttaaaaga attcatcaca gagcgtgtaa gaccaacaga tgaattggta ctattttttg    286680
     ctggattagg cggtggaaca ggtacttcta caatcattaa agcaattgaa gaattctcgg    286740
     cttttcataa taaacctata atcgctgaag aacttaaaag tatggcaatg aaaatttcta    286800
     gagaggaatt aatagcaaat caacaaaagt atgcaagaat tgcattcaat aatgcaattg    286860
     agcgtaaaga ttttattaaa atgggtattg ttgtgacact ccctgtaaga gccgatgggc    286920
     ctgatgtact aagacaagta aataaattct ctcaagagat ttggaagtta gcaaatgaac    286980
     cagcaaaagg tgttgcattc gttgttttcg cggataacca acatttctat gatgaattta    287040
     agggattaaa cgaaaatgag aaaaaaggta ttgctaattc acgagactat gctaatcagc    287100
     gcattggtga aatcatccat gaattaaata cagcttctaa tggcgcagga acatctgtta    287160
     ttttagattc tcaggacttt aaacgtattt tattagagaa aactggctgt ctagttatta    287220
     ataaaatttc tcgcaatatg aatcaaattg aaaatagtaa agaaatagta gatatgttct    287280
     cagaatcgtt gaaaggaagc tctttccacc ctcctataga attaatgaaa aagaacgatg    287340
     atggtgagtt ggaggcttct aaggtgcatc attttggaat gcttgcaatt ctagacgaac    287400
     aaaagaatat cgatgattca tttatggatg atgcaaaagt agaagttacg aatacattac    287460
     caatcaacgg tacggtattt aatgggtatt taattagtaa aaatgatttt atgggcagtg    287520
     tgtatacgtt ctataaaact gatgcattac cgtcccgttt gtctaaaggt ttagttgaag    287580
     aattcaatga atttaaagag aagcaaaatc aaattcagtt taaaaaatct caaattagta    287640
     caattgaaat gcaagatcaa gacgatgatt tcagtattaa ttttggtgat tacatcgata    287700
     tgggaactag taatgaggaa ccatcagcag atgctgagaa tgatgaagaa ttagctgcat    287760
     ttatggatcc agacaaaatg tttggtacat caaaataaaa aaaagaggtc tgggaatatc    287820
     ccgggcctct tttttattct gatgtcataa tagattgcat atactctatc atattttcgt    287880
     ttaaataatt ctctataaaa aggtgttttt ttgctagatc ttcctctttt ttaaaccaac    287940
     caactttttt cacacgctct tcctcaggct tttcattcca gagtttttca gcttgtcttc    288000
     ttaactcttt acgagctcta tgttcaatta ttatgttatc aagtctctct tgtctttgac    288060
     gttctttcat agcaattgga tcttcaggtt gaggcaatgc ttttaataca ttttcaaatt    288120
     tctcttggaa ttgtatttcg atgttttgta aatgtgcttg aactttttgt tccaccaatt    288180
     tttcaattgt ctcagctgcg tcttgaaaat caatttgaga taatacttca ttagagtggt    288240
     tttcaggaga tactggcctt agttcaaatt gatgcggcaa aagttcgatt atggcatcta    288300
     aagaccactt ttcatccctt ttctgtttta tgaaaagagc tatatttaaa tccaatgaat    288360
     tatatagctt ttcatttgta ttattggttc taagtgtccc gtgcaatccc ttctcttcta    288420
     acgtattgaa ccaattataa acagtattat ggtgtctacc tactaactta gaaaactctg    288480
     ttattcgcca ggctttttca aaagcgtctt cgtgtaatga gttctcatca tctaccatgg    288540
     tttgttctga ttgattttcc tgcttaatca taatattacc tccttaacag tatgtaattg    288600
     tgctgataaa tgacattaac atgaaatatg agattgatat gttaagtgtt tttcgacgat    288660
     attaatagga atcccttcct tatctagtat taacatgaaa gataacatta acatgttaca    288720
     ttcaaagtgt taacagcaca ttaacaaagt gcggtttatt cccgctaaat gttaatgttt    288780
     tgttaactgg gacttaaaat gcatcaatgt tatataggat taatgaggta actttgcccc    288840
     ctatatcctt ataaattgtt gctatgagat tgacattttt attcacttaa tattaatgat    288900
     aagtaaatat aaccgatttg taaataaatt atgaggatat agcattgaac tttcaaaaaa    288960
     aataggtata aatatgataa aaagagtcca tattattaat aattgtagta tgagcctgtt    289020
     ttattcataa cacttgagag tatagaacgg atatctgttt gactaataga ggcagtgtct    289080
     ctttttaact gatcccaaga ctagtaaagc aattttcgat aataactatt ataggtctct    289140
     atatgaacgt taaattctaa ttagatgact gtataggata gttaatttat tggttgttag    289200
     tcgtttgaaa cactataaag tactattcgc tttgttgatt aacttcaatg attattttgt    289260
     aagtgtaaat cacaaagaaa aagcttttac taataggatt tatgcggccc ttattaattg    289320
     taaataatat tcaatcgttg tgaacctggt atattaatag cgctactaat aaggatctac    289380
     atcaatcaat gttttgttaa tgtcttgtca ttgatagaat taagtatggt tgatataaga    289440
     ttaacaattg tgttgttcta agtattaaca tgttaatgtt tcttgatata tcaatcacat    289500
     ttctagtacg tatgcggacc tgtttctgta gaatgtcaat cttatgtcaa tactcgtaga    289560
     gataatttct ttaattaaaa cattgttcct tcaattacat acccaagagt ggatttaaaa    289620
     cttctaaagc ttatattaca aagtaatttt tctcaaatta agatagtatt ctattgatat    289680
     gaattcacta taatggacag taatttgctt gatagtctgc attttttaat aattttcagc    289740
     gcggaatttc tagcgattta taaagcgtgg ttcttaacta gtgtggattt tcgcatttta    289800
     attctcatcc taataaagtt gtagttttat agatctgttg ttaatgtctt gtctttatta    289860
     aaaccaatga tagttaacat aacattgata ttttttattc tctgaggatt aacatgttaa    289920
     tgtctgttga tgtgtcaatc ccattctcgg tatgtattta gatcctactt cgcgaaatgt    289980
     taatgtcata tcgatactcc atgagaagaa tttctttata tgaagtacta aatcttcaat    290040
     tatgcatcta atggtaaatc gggaatctct aagttgcata ttacaaagta attctgatat    290100
     tactttatta aatacaatca gatacactgg atgtaatttt actttacagt ctatatgttc    290160
     tattaatctt ccgctcgaaa ttctcttatc aatatataaa gaatgtttct ttatatattg    290220
     ataaggaatc attctttata tattgagggt ttttaaatgc tttggatttt tgtatttcaa    290280
     ttctcattct agtaaaccta tgatttatcg atgtattgtt agtaatagta aggggagttg    290340
     acatgaggtt aacattttaa tgcttctaag gttaacatgt taatgtttgt tgatatgtta    290400
     atctcatttc tggtctgtat ttaaattcga ttttgcgata tgttaatatc ctttaggggg    290460
     aattcctttg tatgaagtac tgatccttca atatttatac cgattgtaca actttttaga    290520
     gtaacagtat cagtatgtcc aatgtttaga gattacttac atgtattttg aagtttttac    290580
     acctgaaccg cttatactat ttgtaggatt ttctgctttt ttgtcgaata ccattaatgc    290640
     aaggggggac attacatgat aattaaagac tatttcatca atctttctat tttttcttta    290700
     ttagttagcg cagcaatatt tattcaagtg tttacgattc attccaggcg atattttgaa    290760
     aaattctatg gagggatcat cgcagttact ttgatgttct tttcgtttcc gtacatggga    290820
     ttttcctacg atctccgggc tgttcctctt attctttctt ttatttactt tggtcgcatt    290880
     gctggttgga ttacattaat tagcattatt ataatgcgca tcttttacat tggtgggtat    290940
     tgggaaccac ctgtgatggc ttatttcggt atgggtattc tatttactat ttttaaaact    291000
     tatttcaaaa gccttcatcc atttaaaagt gcacctctat acttttctgt ttttgtgggt    291060
     atgaagtggt tagtaggtgt attctttatt actacagtgc tttatactcc aggcttagta    291120
     tttatagctt taggactttt aatcggtgtt tttcttatgg aagcttacca aagattatat    291180
     tacttaacac aggacttatc taaaatgaat caaaaattaa aaaaatcgaa gcaagaactc    291240
     aaagataccg tacatgagct tcaagggggt atctttaaat tcaaaaaaac ggataaacat    291300
     tttatacaca ctttgtgtga tggacagttt tattatcaaa acggaattta ttctgaacgg    291360
     gtggtaggaa aaagcttacg tactattgat gcttctatta ttcctcccca tttagttcca    291420
     caattaatga agtattatct tcaggcgtgg gaagggaaag aaattatatt tgaattaccc    291480
     tggccgaatg ataaaactat tattcttatt gcgcttagac cgattaaacg aaatggacaa    291540
     gttattgaag ttgttggttc tacagtcgat ataaccgaaa ggaaaaaggt agaatcagaa    291600
     ttaagggcaa ctaaagaatt actggaatca tttataaaac ataatgtaga tgcgattacc    291660
     atatctgatc gggagggaca tattttacaa gctaataaag cttatgaaaa gatatttggt    291720
     tggtcatcac acgaaatcat aggtaaaaga ttaccttgtg tgcctgattt cttaatggat    291780
     gaatcactcg gaaatataca gaaaattcta actggagaat ctgtagttac gagattagaa    291840
     acagttagac aacgtaacga tggaagcctt cttgatgtca gtctgacagt ttcacctatt    291900
     ctagatgtaa ggggaaatgt gatagcttta tctgcaatat gtagggacat ttccgaaaga    291960
     aaacaagcag aaagagaacg gcaacgatta catcaacaat taagagatag tgaaatgaaa    292020
     tatcgtgcac taattgaaca agcaactgat gcagtatatg ttgtagagtt gaatgaggat    292080
     caatttccaa gtcgatttat tgaggtaaat cctgttggat gtaacagatt tggatatagt    292140
     agagaagagc ttctctcgat gccatttccc aataatgtac cacaagattc tccaattatc    292200
     atacagttgt tagaaaaaat tagagaggga cagacttctt tcactttgca agatgaacat    292260
     atttttccaa ccggaaaaac aataacaacc gagtttagtg tccgtatttt taacttgaat    292320
     ggcaaaaaag ttttcttaag tatctctcgt gatatcactg aacggttaaa aacagaagaa    292380
     ttattacgaa aatctgaaaa actggctgtc gtaggacaat tagccactgc aatagctcat    292440
     gaaattaata atccattaac cgcaatgaaa gggtttatgc aattactaaa atcaacagaa    292500
     aatgagaata atcaggggta tataaatata gtatcatcag agattgagcg tatagaaagt    292560
     attacgaatg aatttatggc ggtagccaaa ccacaggtgg taaggataca acctaatgat    292620
     attagtgtgc taactgatca agttttattg atactgcaac ctcaagcaat gatgaataat    292680
     atacaaatta gaacagatta tacacctggt attccattga ttccatgtga aggaaatcaa    292740
     ttaaaacaag tatttgttaa tattttaaaa aatgcaattg aatccatgcc aatgggagga    292800
     gaaattctga ttcaaattga taaacttgat aatgatcaaa taagcattcg ttttatcgat    292860
     caagggtgtg ggatcccaaa agaacgtata ccatatctag gagaaccttt ttacagtatt    292920
     aaggaagagg ggattggctt aggattaatg atttgttata aaattatcga aacacatcaa    292980
     ggaaaggtat ttattgagag tgaagtaaat aaaggaacaa cagttgaagt tactctccct    293040
     atttgtacaa ttcaaaagta ataccttcct ttattaacta gtttctaaat agccttacaa    293100
     aaatgtaata ctattgttac ctaatgaaat ggaaacagcg tataaggtac ttttaaaaaa    293160
     agtttgataa tttataaaaa agtctgatcg tttaaaataa agattgatca tatgtaaaaa    293220
     agtttgatca aaatcctgtg ttgatgtgca ggattttttt cttattcagc aatcgggcca    293280
     ttataacgga ataaattctt gtgaaaatta aaaatgcagc gaaggcacaa gaagtaccta    293340
     aaactagcac acagtctgct aaacgtgaat taacggttgt agcaacagcg tatactgctg    293400
     atccaagtga aaatggtaca tatggtggac gtgtattaag tgcaatgggg cataatttaa    293460
     tgaaaaatcc gaatatgaga attatagcag ttgacccgaa agtaattcca ttagggggta    293520
     gaaaattatg gtgaagcaat cgctggtgat accggtagtg ccattaaagg taatcgtatt    293580
     gatgttttag taggttcaaa aagtaaggcc atggattggg gaagacaaac tgttaaagta    293640
     aaagttctat gataattatg gttacccaaa tagaagtcag ttctctttat tgagactggc    293700
     ttttattttt atatgtatta attatttcaa aggtggatgt agtaaatgaa aaataataaa    293760
     ctttcagata tagagattta caatctatgt gttaagtaat taaaaaattg tctaatttat    293820
     aatatagctg taaaaaaata caaatcattc tattccacaa ccgggccagc tcttatgaag    293880
     taatactgat ataggaggcg ataggagcca aggattaaac aattggcaat gataggatga    293940
     aagggtggat aattatgagc agttattttc cgaaagtggg gaggctaatt ggtgtaataa    294000
     gtatgcttgt cattttgctt tcatcatttt ggcttatatg gaatggagaa acaaacattc    294060
     gttatagtgg ggatcatgag ggaacgatgt cttttgggaa caagtggata ccagttatta    294120
     tcggtatatt cctcgtccgt ttcttaccat ttcatcgtaa aaattacaat cccattcagc    294180
     agcacgaacc aaggcatatc atgattcaaa cttttgtctt attcttgagc ggattcctct    294240
     tcacgatttg tcttctcatc gcgaactttg aaggaatggc gctccaattg tggtttatga    294300
     tatctaaaat tattttatta ttgttaactc cattaatgct tcttttgttt tatcaaagta    294360
     accccaacaa agaacggttc aaacctgtaa aatcactggt gagtaataga tggtatcggc    294420
     ttacaccgct tatggtcatt ataatatggg gttacttcaa cttcttttct gtattctcta    294480
     caccatttgt ttcaatagga atggatcgaa cgattttaat cgcaacttta ttcctaggat    294540
     tttttattaa tagtgtcctt gaagagattt tttatagggt ttggttgcaa acacgtttgg    294600
     aattattact aggtacctgg ccggcaattc ttcttacctc gctcttatgg gcgagctggc    294660
     atattgcaat acatggctct ggtcattggg ggactgatac ggccacggtc attacgaacc    294720
     ttggtatcgt aggtctattc cttggatatt tgtgggcgcg ctatcgcaag gtgtgggtaa    294780
     ttattattgt acatggattc attaatgcac atccacagca actacttgag atcttgttta    294840
     attaaacggc gctattggtg agtggaactt ttatttatac atgactgtgt tgttatattt    294900
     ttagagtggt gaagtctctt acattaagat taaacaaata tatgtataac cccgtcctaa    294960
     atgtagaacg gggttatact tgtttgaacc tttatagttg tagcgaatag ataaataaat    295020
     aaataaatga atgaactgaa gcggttagag tggttaaaag gctgttaagt ataattatcc    295080
     aaagaataaa tgcacttagt taagttttag agagtttatt atggtaagga tttcatctaa    295140
     tttaaaatta taattatctc ccttttttat cctgtatatg aaataaagtt tattgagctg    295200
     actagcaggg taataaaata tttttagaga agtatggttt attaaagtat tactaaaaag    295260
     gaaggatgat tctacatgat aggaactgat agtaaaaaac aggaaatttt aaaagcttac    295320
     cagttcagac atgcttgcaa ggtatttgac accaaaaaaa agatttcgga tgaagatttt    295380
     cactttattt tggagacagg tagattgtct ccaagttcag ttggtttgga gccgtggaag    295440
     tttgtcgtaa tccaggatga agcgcttcgt gaaaaattaa aatctgtatc tggcggtgcc    295500
     cagggacaac ttcctactgc cagccatttt gtaattatat tggcaagaag caaagaaggc    295560
     ttaaggcatg attccgctca cgtgatcaaa atgatgaaag acattcatca tatgcctgaa    295620
     gaagttgtgc aaaatctttc tggtttttac aaatccttcg ttgaaacaga gctggaagat    295680
     aatgaccgcc tcgtttttga atgggcaagt aaacaaacat atatagcatt aggaaacatg    295740
     atgacagctg cggctcagat tggtattgat tcctgtccga tagaaggttt tgataaaaag    295800
     caggtgaacg ctattttgca aaacgagggt atcattgacg gcaacgattt cggtgtagcc    295860
     tgtatggtcg ctttcggata taggaaagag gattccaaac gtccaaaaac aagacaaaat    295920
     ctcgatgaaa ttgttgcgtg gcgataaaac tgtagatgat gtttctcagc attaagggca    295980
     cgattgtaga gcaatacaag cagaaaatga tttaactttt tataaaaaaa attcactagc    296040
     aacacacaac ccaaacattt tgaacaaact tttttcgaaa tgtttgggtt tcctctgttg    296100
     gaaaatcact tgttgtaaca tgctttgttc aaattttata ttatattatc tttaatttta    296160
     tatataaaat taaagataat ataatatgat gaaagcgagt aaatacttct aaatctatct    296220
     tgcaaaagga tatatctacg catacatatg ccataggtac gtcctttttt cgttgtttat    296280
     aagtccctga aaaaagagag gggaaagatc tattgcgtac gagtgaaaat gaaactccta    296340
     agagtatcat tggtgaaatt tcacattatg ttaatgcgct ttttttaaat actttacttt    296400
     tagcttgatg gttgtatagg aatagaattt ttaaactgta ttgtaaatca gcagttgaaa    296460
     ctggtaacta tctactgtta ggacgcttaa aggtggccga ggacaaaggg gaggggcatg    296520
     tgccaaataa tttgtacatt gtcaaattgt ttatacatat ttgaattgtt tgtgtatatt    296580
     ttattctaca gtatggatga aaaacggttc tttattcact taaataacat tggcatagtt    296640
     tttgcttgta taaatttaag gaaggaggat tgaatgtaag aaatctgtat tagtaatagt    296700
     aaaaaacaag ctactattgc atcattgatc ttacttgtat ttatagcgaa actgtaaata    296760
     catacaaata agaatgttcc gcttttaaaa ttcagaattt tcttttaatt attagggggt    296820
     aacagtatgg ttaaatattc aagaatttct aaactgattg ttggtgttgg actcgtgaca    296880
     atatcatgta gtggtttaca aattcaagca gagacaaaag aaaaaaatgt gaagaacgta    296940
     ttacaaatgg agccggtagg attaaggaaa tccgttgatg agttagcgca cccttcgaac    297000
     gtgcaagaaa atggatcatt tactaaacgt ttaaagttag cagatttatc gcagcgtcca    297060
     ccgatgccaa atgagaatgc taaacagctt gttgaagaaa agaaatattc aatggctgaa    297120
     ttaaatcaat taagcaacaa gcaattgacc gatcttctgg ttacgattca atggtatcaa    297180
     attccggagt tatttcagtt taataatgat agtctcaaat tctatcaaga tgatagccgt    297240
     atgcaggcaa tcattgctaa gctagcagaa caaggacaag cctatacgaa agatgactca    297300
     aaaggaattg agacattagt agaagtttta cgctcaggtt tttatttagg tttttatcat    297360
     caagaattaa gtaaactaag tgaacgtgtc tatcatgata aatgtttgcc agctttaaaa    297420
     acaattgcga agaacccgaa ttttaaactt ggtacaacag aacaaaataa agtaatttcg    297480
     tcttatggga tgttaattgg aggggcgtca gctgatgtag aagttattca atatgcaggt    297540
     gaaatcttta aacaatataa cgataatctt tctacgttta ttgaagatcg aactaaaggc    297600
     gatgctgtat ataatttgat gaaagaagtt gattatgaag ttcaatcgta tatgaatgct    297660
     acaggaaaag aaccaaaaga tatgctgtgg tatggaaaaa ttgatggctt tattaatgag    297720
     ataaatcgtt ttgcactaat aggtacagta acagacaaaa acggatggct aattaataat    297780
     ggtatttact atgctagtcg ttttggcaag ttttatagta caccaacaaa aggacagcaa    297840
     gttgttacag aagcaatggg gatatatcca tatttagggc aacaatattt tgctgcagca    297900
     gaacaaattg ctactaatta cggcgggata gatgcaaatg gaaaaacggt aaatttagat    297960
     caaattcgag aagatggtaa gaaacattat ttgccaaaaa catatacatt tgatgatggg    298020
     gctattgtct ttaaagcggg agataaagtt agcgaagaaa aaattaaacg tttatattgg    298080
     gcagcaaaag aagtacgatc tcaatattat cgtacagttg gtagtgataa accacttgaa    298140
     agtggacatg ctgatgatgt gttaacaatg gttatttata atagtccgga tgaatatcaa    298200
     tttaaccgtc aactatacgg ctatgaaaca aataatggtg gaatttatat tgaaggaaca    298260
     ggaaccttct ttacatatga acgtacacca cagcagagta tttatagttt ggaagaattg    298320
     tttcgtcacg aatttacaca ctatttacag ggcagatacg aagttccggg attatggggt    298380
     caaggagaaa tgtatcaaaa tgaacgctta acatggtttg aagaaggaaa tgcggagttt    298440
     tttgcaggct caacgcgatt agacagtgta gtaccgcgaa aaagtatcat tggtggattg    298500
     tctaatgatc cttcgaaacg ttacacagca gcgcaaacat taaatgcaaa atacggaacg    298560
     tgggattttt ataattactc gtttgcattg caatcgtata tgtataataa ccgtcctgat    298620
     atgtttgata aagtgcatga tttaattcgt acaaatgatg ttccaggtta cgatgcgtac    298680
     cgttctacat taagtaaaga taataaatta aatgaagaat atcaaactta catgcaaatg    298740
     ctgatagata atcgtgataa gtatacaatt ccgcaagtat cagatgatta tgtagcacag    298800
     cacaatccaa aaccgctttc agatgttgcg tcagatatca ccaatgaagc gaagctaaaa    298860
     aatgtgaagg taacaaagaa taaatcacaa ttctttaata ccttcacact acaaggaaca    298920
     tatacaggaa gtgcggcaaa aggggagaat gaggattgga aagtgatgaa ccaagcaaca    298980
     aatgatatgc tgaagcatct tgcagaaaaa gagtggagcg gatacaaaac attaaatgct    299040
     tattttgtaa attatcgtgt caatgccgct ggacaatttg aatatgatgt tgtgtttagc    299100
     ggagtgaata cagaagaagg tactgctgta gaaaaagaac cgaataattc atttgatgca    299160
     gcgaatccat tatctttgaa cgcgttatta agaggaaact taagtgatca agatcaagtt    299220
     gacagatttg ttatcgatgt aaaggaccca aaagatttac aaattaccgt tacgaacgaa    299280
     caaaaccttg gactgaactg ggtgttatat tctgaatcag atctaaataa ttatgtaact    299340
     tatgcaacaa aacgcgatgg aaacaaattg cttggaaatt ataatgcgaa gccagggaaa    299400
     tattacttaa gtgtatataa atatggcggt ggaacaggga attttactgt agaagtaaaa    299460
     taattataag tagtcgtttt tagacaaata gatgccccta ggcatctatt tgtctttttt    299520
     taatgaaatg atgatgtata tacaaaagat aaactccaat accttctctt aaaaaatcaa    299580
     ggattttata ctagggttta tttcatatgc aaatttttaa atagttcata tcaaatcttt    299640
     agtaaacaga aaaaaatcta gttgaatgga ttcttactta atcttagctt gatggctatg    299700
     gggttccagc acatcactat caagctaaga aatgtaaata cccccaaaac gagaaaattt    299760
     acattttttt gttttggagt agtttttcga aaaaacaaca gcaaaaatct ctcgatattg    299820
     gagcatccca aaaataatcg gttttgggat actaatttac agcaattcat aaatgattca    299880
     aaaggtctat gtatttttga agtactgcaa aatattatct cgaacttttt gacacattgt    299940
     ttttcataga aattacacca cattaaaagg tgtacctttt gggaatgcta ataattgttt    300000
     ttatatgtaa ctacataaaa tgaatttgtt tattgttaat tttttacatc aaaagtgaaa    300060
     tagatgagca ggcgaaatga atgtacaagt gaaatgaatg tgtatcagat agtggctata    300120
     aaaagtggac gagttaatct tgttacttta aaaagtcagg agttttataa atgagtaaaa    300180
     aaaagcaaga agcagaacaa aaataataca aaaaaacttg gaggtgagaa aggcagggaa    300240
     agtaatgtga gaaaagaaaa tgccgtttct aagattgagt tagtaatcca ggtgattaaa    300300
     tttgtaatgg tagtcgttga atttattaat tggtttctgt gagactgttt tgagagtcct    300360
     aatttaatag gactctttta aaattttctt tttatgttct accttaaaaa taacaaagga    300420
     gagtaataat ttcatataat agaaggatat tgagaactta tgatttaggg ttctggtgca    300480
     aaaaatctct taaacttgga catactgata ttactactct acaaaaggtg tgtgatcagt    300540
     atggaaaagg agaatttgtt caaatggaag cattatcagc ctgaactaat cttattaaca    300600
     gtaagatggt acctacggta caatttgagc tttcgtaacc tggtggaaat gatggaggaa    300660
     agaggattat caattgctca cacaacgatt atgcgctggg ttcatcaata tggacctcaa    300720
     ttagaagaga aagtacgaca tcatctaaaa tcaaccaatg attcatggag agtcgatgaa    300780
     acctatatta aagtaaaagg gcaatggatg tatttatatc gtgccgttga ttcaaaaggg    300840
     aataccattg attttcatct aagtaaatca agagataaac aagccgccaa gtgctttttc    300900
     aagaaagccc tggctttttc gtacgtttct aaacctcgcg tgataacagt agataagaac    300960
     cctgcctatc ctgtagcaat tcaagcgttg aaagaagaaa aacatatgcc tgaaggcatc    301020
     aagctaagac aagttagata tctcaataat atagtggaac aagatcatcg ttttattaag    301080
     aaacgtgtgc gttctatgtt agggttcaag tcttttggca cagctacatc cattcttgca    301140
     ggagtagaag ctatgcatat gattaaaaaa gaacagattg atttacggga tcagtctgtt    301200
     caaaatcaga aagaattcat ccatcaattg tttgggctaa cagcataaaa tacaattctg    301260
     ctcgaaatat acgcgctata ttctctttta ttttatcttt gcaccagaac caaaaataaa    301320
     actgactcta gttagccagt ttttacatat cccaaaagtc ggtagattta acgtttggtt    301380
     ttatttgcct aataactttt aaaatctttt tcattacagt tggactaggt atgtattctt    301440
     tatcattgca cgcctttgaa actgtaggac gacttaattt cgcggtcttt tctaaatcat    301500
     tttgggtgaa gccattccga tctaaaaaat cacctaattt cgttcggttt ttccctccga    301560
     atttccaaaa cacttaaatc cctcctgaac ctattttcaa cattgtggac ataaatgtaa    301620
     aaaactattc gcatagacgg caaaagtttt ttacataatg tacaagctgt ccacaatatg    301680
     atgtatcaaa gcagctacca cggtatttat taaggtagaa gaatacgagg ttaccaaagt    301740
     aagttgcgaa tgattaccac agtatttatc aagatttcta ccaaggtaaa actaccacgg    301800
     tattaagtag atgaagctat gtaatatcta cattctaaat tctgtttata aagggggcat    301860
     ttaaatgcgt gctaggaaag aaacaattcc ttttcgcgag tttatggatc ggtcatacaa    301920
     agataaagaa cagaaaatcc gtaaatacaa ttcattaagt cctttcgcat tccttcatat    301980
     gtcggatcag gtattacata cttacattgc attaggagtt atgggaacga ttttaatcgg    302040
     agcagtcatg ttagaaaaat acttggtgcg acatgactat atatcagcag ctaaatttgt    302100
     aagtgaaggt atttatcacg gaacgcgaat tggtggagtt tgtttgattg gatatgtatt    302160
     tgttcgtatc gtaatcatgt tttaaggagg gaagagagta atggggatta taaaggagtg    302220
     ggttcgtacg caaaggttaa ggaatcagct tatggaggtg ttcggaaaag caggtttata    302280
     tacggaacat caaacgcgtg ggggaaaagt gcctatttat ccaaaggtac ataatgtttc    302340
     ttcttcagca gaaagcgtga ggtatgtttt taccatacca aacggattag atccacagaa    302400
     gattgaaaag aagtggtttt gttttcagca aatattagga ccgaatatta cgattgaagg    302460
     ggatgtgaaa aagtttgtac tacatgtatt ccgttcagat gctggattaa aaccatacaa    302520
     ttactgttat aaagaatggc agcccttatt aaaagggtac cgtcttcctg ttgtggttgg    302580
     ccgggatcaa tttggaaaaa cgattacgta cgatatggtt gattccaata caccacactt    302640
     attaatagca ggggaaacgg gaagcgggaa aagtagtatg gtacgtgttg tactatccac    302700
     actcattcaa tatatgtctc ctgatacgtt gcatttgtat cttggagatt taaaaaactc    302760
     tgaatttcat ttcttgcgaa gagtgaagca tgtaaaagaa gtttgtatgg aagaaattga    302820
     aatgaaaata atgcttcaaa agatgtggaa ggaaattaga gaacgaagaa aacttatgga    302880
     agaatatgag gttgatcata ttgatgcgta caacaagtta aatccagatc atcaaaaacc    302940
     atatattcta cttgctattg atgaagtggc catgctaaaa gatgaaaaag agtgtatgac    303000
     tacaattgaa aagatttcag cagtcggccg atcacttggg gtgtttctta tgcttagtat    303060
     gcagcggcca gatgcgaaag tgttggatgg taagttaaag ctaaatatga ccgttagaat    303120
     cggctttaaa tgtgatagtg caattaatag taatatcatg ggtactcctg gttcagagca    303180
     tttagagcaa tctggccaaa tgattttaaa acgaaatgga ttaaagaaag tgcaagctcc    303240
     ttatttggaa ttaagtaagg cgaaacaaat tgttgaaccg tatcgcatgt ctaaaggaga    303300
     gaggatactc cataattctt tgcaggaaga aatgccgcta tttggggtgt tagatgatga    303360
     agagtagaga taaaggaatc ctgaatgatt tgaatcgatt tagatgcatg tcccgtgacg    303420
     atattattga cttgcatttt caaggcttaa agaatgcggt aacttgttgt aatacggtta    303480
     tgaaacgatt aagaagagac ggctatgttg atgctaacgt attgcagcac ccatacattt    303540
     attttccaca acccagttct atcagaaaaa cgagtcaaaa aattcctcat ttccttggta    303600
     ttgtggacgt atacaaacaa ctcgttcatt atgaaaatcc taaactattc gaagttgaac    303660
     caaagtatag gaaagaatat atggagccgg atgcttttac aatatggcgt agatcgccat    303720
     tctttattga agttcaaaag tcagtgtaca gtaaaaagct aatgcaagat aagataaata    303780
     gatatgagtt atacttccat aaccaagaat ggcataatga atattggcaa ccgaaagctt    303840
     ctaaattctt tccttcaatc cttatcatta ctgacaaaca ttacgacgtt caatctcctt    303900
     atttccgtat attccaggcg aattctatag aaagttttat gaataattta acagtgaaat    303960
     cataaagaaa gcctgcatag tgcagagctt ttttcttttt gataatctat taagccgtgt    304020
     gtgatgctga ttgttagaag gtggtaaatc ttcttctgga atgatatctc cataattaat    304080
     aatttgtaca ataacctctc cattatcact atatccattc atatcaacaa gttgtcccac    304140
     atatccgttt gtaccaatat ctttttaaag tactctaaaa aatgcacttt atcttatctt    304200
     tatcttatct ttactttatt tttaaatttc tatattaaac tttaaaccta aaggaaatga    304260
     atttgagtct aaaaaggggc agggaaatag atgattatta catcttttgt aaataaccaa    304320
     ccaccattga aaaatggaat ttcttatacg aggaggaata tatgaagaat acgagtaaaa    304380
     aacaaattat tatattattc tttattagta ttttaggttt aggaacaatg cttggaatac    304440
     tatattttaa tcataaaact aatattcaac aaaataaagc gcttgctacc gaaaaacgtg    304500
     tattgcaata tgagcctacc ttgaaaaaag aattagaaaa atataattta ggagggaaaa    304560
     cagcagtttt attaggaatt atgtaccaag agagtagagg tgagggaaac gaccctatgc    304620
     agtcatctga atcacttgga ttaaagccaa atgaaattca agagacaagc ttgagcatta    304680
     aacaaggggt aaaacacttt gctaaaatgt acaaatatgg aacggaaaaa gatgttagca    304740
     tggatacaat tattcaaagc tataatatgg ggccagggta tattgatttt attgctagtc    304800
     aagaagttaa acaacactcg gaagattcgg ccaaaaagtt ttctaagatg aaagttaatc    304860
     aaaacccagc gatgtacact tgtggtggaa ataaaaataa ttttaggtat ccatattgtt    304920
     atggtgattt cacatatgcc acaaaggtga atgaaaaaac aatacttatt gaagaacttc    304980
     ttcgaaatgt acatgactct tctaaataag ctgtataatg ataccgtcgg ttttggtgca    305040
     aaaatagaat aaaagataat aaagcgcata gattcctaac ggaatcgtat cttatgccgc    305100
     aagcccaaac aattgatgga tgaattcttt ttgattttgg acagactggt cccgtaaatc    305160
     aacctgttct tttttaatca tatgcatgac ttctactcca gaaagaatgg atgtagctgt    305220
     gtcaaaacat ttgaacccta gcatagaacg aattcgcttc tttataaaac gatgatcttg    305280
     ttctactatg ttattcaagt acttttgttg tctaagtcgc ataccaccag gtatgctttt    305340
     ttcttttttc aactgttcaa ttgcaatagg ataagctgga tttttatcga ctgttataac    305400
     aggaggtttt gaaacatgaa aagactgcaa ggccttcttg aaaaagtgct ttgcagcctt    305460
     ctggtctctt gttttgctta ggtaaaaatc gattgtattt ccttttgaat caacagcacg    305520
     atacaggtac atccattgac cttttacttt gatatatgtt tcatcgactc tccaggagtc    305580
     atttgtttgt ttaaggtgac ttcggattcg tttgtccaat tcaggaccgt actgatgaac    305640
     ccaacgcata atcgttgtat gagaaatgga taagccccgt tcctccatca tttccactaa    305700
     atcacgaaaa ctgaggttgt accgtaggta ccatcttacc gttaacaaaa taatatcagg    305760
     ctgataatgt ttccatttga atacatattc cttttccata ccaatcacgc accttcttta    305820
     gattagtagt atcagtatgt ccaagatttg tagatttatt gcaattgtcc tgaagttttt    305880
     gcaccagaac ctcttttaag gcagccatgt tgaatcctcc aattattaat tgtttaatat    305940
     aatgaaaaaa ggacaaacct agtcctgtta gggatatata ggtttgtcct ttagtatgtg    306000
     gggtaatgat atgtttaatt accattatta taactgaatt tacaaatatt ttcaattagg    306060
     tctgacatct tattaacagg catactagta atattaaaat ctattataaa tatatatctt    306120
     atatattaaa aagaaataaa gataaaactt ttataggtta tcaaaaatag ggaatagact    306180
     tactcccaca agggaaaatt tgatataaga gcataaaaaa tcataaattg tagaaaatgt    306240
     ttccgtagac tcaaggatta atagactttc aattctacaa aaaagcataa agaaaattat    306300
     atatttctac atgaaatcgg aaagaaattg atacagatta cattatattt attcaaccat    306360
     gtaaacaggg cggattttca ttattttggt aaatggagta gtattcatcg aagaaatatc    306420
     cacaatttgt ccagataaag ctgctatttg ttaacattat tcagtattta cacataatcc    306480
     acactattat tgatgatttt tattagatgg attgaacggc actagtattt tcaaggctat    306540
     tgggaaaata ttattcacat ttgatcatat ttttcctcat atccactgtt ttttataatt    306600
     ttccttccga ttttttgtag gtatagtagg ataggtttta cttcagaaga agaatactcc    306660
     ctagtgttat gtggagagtt atgtatagat agaagagaat ttgtatagaa gtgcataaaa    306720
     aaagactcca ttttacatga agtccttctg atttggtatt tataaataga gtattagaaa    306780
     agggttacta ataaaacaaa cacgaatagc cctctacttt cgattttttc aaaaatagag    306840
     agcttgttac tattatttta tttccattgc gcttagcacc tgatctggag ctgttattgt    306900
     tgcaccagca cgtattaagt gttcaaaggt acgcataaac tctagtaaat taaattgctt    306960
     tggcagctca attacacgaa gtttttcttg tggtagttta tcaattgctt cgataaacca    307020
     ttcacgtaca tcacttggaa tcgtgcgttc tttatggcca cgaactttta atttttcacg    307080
     catttcaatt tctaaagcga tatatgcatg gagattcact ccctgatcat atgcatattt    307140
     tctaaataac gtttcttcct ggtattttag gtaattacgg tgataagatt cttcagtcac    307200
     tggtactgca aacttctgct tgagtagtgc atgcacattt ttaaacatct tcttaatgct    307260
     atgaagagag tacattgaat aatgtagacc aaaattaaag acagcttgtt cgcggtcact    307320
     atttctctct tttggtatat gctgtgcaat aagaggatag ataccttctt ttgctgctgt    307380
     atcaagaatt tgatattgag atgtttgatg caatagtttt ttcaatgtat atacaatttt    307440
     cgttggatat ccttcttttc gatcaaccat gtcacgaagt ccacgaatca caccacgaat    307500
     ttgacgatga caagtatgct ttaaaacatg aatgaattta ttcatgtctg aagaaagttc    307560
     accgatattc atttcttgta ggactgattc aataaatttc gctttacgag cataggtagc    307620
     ttttggtgta aatggatccc tgtgttgctc ttctccggat tctttcgtac ataagaagtc    307680
     cgaatggata gatagatata aggttgtata tcgctttgta tgctttacac ctttttgcat    307740
     tttgcaaatt ttgaataggg gattctccgt acacggtaat gcagttgtta attcttcgat    307800
     aaccgcacgg atctggtgcg gatatttttt atgtaagaaa cgatacatcc caccaaagtg    307860
     agttttgtta cctctttcat cctgcttgtc caaagaacgc tttaacgttg tttctgtatg    307920
     ttgttgcata gcaatgtcta agaatagttt cttagctgct acagatagct taaagaaagc    307980
     ctttgtaaat acaacaggac taatatatac gtatggattt gtcttttctg tttcttcatt    308040
     cataaaatga gtaagtttga ttgtatagcg gccatctacg ccattttcga tagcgattat    308100
     gttatgtatg cttaatttct ttagagcgat atagaattgt gagtgctgga tatgagcaaa    308160
     ttcttcttta tattgcttgt aatcttccca catcatatgt atcgttacat ttggaatgac    308220
     accatttgta taacatttct tatgtagata taagaacact tcaagatctg cattcgtaat    308280
     accatataat ttatgttttc ttcctgtttt ctctgcaagt gcagacattg cacgacgtga    308340
     aaaagatggt ttagcttgtt cgacaaagcc ttctacatcc gcaatacgtt cttcgtatgt    308400
     catgtgctgc agaatatctt ctaaatatgt atctttatag ctgtagtact tcttttcaaa    308460
     tgcttctaca aacttttgcc aagactttag tgttactaaa actgcatttg ttgtttcacc    308520
     atttaagcta cgctgatttt gaataataaa tgatttcccc atctttttca cctccgttct    308580
     acaaattcag aaatatatgc taaaagacta taaaatatac caattatgat tatagcaaat    308640
     cgaaaaatgg tgaaaggtgc tcctttaaga agaaaaatag caacttgcaa cagcctctaa    308700
     aggcaagtgt atcaagggat tggagaattc tactgatttt ttttgtgtta aggataccgc    308760
     aaacgtgttg caagttgaat tatatgtaaa tgaataagta aagaaacacc taaccccttg    308820
     atatataagg ggtttaagtg gaaatgccaa aaaaataagg gtaaggatac cgcaaacatg    308880
     ttgcaagtta agaagtacgc ctattaaccg taaattatac cgattatcgt tgatatgata    308940
     ggttttatta gagttttatg aattgcgata gggtaaggat accgcaaaca gtgttgcatc    309000
     ttatgaaaaa ataagggtaa ggataccgca aacgtgttgc aagttgagtt atatgtaaat    309060
     gaataagtaa aaaacatcta atcccttgat atataagaga ttcgagtgaa aatgccaaaa    309120
     aagttagggg aaggataccg taaatatgtt gcgttttatt tgtataactt gttgtaaata    309180
     taaaaaacac acttaaaaat tttaaactag aacgattttg tgtgtaatgt attaggttga    309240
     gaaaagattg tactgttgca agttggacga agtagggtaa ggataccgca aacgtgttgc    309300
     aagttgtaga gttaaggaaa gaaaagcgca aaaggaatgc aagtaaagag gaatagggaa    309360
     aagaaagagc aaacgtgttg caagttgtag agttaaggaa agaaaagcgc aaaaggaatg    309420
     taagtaaaga ggaataggga aaagaaagag caaacgtgtt gcaagttgta gagttaagga    309480
     aagaaaagcg caaaaggaat gcaagtaaag aggaataggg aaaagaaaga gcaaacgtgt    309540
     tgcaagttgt agagttaagg aaagaaaagc gcaaaaggaa tgcaagtaaa gaggaatagg    309600
     gaaaagaaag agcaaacatg ttgcaagttg tagagttaag gaaagaaaag cgcaaaagga    309660
     atgcaagtaa agaggaatag ggaaaagaaa gagcaaacac gttgcaggtt gtagaattaa    309720
     ggagaagaaa cagcaaaacc ttttaattat ctgttacaat aaattaaata taatagtagt    309780
     aaagattttt atgatgaaaa ctactttgtt gtgatccatg gtttagggag gaatataaag    309840
     tggataactt attacaaatg ttccgagatg cattgctaat ctctgagcca atttataaaa    309900
     agaatgagcc attatggaat aaatggaatg catactttaa agatgttaaa aacaataata    309960
     ataaagtact aacctcaccc tatgcttctc catcatttac tgcattagta tcttggttag    310020
     agaaaaagca agagtccgga gttacattag tacaaattta tgcaaaaatt gattcttata    310080
     aggaagaaat atataaagaa attgaaggat ttatagaaaa agaatttcaa gatgtagcac    310140
     cttcaaattc cataatatta gaaaatgatc aaaatgcaga taagctaaat acagtgaacc    310200
     atgaggatta ttacgaggta aataattctg ctgtttacta taaattaaga gatggaattg    310260
     caaagaatca atttgaagaa gatgaaaaaa gtaaagtctt acagtatccc attgaaacga    310320
     agtcttctaa tggtgtagct caactttctt cacacaaaga cgaggattta agacttacaa    310380
     acactgaaga atcagctcga tggaataccc ttgttgatga tgtaatgagt aatatggatg    310440
     atttaacggc agactgttta gatgcaatta caatacagtg gataaatgag gcaaaatctc    310500
     cagatgaatt cattgatttt tcatatgagc aagttttaga gatgtgcaat attccaaaga    310560
     cagtcgtcaa aaataaagaa tattatcgag cggaagataa aattaaaata gcaaagagga    310620
     ttgcggcttt agcaagtatt tttatctatt taaatgatga taatgaggtc gtagtactaa    310680
     acgatcgtga tgacgaagga gaacgagtag aattaaagcg tgaggttatt aaaaggttat    310740
     ttgttttaga ttcggttgta ttgtggagac atagtgttac aaacgaatat atggggattg    310800
     aatcttgtcg tattaagcca ggtagttttt taacgaatta tttatacgga tcaaataata    310860
     caacagcatt attgtctaaa aaggcccttg aatacaatag ttatagacat aaatatcata    310920
     aaaggttaat tcgatacttg acatggcaat ggagaattag acaaatgtat tcatcattga    310980
     aaaagcccta ttctatagga ggggacaagg ggctactagc agtaatggat attccaaaag    311040
     attggaagcc gaatcgtatt agagaacagc tagagaatgt tttaatggat ttagaaaatg    311100
     aaaaagtaat ctctcattgg gagtatagtg acccgcttga tgaacaacaa atttggaaac    311160
     gtaactggtt taaaaattat tacgctaact tagggataac tattttacca cctgaggaaa    311220
     tgctacagtc aatggatagt ggaataggaa agaaatttat agaggaacca caagagcaat    311280
     tacctgtagt aacagttgtt gaagaggtta gggagactgt ggaaccagtc gaacaaagag    311340
     agaagaaaat tcgggatcaa atactgaaag tgcataatga aaaaaatgta agtattcgtg    311400
     aaatagcaga tgaagttagt atttcgccat ctacgctgtc tagattttgt aattataaaa    311460
     caaaacgctt gtctaaaaaa gcattagaaa agttaacgaa atggtgtgag agacaagaaa    311520
     tactagaaaa aatgtaatgt agactaaaaa ctactcttag aaatagagaa aatgaaaata    311580
     cacatacatt atgtatgtgt attttattta gaataataga tgatagaaac cacctactgc    311640
     attttaaaat gactgttgat attgtcttgt gagaatgaat tcatttaata tagtagttaa    311700
     aagggggagt attgaaaatg aaattaaata attgggatga aattagtatt gaaaaaagta    311760
     caaacattgg taaagaagaa atggagttat tattactagc tgatccttca ccagaagtag    311820
     ttaatggata ccttaaacaa ggggactgtt ttgttttgaa aaaggatgct attactgtag    311880
     gtattatgat tttaattcct actcgtcctg aaacaattga aattataaat atagcagttt    311940
     ctgaaaaaga acagggaaaa gggtatggga aatatttgct tgggtttgct atagactatg    312000
     ctaaaaaaga gaaatataaa accatagaaa tagggacggg aaattctagc ttaatgcaat    312060
     taggccttta tcaaaaatgt gggtttagaa taacaaatgt ggatagggat tttttcttac    312120
     gcaattatga agaggaaata tatgaaaacg gtattcaatg tatagatatg attaggttaa    312180
     cgcaatattt ataaaaaaat taaaaagtaa tcatatatca aaaatcgtaa ctctcagttg    312240
     attgatgaga tgttacgatt ttttattttg aataatgtaa accttaaccc ttcattaaaa    312300
     aaatgaagta tgtgagacgg ctggaatcga attgtaaatt cttttaatgc aactttatat    312360
     ttagaaaagg tatatctttt atagttttaa tttcaaaatg tttttattat tcagatagat    312420
     gtttttctaa taatttcaat aaaaagtaaa aacagtaaaa attattacag ttaataataa    312480
     gttaatactc ttattaacaa attgatgagt tatatttttc gaattaaaag agaggaaatt    312540
     ctttcttttt tgagggaggt tcttaataaa tgcagctata acaagtatta tgttgtttta    312600
     acgatataag aatatagttt ttttagatta atatttttat aaaaataaaa tttattctac    312660
     attgagaaag taaaaataag gaaaaaaatg attgaatccc ataaagtaac atgtgaatat    312720
     tatagatata taaaatacat cgaaattcta gatcattttt ataaatctaa atgtgcaact    312780
     aatgaggagg aatgatagtg ttaataattt agtttgtttc attattcaat catttacgta    312840
     catctatggg ctttcataac gcgcaattat cttttactgg taagaatttt aatatcaaat    312900
     ttctagggaa gtgataagta atggtcactg tattaaataa tgaaattaaa aaaacattag    312960
     ttgaaaaaat tgtaaataaa agtgcgtgta ttgggtatat tggtctagga tatgttggac    313020
     taccatcggc tcttaaatgt ttagaagtag gttatacggt aagaggattc gataaaaacc    313080
     tcactaaaat agaaaaatta gaatgtggaa caagttatat cagtgatatt caggatactg    313140
     aaattcaaga cgctttacat acaaatagat tttttattag tacagaaatg aattatataa    313200
     atgaatgtga tgttgttgtt atatgtgttc ctactccttt agaaaaagat agtaaacaac    313260
     cagatttaac atatattcat tcagcagtta atgaattagt caaatacatt agaaagggta    313320
     cattaattat tctagaaagt actacttatc caggtacaac aagagaagag attttatata    313380
     aattagaaca tgaaactaat tttgaaattg gtacagatat ttttgtagca tactccccag    313440
     agaggattga ccctgcgaat aagtcatttt caatccaaga tattattaaa attgtaggtg    313500
     gagttacgcc taattgtaca gattgtgctg cagcctttta tagtcaccta attaagggga    313560
     ttcataaggt tagtagtcca gaagtggcag agacagcgaa gttattagaa aacacttacc    313620
     gttttataaa tattgctttt attaatgaaa tgacacaaat atgtaatgaa ttaaacatta    313680
     atatttggga agtaattgat gcctctggga ctaagccgtt tggatttcaa aaattctatc    313740
     caggtcctgg tgtaggagga cattgtattc caattgatcc tatatatttt aaatggattg    313800
     caaataataa agatttagca acaaaaatga ttgatgtagc acaagagatt aacgaaaata    313860
     tgccaaatta tattattaaa agggcattac agttactaca agatgaagat ggaaagaatg    313920
     ttcttatgat tggcgtagca tataaaaaaa atgttaacga tgccagagaa tcgtcagctt    313980
     tggatattat gaatggttta atgttagaag ggtataacgt cgattatcat gatccattta    314040
     ttgaggagct aattgtggac aatcataaag taaaaaaatc tattaattta actacgaatg    314100
     cattaaataa ataccattta attattgttc atacggatca tgattgcatt aattttaatt    314160
     tactcaatgg agtaaattgc ttaattttag atacaagaaa catattaaaa gatcagtcaa    314220
     tatataaaaa aaatattata tgtttgtagg tgattatatg gtagaattta ttccttttta    314280
     tcgaccagaa ataaatgatg aagatgttga gggagttatt cgtgctctta agtctggatg    314340
     gctttcaaag gggccaaaag tgatagagtt tgaagagagt ttaaaagaat atctaaatac    314400
     tggacatgta gtaagttgca attcagggac tgccgcattg catttagcat tattgtcttt    314460
     gggaattgga gtagaagatg aagtaatagt tccaagtttt actttttgtt ctagtgtaaa    314520
     cgttattatg catgtaggtg caaaaccagt atttgtagac atagatgaag aggatttatg    314580
     tcttgatctt catgatgtta aaagaaaaat tactaaaaaa actaaagcaa ttattgctgt    314640
     tcattttgct ggatacccag ccaaattaca agaacttcaa aagctatgta aagaacacgg    314700
     gttatttttg atagaggacg cggcgcatgc attagggact aaatatgata ataccttgat    314760
     tggtacacat ggagatatta tttgttttag tttttatgct accaaaaata taacaacagg    314820
     tgaaggtgga gcgttagtta ctaaaaatga ggagattgct gaaaaagcta gattatatgg    314880
     ctggcatggt atcaccaaga atgcatggaa tcgttatggc gaaaaaggaa gttggcgtta    314940
     tgatgttcta ttacctggat ttaagtataa catgatggat ctgcaagcta gcttagggat    315000
     tagtcagtta aaaagagctg atgaaatgat tgaaaaacgg agaagaatag cggaaatata    315060
     ccaaaaggaa ttaaaagaaa tccaagagta tataacatta cctaactatg taaacaatcc    315120
     aagtataaaa catgcatggc atttatttgt tataaagatt aatcctaatt ctcctatcag    315180
     tagagatcag atgattcaag aaatgaaaaa gagaaatatt gggctgagtg ttcactttat    315240
     tcccgttcat atgcatccat attatcaaga gagatttaat gtacatttac ccaaaacaga    315300
     agaagtattt gatcaaatta tttcattacc attgtatagt gcacttacag aaaatgaggt    315360
     tgaacatatc gttacgtctt taaaaagttt ataccaatta aaggtaggga ggtaaatatt    315420
     tatgaagata ggagttattg gtggcggtgg atttattggt aaacatgtta caaaggagtt    315480
     aatagcaaga ggttatgaag taattatatt tgataaattt aaaccaagta tggatgttcc    315540
     ttttgaagaa attgatatct tagatattgc gacattaaga gaaaagctta ttaatgtgga    315600
     tggggtcata catttagctg cattagtagg tgttgataat tgtcgttcaa atgaagaaga    315660
     tgtagtaagg gtgaattttg aaggcacgaa aaatattgta gaagtttgta tagaaaatgg    315720
     aataggtaag ttattatttt cttctagttc tgaggtgtat ggggatggtg tgagtgttcc    315780
     gtttaaagaa aatgatgtca aaattcccaa atcagcttat ggaaaagcta aattaatgtc    315840
     agaagatttt ttgaaagaat atgctaataa tagttttaaa gtcagagtgg tacgttattt    315900
     taatgtatac ggttcacaac aaaatgaaaa ctttgtgatt tctaagtttt taaaacaagc    315960
     tcataacggc gaaaatatga ctatttatgg ggacgggcag caaattagat gctttagtta    316020
     tattagcgat attgttaacg gaacgatatt agcatttgaa tatgaaagag agaattttgc    316080
     agattttaat ataggaaata acaagcctat atctatggag gaattagcgg ggaaaatcaa    316140
     tgagttaatg ggaaacaaaa gtgaaattga atttcttaat ttaggggatg agggagtaag    316200
     agattctaat attgaaatat tcagaagaat accttcaata gagaaggctc aattattatt    316260
     aaactatcag ccggttattt cattaaatag aggattagag aaaataatag aggagaaata    316320
     tggaaacaca gtatctatat cctaaaaatc ctaaaaaaat taagtatcca atatatcctt    316380
     ctttttggag tgtatttgat catatatatt ttttgaaaag tatatataga tccaatcatt    316440
     ctaatctaaa agagagttta caaactctct accctaattc cgaaattata ttaactaata    316500
     gtggttcgtc ggcattagta gcagggttaa agtatctaaa cataaaaaaa gaggatgaag    316560
     taattttatc aaattttaat tgtcctaatg taatagaggc tgtattaaca gtaggagcaa    316620
     aacctgtatt aattgatttg actactgatt actcactttc tcttaataaa ataaaaaaat    316680
     attcaaatga aaatacaaga gcaattattc ttacacatgt gtatggatgt catgaagatt    316740
     tagaagttat taattgggcc agagacaatg atatttatat aattgatgat gcagcacaag    316800
     caatgttctc ttatcaaaat gaaaaatcaa ttggtagttt aggtgacatt ggaattttaa    316860
     gttttggggg aactaaaccc atcccgagta tagggggagg agcgttactt cttaatcgta    316920
     cggtaaatga cttgtgtgac atggatgaag aaaagaaggc agaagtgttt ttagattata    316980
     aaaaccacct taaaacgcaa ttagctttaa gaatcaagaa gaataggcta ctgagtttat    317040
     ttactgatta ttgggaaaag ttaggaattc ttccttccta taatgatagc aaattggatt    317100
     ctttgccaga ggaaacggaa gttatatatc caaaaacaat gtccacatta cgttcattgc    317160
     taattgatag acacttaaag agaatgaaaa agattttaga aattaatata tataatgcta    317220
     gtttgtgtta tacgatgctg caatcaattg aagaaaagta cggggtaaag attatatttt    317280
     cagctcagaa tgtatatttg aactatttca ctattatttt caaagaacca tctgatagat    317340
     atgaatgttc cgtatatttg gctggaaaag gaatacaaac ttgttggaat tatctacctc    317400
     taagtgaaat ccctatattt tccaagtacg ccactgagtc agaaaatata gaatttttat    317460
     ggtcaagagt attatcaata ccttttaaat atccgttaag gaaaaaagac cttaagtata    317520
     tatgtagtca aattctaata tatttagaga aaaagaagta aaaggtgatt atatggaaat    317580
     cgaaatatgt actgatgccc aatattggga tgcttgtatg gaagaatata atggttctgt    317640
     attccattgt tatgaatggg gaaaattaat ggaattatta cctggtgttc aattttttcc    317700
     agtattaatt aaaacaaggg atacagtagt tttatctcct atatatgtac aggatggtag    317760
     ggtgctggga agtttaattg gttatggagg ccctgtaatc attggccaag ataaaataga    317820
     ttttgcattt tatgaatcga taataaatag gaagtttgaa aataaaattc aaaaactttt    317880
     attacctata acaataaatc cttttcaaag ttatagtgat gaaaagtggg agtataaaga    317940
     aacttatatg ttagatctac caaataattt tgaggattta tggacatcgt gttcaggaaa    318000
     agctaggaca agtgttagat atgcccgtaa acagaatgtt gaaattcggc ctatagcctt    318060
     agaagaatta gatgaatttt acaatttata tcaggaacat aataacagta taggagcgag    318120
     ttattcattt agtagagagt ttttttatta tttatttatt aatttaaaag aaaggatcct    318180
     tttcttagga gcattcttag aagaagaact aattagttcc agtatattta taatggataa    318240
     acaagtttta tattactgga ttaatattaa taatatcaaa gggaaaaata cacaatcttc    318300
     atacttacta ctaaatgttg cgtttgaatt agcaattcat aataaattaa agtatgcgga    318360
     tttaggatat tcacataata aagggattgc tagaccaaag atatactggg gagcagtttt    318420
     gaaaaaatgt ttttgtttaa aagagaggat ttaaactatg attattagtg gccaccaacc    318480
     aagttattta ccttggtatg gtttttttga aaaaattcat aaatcggatg tgtttgtatt    318540
     tcatgatata gcacaatttg aaaagaaagg ttttttaaat agaaatcgta ttaaaacttc    318600
     ccaaggagta tcctggttaa cggttccgat gcaaatgaaa aattataaag aaatcccatt    318660
     gaataagtta aagatagaca atacacaaga ttgggagcga aagcattgga agacaataag    318720
     aattaattac tctaatgcgc cctatttcaa tgtatacaag gattatctag aaaattttta    318780
     ttcagaaaaa tgggataatc tcaatagtat gaatatgaac tttattcatt ttattattca    318840
     agaattaaat attgatacgg aattatatta tgcatcagag ctagagggga ttacagggaa    318900
     aaaaagtgat tttgtattag agctttgtca aaagtttaat gccaatactt attattctgg    318960
     aagtttaggt caagattatt taatagaaag tgattttgag catgaaaata tagaaatcat    319020
     ataccaaagg ataagagagt attcttaccc acagttattt ggagagttta taccgcattt    319080
     atctatgcta gatgttttat taaattgtgg tccagaggaa acagaaaaat taattaaagg    319140
     agtttaaaat catatgaatg tacttgtatt tgctgcgcac ccggatgatg aaattattgg    319200
     tgttggtgga acaatagcaa aacacgtgga acaaggtgat gatgtacatg ttgtaatcct    319260
     tgcagagggg aaatcttcga gatctaaaga atacagagaa ctagatttag aggttaagag    319320
     cctgtcttat aaagaaacgg agggggcatg tactacactt ggtgtaacaa gttttgcgag    319380
     gttagatttt cctgataatc gtcttgatac attgccatta ctagatgttg taaaagaaat    319440
     tgaagagcac attaataaaa taaaccctac gattatttat actcaatacg gtggagatat    319500
     aaatatcgat catactgttg tttatagagc agtgatgaca gctacacgac ctctaccaaa    319560
     tagtaatatt aaatgggtgt ttgcatatga aaccttatct tctactgagt ggaattataa    319620
     tgagaaagat aagtttcttc ccaattattt cgtaaatatt gaagaacatt tggagacaaa    319680
     attaaatgcg atgaaacatt atgaatcgga gttaagggaa tttcctcacc cacgttcaat    319740
     agaagcaatg aagcacaatg cttttgtatg gggagcaaag tcaggatata aagcggctga    319800
     agcatttatg ttagtaagag gaacatggta ggtgaagaga atatgttaat accgcaggta    319860
     ccattctttg gattagatag caaacaaatt gatttaaaat gggttgaaca aggttatgga    319920
     ttagaagcaa atatttttga tggagaatct ttacatgata agtcatatac aacaaagttt    319980
     tcagatgtac tttcttttgt tcaaacactt aatccatctt tattaacctt gcattttcca    320040
     actgataatg cagactattt aaatagtgaa tttataaaaa aacagttata tgagtttatt    320100
     aatcttgcta taaaatataa cgcagcaggt ataacagttc atgctaatca atttatgaac    320160
     atagcagaat ttcaaactta taatcttatt gataatagaa aaagaattat agagttcttt    320220
     aaaatgatag atgaggaaat aaaaggaacc aatatatgga taggtgttga aaacttaccc    320280
     atcattggaa acttaggtga tgactttgat cctatatttg tatacccaga agattttaat    320340
     gacttggtaa atttagattt atctaatgtt ggaataacgt gggatatatg ccattggtct    320400
     atcacttatc ttacacgtct aggtatttct aaattattaa gacaagagga aattgagtat    320460
     aaagactttc ataagtatat aaatttaatg aatcatatca aacatttaca ttttagttct    320520
     tttaaacatt tgacgattcc ttatagtgag gtacgctgct ttgagggaga aagtccgact    320580
     aatggttcta ttaatgaaca tttattacat gaaactttat taaaagtaaa gaatcaagtt    320640
     tcaagtagaa atataggaat tgtattcgaa gtacaggaga ctgattatac aaatagagtg    320700
     aaatcatggg agactcttaa ttggttccaa aagaatatta ctggcataca agcaaactcg    320760
     aattttttaa agatataaaa agagttactg gtttaatatc atatcaagta atttaagtta    320820
     gagatgattt tagtgaacct tttcttctaa ataagtatgt tagaagggaa ggttttacta    320880
     ttaatgtttt ctaataaaag ggaggacaaa tgaaaaaatt agctattaca aaaaaaatca    320940
     ttgtaagttt tggaattcta ttgcttttct tttttagtaa tccatatgga gaaccagtaa    321000
     aagtaaatgc tatggttaat aataatctgt attctcctgt gacagaacaa gttcgtgcta    321060
     gtcgtgccat tgaacatata cgttttcttt ctgaaaaaat tggtccacgg ccaagtggga    321120
     ctatgcaaga acatagagca gctaaataca ttggagatac attgcagaaa ttagggtatg    321180
     aggttgaata tcaagcactt cctgtacctg atcaatatat tggaagtatt tcttttagta    321240
     tgtatgggga aaaagattgg caggttgggg cagcatctaa tgcatttata tctaaaaatc    321300
     cggtggttgg ctcggtagtt tttataggaa aagagaccaa tattaatagt ttatctgagt    321360
     caatccatgg gaaaatagta ttattagaac aagccgatac tattgaaaaa tataatgaac    321420
     aggttgagca tgtagcgata aagggagcaa aaggtgtgtt gttatatagt acgattgggg    321480
     atagagggaa ctatggagaa gcttttaatc caattttaaa aaaggaacaa tcgatacctg    321540
     tatttggact tgcctataat caggggatta gaatgaaaga aaagttatta cataatcaaa    321600
     atgtagtcag tttaaaggca aagcaagaag taaatttgcg ctcattaaat gttattgcga    321660
     aaaaaaagcc taaacatacg acaggtgatg aggaagtagc aataatgagt gctcattatg    321720
     atagtgttat cggggcacct ggagcaaacg ataatgcttc tggagtaggg cttttattag    321780
     agttggctta caattttaag gatatagaga ctaataaaga aattcaattt attgcttttg    321840
     gagcggaaga aaatgaatct ttaggagctt atcattatgt taatcagtta tctgctaaag    321900
     acaaaacacg tattcgagga gtgtttaatg cagatatgat tgcaacaagt tatcatcagg    321960
     ctaaggattt atatgcaatg acgttagatg gctctcaaaa tgaagtaaca aatactgctg    322020
     tagctactag taaagaattg aggaaatcgg ttgtgttaac tggaaagttt gattctagtg    322080
     atcatgtacc atttaaccaa gctggaattc cctctgcttt atttatatgg atggatgtag    322140
     agagttggga tcctcttatt tatcatgttg aaagggtttt ccatacacct caagataccg    322200
     ttttagagaa catctcggct caacgtatgc aagatgcact ggagattatt ggtacgagtt    322260
     tatattattt tatcaaaaga taagtatttt tatgaattgg tagcttattt tgctaaattt    322320
     agattttggt aaaagtgtta taaagctctt tacgtaataa aaaatataca gtgagcatag    322380
     gtgaggtata tatgagaagt acatggaaag agttcaaggg gatggacctt aatgtatgga    322440
     ttcgctttat tggagaagct ttaaatggta ttgcaatgat gatgttaatg ccatttttcg    322500
     cattatattt aaaggataaa gtggattctt tgcttgaggt aggtgtgatt atagctttat    322560
     ctccaattgc agcaagtata ggctcgttaa ttggaggaca tatagcagat acttatggcc    322620
     ggaaaccaac tatggtactc tctatggcta gtaatgggtt attaatgctg ttttttttgt    322680
     tcatagatgg ttttatagca tatgcaatct tatctatcgg tttagggtta tgtaactctt    322740
     tttttgaacc agccgcatct gcaatggtta cggatgtaac agaaccagaa aaaagaactg    322800
     aggcatatgg attacttaga atggctcata atataggagc agcgataggt cctataattg    322860
     gcgcagcagt tgtagttgta tcaaaagatg tcatcttttt gattacttct ggaaccatgc    322920
     tgttttatac aatattaatg gtactgtttt taaaggaaac aaaacctaaa aatgtcatga    322980
     tacatgaaga aacacctgaa aattcaataa gatccacatt aagagttgtt ataagggata    323040
     ggatattact tttctatata gttacaggaa tcattatatt tatgggattc tcgcaatcgg    323100
     aaggtatgtt accgcttcat tttagtaatg agaagacaat gatttttgga aatagtaatc    323160
     catttccata tttaatgacg ttaaatggcc tattagttgt tttttttcaa tttcccattt    323220
     caaaatggtt aactcacaaa tcgattggga aatcaatgct atatggcgca attctttttg    323280
     gtattggtct tttggcaata ggatggttac caaagtggtt tcaagtaata aacacaaacg    323340
     atttagttat tttagtttca ttattaatag cttatacagt ttatacttta ggagaaatga    323400
     ttatgtcacc tgtccaaatg actttcgttg ctaatttagc tccagaacat ttgaggggta    323460
     cttatatggg agccgctaat ctgcagtgga ttacaggtaa tatattaggg cctcttttag    323520
     gcggtttgtt actggagcat cttctagggc atatattatt tacaatctta ggtgtgggat    323580
     gtgttatgtc tggatttgtt tacttattat tagataaact tgttgaggat agaagcaaac    323640
     agatacctat aaaacaaaca tcttaatttt aaaagtgtta tcgagttgga agaatttcta    323700
     ttttatggaa taagtaaagc gcacatttat taacaataaa cgtgcgcttt acttattatc    323760
     attttttatg tattgaaatt aattcataca tagtaatttt gacaagctac ggttttaaca    323820
     tgataaaaat taatttgttc cttcttctta tttgactaca atcaagtttc ttgccttatc    323880
     gatatggtta agtaacatac gatactcttc ttcgtatgtg gttaaccgtt gtagaaggga    323940
     tttattctct gctgttaaat attcaatttg ctgttgtaaa ttgttcactt cattcacttc    324000
     tttataattt tgtagaaaga taataatgac atctaatgtc atagataaag attttgtttc    324060
     ttttgtttgt tggatggggg acttgttgtt tccagatttt cgattttgtt tcgcctgttg    324120
     tatttcttct tcgtattgtt ttcgtacgta tgagttccaa cgaaatccgc aagctgcagg    324180
     tgtcctagcc aattgtttag caactgcttt aaatgcagct aactgtgttc caccgtcacg    324240
     aatattttga agtactattg ttgcgagaag tgaatcgtta tcgttagtcc aggaatcttg    324300
     tcttgaaatt accatttttc aatccccctt atatgccttt aattacatat atgcaattac    324360
     ttaaaatgat agaatcccaa cttctcttaa aatgtaaagg ttttatactt aaataagaga    324420
     tcggtttaat atgaggagaa taagactcaa attaaaataa ttaggagtaa gttgatagaa    324480
     gtatacactc tttaaaatgc gaaattgcat aaaaaataag gttgactatt tattatagtt    324540
     gtaactatac tggttacagt aatgtaacta aagtaataga tttgatggta tgaactagtt    324600
     gtattaatga tatataagtg aatataaaaa aatgaatgga gttgaaaata taaccctaaa    324660
     tataagatgc ttgtataaaa aagaagttag gtaatctata gttttttata atcatatata    324720
     aattaaaaga ggtgcacggt ttgaaaattt ttaagggaat tctagtttct tcaattgcgt    324780
     taacagcatt taatggggta ggtggtatac ttccaagtga aaaatcagaa gttgcctacg    324840
     cagctactta caattattca aataagcaat tgaactctac tgtacataag caagttacta    324900
     aacaattaat tttgaaattt aaaaatgaag caaatttacc atatcaggat gggatagaaa    324960
     aatttattaa agaagaaaaa caagaccctg aattaattaa aattttagcc gaatacccaa    325020
     atataactat aaatcgactt tttagttctt taaatcctac agaaattaaa aatttaggta    325080
     aagaaataaa agactccgat catatttctt ctaatttgct aaactattat attgtagaaa    325140
     cccaagttga tattgatgta caagcattac ttgtaaaatt tgagaaatca tctcttgttg    325200
     aaacggcata tctacaggaa gaagaagcgc caccagaaga gcgtttacca aatttatctg    325260
     ttaatccata tgatgagcct agacttacaa ggcaaggtta ccttgaacca gcaccattag    325320
     gaatcaatgc accttatgcc tggagtataa aaggtggaga tggaaaagga acaacttttg    325380
     tagatatgga gtatggctgg ttatttactc atgaagattt agtgaatcag aatatcgaat    325440
     tgatatccgg acagaataag agtgaacacc atgatcatgg tacctcggtt ttagggattg    325500
     tttctgcaga ggataataac ataggtggaa ttgggattgc accaaaagct aaggtaaagg    325560
     ttgtatctca gattagggat aacggaaggt ataatacagc tgatgctata ttaagtgcag    325620
     ttaacaatat gcaagctggg gatatccttt tattagaagc tcaagcaact tacgatggat    325680
     atggagataa gaactatctt cctgtagaag taaaaccgga tatatttgat gcaattcgta    325740
     tgggagcaaa taagggaatc attattattg aagctggtgc aaacggcgga aatgatttgg    325800
     atcaatttaa agaccgtaat ggtaaacaaa ttttaaatcg taatagtcct gattttaaag    325860
     attcaggggc aattatggtt ggagcagctt ctgcaagggt ccctcataaa cgttcatatt    325920
     tctctaatta cggtagtaga gtggatgttt atggatgggg aaatgcagta gacacaacag    325980
     atgcaaaacc aagtgaattt atgacaaatc tatatacatc tagctttagc ggaacgtcta    326040
     gtgcatcacc tattattgct ggtgctgctg catcaattca aggaattgca aaaaatagtc    326100
     aggggaaagt atatacaccg agccagctaa gggatatttt aagtgattct agtactggaa    326160
     cgaaatctaa tgatccaact tctgataaaa ttggtgtttt acctgactta aaagccattt    326220
     tatctaaact tggtttttca ccaaacttaa gtaatgattc ttccattgta tttcctgagg    326280
     aacaagaaat aaataaagga aatgaaggat ctactattac attcccaaaa gaggattccg    326340
     ctaatagtga agggaactct agtttcattt tcccagaata attgtagaga tatcttttat    326400
     ttagtatgaa agacttttat ataaatagtt gtttataata ctagtcagat aggctcttat    326460
     gtgtaatagc ataagagcct atctgttgta cttttaacca tatgaggagg aaagtacttc    326520
     tggatatatt tttagtgtag tgaagtgtct taaatctaca tttatataat attcagtgta    326580
     gcctcatttt aaataatgat ataagattta tacctacaag aactttaaat tttctgttta    326640
     cagtattagg tcttaatcct atcactaaaa gcggactaag tcctgcaagg ggattctcct    326700
     agcaaaaaaa tctataattt taaagtgctt taagcgtcaa gaaggtttaa tttaattatg    326760
     tagtagtgca gcttaaaaga ttgggtaatg gttatgatat aataaaattc aagtataata    326820
     aggggggatg aattaaatga tttttcaaag catgattaca gctattatag aaaaattaca    326880
     agagaccgtg aatccctatt ggataattgt atttggatcc acagcagaaa acagagaacg    326940
     agatgatagt gacattgata tagcttattt aagtgacata aaattaggga attatgaacg    327000
     ttttttatta gcacaggagt tagcggatat tgttcataga gatgttgatt tagttgattt    327060
     atcagaagct tctacagttt tccaagctca aattatacat acaggaaaga caatattttg    327120
     ttcggatgaa gagcgaaaaa caatttttga aatgaaaact ttaaaaatgt attcaaaatt    327180
     gaatgaggaa cgcaaaatcg tatttgagga tataaagaaa agaggttcta tatatgaaga    327240
     atgaagttat tttgaataaa atttctacaa tagagcgttg tataaaaaga attcaagagg    327300
     tatatggaaa taaccctgat aatttagagg attatacaaa gcaagattct ataatattaa    327360
     atattcaaag agcatgcgaa gcaagtattg atttagcaat gcatattgtt gcagggaaga    327420
     agttgggact accccaatct agtagagagg catttgattt gttggttgat gcagatctac    327480
     ttagtacaga actggcaagt aagttaaaag caatggttgg gtttcgaaat attgctgttc    327540
     atgattatca aagtgtaaac ttagatattg ttcgtcaaat tattgaaaaa catctaaaag    327600
     actttaagct atttacgaaa gaagttatgg gaattctaga cttataaaag cacagatctt    327660
     tgaactatga ttacattgga gagcattgta gtaacttgta tatcatgagg aggaaagtac    327720
     ttcagtggac cctttacttg ctttaacaag tgaactactc gccacttagc aaagcttgaa    327780
     gtgggagttt ctcagttcca cgatgaaagc aacctttcgt ctccctgagc gttacttcgg    327840
     ggtgttccat ccctagatgt ccaaaggttg gacgctcttt tggtacggtt gatattttac    327900
     gcaggaaccg aatggcttgg ttttcgcact ctattttctt cctgcaacct catatatcaa    327960
     gttatcaaag aacttcatat agctagttta tcaaaagttt ttggctatgc caaaccgaaa    328020
     ttcatctccc acctaccgtt gggctacgcc cttcacacgc ttgaggaagg agaattcttt    328080
     cggggaatta gttaaattaa aatcatattg gctaacgtaa agaataccaa tcatttactt    328140
     ctcctatcag cacaagtaaa tgattggtat ttctcattaa tattgctaaa actgaactac    328200
     gagcagaata ctttatttca ttcttttttc ccttacagtt tgatcttgta atcgctgttg    328260
     ttcttttatc agtcattcct acataagcgt tggatatttt gcaggtttgt ccagactgaa    328320
     aagagcttat taaaccatcc attattcacg ttcttcttca tatatttgta ccgcaatttt    328380
     tttgtatgtg gttaaaacta gtttttaaga agcatatgtt ttagcaactg cagaaattct    328440
     ttatcacttt tatcatcttt tatgtaatcc tgttcgtagt taaaaatcat tcgtactaac    328500
     ataaaagctg taagtggtaa tggtacctta tgcaaagctc cttgctgata acctttttcg    328560
     agcaaattac ttatcatttt aattgcttct tcttcagact ttttaaaaca agctgtaatt    328620
     tcaggtgaat ggtactcttt atattcttga aagagtgtag aaacaaacgg atcttggtga    328680
     tattctaggc tgatataatg aaggattttt tgtattcgaa gtaaaacatc tttttcctct    328740
     ttatataaat caaataattg tgaacgtata agctgaatat gacgcatata gcagtcacat    328800
     aatatttcag ttttatctgt atagtaataa taaatagtac ctttaccaac tttagctttc    328860
     tttgcaattt catcaaccgt tgtgttacgg acaccacgcg tagagaacag tattgtggca    328920
     gattgaatga ttttcatttt tttattttct ttttctaatt tgatcattgt ctacacccta    328980
     tccttgaaat atttagcgaa gttttctttc attacattct ctatcattct atttgtcatt    329040
     ttttaaagct taatagaaag tcccctagtt gcttcttata gaataacata caccattctc    329100
     atttctagta tataactata atagaatgca actttataac ttaggataaa aatgaaagtt    329160
     taaggtaata actttttaat cagacgatga gaattcaagt gaaaggggac agtgatttct    329220
     ttcttgattg aattatttga ttttttattt aattcgtttt attatataaa catgactaaa    329280
     agatgttttt agtcggattt ttttacggaa aaccgactga tatttaattt tagtcggttt    329340
     ctatactatt tgagagaagg tagacactat gtgtggaatt gcagggtgga tagactggtc    329400
     taaagacctg tctaatgaac aagaaacgtt aaaaaaaatg acagatgcta tcactcaccg    329460
     agggcctgat gcagaggggc attggctttc aaaacgagca gcattaggtc atcgacgtct    329520
     catcgtcatt gatcctgaag gtggccttca acctatgctg tataaagatg gaaatgatac    329580
     gattggcctt acgttcaatg gagaaattta taactatcaa gaattacgta aagaacttga    329640
     ggggaaaggt catgaatttc agacaaagtc tgatacagag gtattactac atgcttattt    329700
     agaatggcaa gaagattgtg ttcaacactt aaatgggatt tttgcttttg gtatttggga    329760
     tgaaagattt gggaaattga tgcttggtcg tgatcatcta ggtgtgaagc ctttattttt    329820
     cgctcaaaga gggagtgcaa ttctctttgg ttcagagtta aaagttttac tttcgcaccc    329880
     acttgtagat gcagaagtag ataaagaagg actttctgag atattttgtc ttggaccaac    329940
     acgtactcca ggtcatgcga ttttcaagga tatacacgaa gtgcgtgctg gccattatat    330000
     gacgtttacc tctaatggct cgaatacgac acagtattgg aaacttgaaa gtaaaaacca    330060
     tatagatgat attgatatga cagtggagac aatccgctcc attttacaag atacggttaa    330120
     acgtcagtta attgctgata gacccgtggt atctatgctt tccggaggtt tagattcaag    330180
     tggtctaaca ggtttagcag gaaacgaatt tgggaataaa ggggaacatc ttcatacata    330240
     ttccctgaat ttcatcaatg atgaaaaaga ctttgagcaa gacttccttc gttttgatcg    330300
     tgatgaacct tgggtgaaac gtgtggctga atatgtagga acaaagcatc actctataga    330360
     gttgggatca gatagtttaa tagagcattt attaattcca atgcgagcgc gtgatctacc    330420
     tggagttgga gaactagaaa catcacttta tttgctattt aaggaaatga aaaaagacgc    330480
     aacagttgca ctttcaggcg aatccgcaga tgaagtgttc tcaggatatc catggttcca    330540
     tcaagagaag tttttagatg cagagatatt cccttggagt gttaatttat ggtatagtac    330600
     agaaatttta tcagaggatt ttaaagaaaa gattagccct gaaaaatatc aaaaacaaaa    330660
     atttgaagat gcggttgctg aggttccttt tttagaaggt gaaagtgatc tgcaaatgaa    330720
     gcaacgtcaa atgtcttaca tgtttattac acgtttcttg ccatttatgc tagaacgaaa    330780
     agatcgtaca agtatgatga atggctttga agtacgagtt ccattttgcg attaccggct    330840
     tgtagaatac ttatggaatg ttccattcga aatgaaaagc atagacaata ttgaaaaagg    330900
     tattttacgt cgagcttttg aaaatgtact tccagaggat gtactttatc gcaaaaaaag    330960
     tgcatatcca agcacaaagg atgcttctta tctacaaggt attagtgatt ggatgttaca    331020
     tgtgttgaac gatcctcaat cacctatttt accattaata aatgtagaaa gagttcgtgc    331080
     tattgcagaa ggaaaagaca aagtaatttc tggtaatgat gcacgaggta taatagatta    331140
     tttgcttcaa gttaatagtt ggcttcagga atataatatt aaattagtat gataaatgta    331200
     atattcgaat aaagaggata gatgaatcct caatgaccta agtgaaccgc atctccaatg    331260
     tattagatag ttatctaaca tttggagatg cggttttatt atcttgattt gcaataacgc    331320
     taatcagtta gtaaattaga attgaataag ggacatggaa agaactaggg ggaataatat    331380
     gaattggagg tcccacgtaa aggagaatac gatgaacctt ttaattagag aattagaagt    331440
     agatgattta gacaatttac cggagattga tgatagtttt atagtaaact ctcggttaat    331500
     tctttctctt tcaaaagtaa ataagcaaat agaatataca gtagaagacg ttccaagtta    331560
     tgagaaaagt tatttacaag atcaatatga tgatgaacta gcatacactg aatatataaa    331620
     taagcctgat caagtaattt acatagcaat tttacatgac caaattatag gagtaatggt    331680
     attgaaaaag aattggaatc actatgctta cataaaagat ataaaggtgg ataaaaaata    331740
     tcgttcactt ggagtaggta ggaggttaat tgagcaagca aggcagtggg taaaagaaag    331800
     caatatgcca ggtataatgc ttgaaacaca aaataataat gtagcagcat gtaggttcta    331860
     tgaaaaatgt aggtttgtaa taggtgggtt ggatttttta gtatataaag ggatacatga    331920
     agaaagcgat gaagttgcaa tgtattggta tttgcatttc aaatgaaagt acaccaaaac    331980
     tcgaatatat aaatttctcg ctgttacatt cgggacaagc gaataactaa aagaaaaggg    332040
     aggtttcttt ccgagagtag gggggactct ttgctcttgg taccgataat gagacgttat    332100
     actaacttga catgtataga gtatacaacc aaaatcaaac aacaaatcac ttcttataaa    332160
     tggtaaaata gggaaaagga ggtcctgtat aatgccttta gaaaactcta tttattacat    332220
     tggagttact attatattag tgatcatcgg tgcactgctt ggggggatta tacgtttaat    332280
     tcaacatact agtaattaca aaaagcaaga ttcagttgag caaaagttag ataaagttat    332340
     tcaactttta gaaaaacaaa acaaagattg accttactca aaatagaagt agtttgcaat    332400
     agctcccaat aacgaaaatt atgtaaatga gctgtctata tggacagctc attttatttt    332460
     ttcttatcgt gggtgttctt tgaaatgctg aaggtaccca atcactatca aactaacaaa    332520
     agcaaatatc ctcaaaacga aaaaataagc cggtctttgt caaaaagtag gtgttgtaaa    332580
     agtagtacgg tccccttatt aaacagttaa ttcagtccct cagggctgat gagtacttct    332640
     gttgatgctt ctaaacagct agataactga gcaaaagaag ttatagctat atttttgcca    332700
     actcatacac agaaacagac atgaaaaagc catcctttcc tataattcta cagaaaaaaa    332760
     tttctattct tatatttgta ggatagtttt agatacaaga ataaagagat tagtaatata    332820
     tatatgtctt aatgtaaaat atacattgca tttttctata tgttaattta atatatagaa    332880
     tataagattt atagtatgaa gttattattt acaaatgaga cgtatttaaa gtctataagt    332940
     aaagagaaaa ttgcaagagt aaaaaaagtc taactcaact gaagttggtc gatattgtaa    333000
     acgctacgcg acaaaccact agtcttattg aaagtaataa gtctagccct tctttaaaat    333060
     tttatatttg tatagatgga aatttttata gtagtttaga taaattattt tggaggaact    333120
     ttaaaatgga aaaactaaaa aaatggtttt cactcagtac acacaaagat gaaagaattc    333180
     aacaaattga aatgaaaatt tgggctcaat ctggaattgt tgtcctactt ttagctttta    333240
     tagatgttat cataagggga gcatatcttc atcgcccatt tctagaatgg attgcttcat    333300
     tagccattat attatgttat atgatattct tttttattaa atctattttg actggtgttt    333360
     atgaaacaga tattaataat aaagaacaat taaatgaaaa attaaaagaa aaaatgagta    333420
     atacctttat tttttgtttt gtcgcaatag gtgctactac atacaaatat tacttccctg    333480
     aagatttcgg tggatggtta gcagcaatag caaaattcat tatacttttc gtttttctat    333540
     ttggtattca atatcttatt acagtaatag cgtggaagag atccaataaa atttaataaa    333600
     tatagacaaa aaagcttatc ctttagcact taatgataag cttttttatt atttttttta    333660
     tcgttttttt gtttttgtgg tatttgcttc tcttaggttg atagcgatgt agtggtactc    333720
     catcactatc aatttaaaag aatgattcca ctttttaaga aaaaattaat ttgttttgat    333780
     tgaaagtaga ttataaagtt aatatttaaa tataaagaat ttgaatatta atatgttatc    333840
     atttgaatga ttcagatatg ggctacaaag ttaatatttg tagctgaggt cgtttataca    333900
     tatgaaagaa gtgaactact cgccacttag caaagcttga agtggtagct tctcagttcc    333960
     acgacgaaag tacccttttg tctccctgag cgttacttcg gggtgttcca cccctagatg    334020
     tccaacgctt ggacgctctt ttggtacggt tgatatttta cgcaggaacc gaatggcttg    334080
     gttttcgcac tctattttct tcctgcaacc tcatatatca agttatcaaa gaacttcata    334140
     tagctagttt atcaaaagtt tttggctatg ccaaaccgaa attcatctcc cacttaccgt    334200
     tgggctacgc ccttcacacg cttgaggaag gagaattctt tcggggaatt agttaaatta    334260
     gcaggcttaa caattgcagc aagtttatta ttggcagcgt gtggtaatga agaagcgaca    334320
     atagagcaag atgcgaagat agaggaacaa aaagaaaaag ttaaagcatt tcaggaagaa    334380
     aagcagcaag aacataagaa agtaactgtg cagaaatcga cggataaatc aaaacagtat    334440
     gaaaatgtag tgaaggaaac agttaaagaa gaaccaaaag cagagtcaac gcctgttgaa    334500
     caaccgaaag ccagtgggct aaatgaggca caagcacaag aaaaaatgga acaatcgatg    334560
     gcagcataag gccagggaac acgtaataag gatgtgaagt taagtcaatt aggaatccaa    334620
     acagcaaagg atgggataaa ggttgctaca caggcgcaag acgtccatat tgaagtaaaa    334680
     gacagtctaa ctcgaattgt tgttatcgtt ccagcgggaa taacgaaaga acgagcgcaa    334740
     caagtaggag acacagcagc gcgccaggtg gcgagtttcg gcacaatggg attgtatgta    334800
     gatttgaaaa caccatcaaa cgactattta ggaggatatt aggaaaaatt ttctggtgat    334860
     atcggtatct ttgacagcaa cgaaaaacaa ttagcacgcg gaactatttc caaattaaat    334920
     ccaacaaaaa ttaaatggta aaaaaacatg gtacctgcac aatgtgtggg tatttttata    334980
     aagaaaagac gccctaaggc gtcccccaca attgggtaga taagacttta gttttccaat    335040
     ctaaagaagt tttgtatcag ctctttgaga gtatatcata atatctagtt gatttattat    335100
     gcattattac atactcttct aaaccctcta ttttccattt gataaaatag aatcccaata    335160
     ttaccaaaaa tcaaataaat atttctgtaa attcaaaaca tttacaataa taacaaaagt    335220
     gatacattta aggtgcaagt tataaaaaat attaaagggg gaatttttat gtttaagaaa    335280
     ttagtagtag gggctttagc aactggggtt atgctgtctg gtgctacagg agcatccgca    335340
     gctgtagaca ctggtaataa tttaaataac agtaataatt caattgccgc aacatgtgat    335400
     tataagactt ttccttataa tagtaaagat gatatgccta tggtagtgat taaagggggg    335460
     ataaagcatt atttaaaagg aactgttata aacggtggac agttatacgg gttatatgaa    335520
     cctgaatatt gttaaaaaaa ggacactcat ttgagtgtcc tttctccgac ttgaaccatc    335580
     ttaattttaa aaatatgaat gttggatgcc gatccaatat aggcataatg aaaggaacta    335640
     tcaagattgc tttaggtatc ctaacatgaa gtgaaatctt attatttaaa tacattgttt    335700
     ttttccgaat tcaaaggatt gaaaaactta tttaaaattg taacaccttt gcagagataa    335760
     aaaagttatt taattgaagc gcctgttagt taaagtaagt tttttaaaat cttactattt    335820
     tatgatgaat tctgtaatgt aatgatatgg cggcatttgt ctattgagtt ttcagaagga    335880
     tttaaagtcg tatatctaaa aaaatgtaaa catatatatt taagagagaa ctgaacttca    335940
     aagtataact ataaaatgta ctgggtgtac tgacacattt attactggaa aaacaaacta    336000
     tttaagacca gtgctatcag atactacaat tgtactggtc acgttaatta tttctcactt    336060
     gtaatagctt ataataacag ggggaattgt agtgttttga tatgtatctg tttcactata    336120
     ttaactatta tttcatcggg ctccttactg aaataatgga gaatcatcat ttgtttattc    336180
     tgatttctgg aaaaagttta atggtttcat actgaacaaa catacttttt aggaagagga    336240
     gagattattg atggataatc aattaccata tcaacagcca aaaagagaaa aggcactcgt    336300
     gattggagcc ggtattgcag gtttacttac tgcacgcgta ctttccagtt attttgagac    336360
     agtgatagtt gttgaaaaag atgagttacc tcaaaaacca tctgaacgtc caggtacacc    336420
     ccaagacttt catcctcatc gtgtattacc acgcggagaa ataattatga accgtttctt    336480
     tcctggatat gttgataatt tattaaatct aggggcccat aatgtcaaga atgataaaat    336540
     gattcgattt tctccttatg gggcacttga actagttata gaacgaaaag gtgcagcgag    336600
     cagtcgagca ttgttagaat ggacaatccg ccaacgtgta caagaaattt ctaatgtaca    336660
     ttttctttca aagcaagtgg tgacaggact tctaacttcg tctgatcaca agcgtgttat    336720
     tgggatcaat attcaagaac gagatgaatt aaaaacaaag agaactgttt taactgattt    336780
     ggtagttgat acatgtggcc gtcaatctaa actcaataaa tggcttacat ctatgggata    336840
     tgatgttcca gaaccagaac gtttaaaggt gaattttgga tatagcacga gatattataa    336900
     agtacctcca catatcaaag agaaattgag tgcaatttct gaaggagatc ctgctaaaaa    336960
     cgttggagct gtagggctat tatatattga agataacata gctcaagcgc tactatttgt    337020
     tgctggaggt acgcactatc cgccaaccaa ttcaaaagaa tatgaaaaag aactggattc    337080
     attagttacc cctatgatga gggagttaat caaagagtta gatccaatta gtgacccaag    337140
     aggatttaga gcgcatgaat caactcgtca acattttgaa caaatggaaa attggccatc    337200
     tggattatta gtgttaggtg atgctttttg taactttgat cccatttatg gacaagggat    337260
     gaccgtagcc gccattgaag ctgaaatgtt agatacttgt ttaaaagaac attctactca    337320
     taaacccgga ttcgaacgca aagtgctgca acgtatgcaa caggctattg agccggcatg    337380
     gtggctgagt tcaattgcgg atttacgttg ggaaggtgtt gaacatgtag gagcagttcc    337440
     actaaaaggt gtgaaattta cacagaaata ttttgattta tatcttaaac aagctttaaa    337500
     gcaagcaagg gatggtaatt ctaccatgct ccaaaaatat ataatgatga atgggctagt    337560
     ttattcgcct catgaaatca ttaactcaga tatgttaagc atgttaatca ctgaggatga    337620
     gactttggaa gggaatgaac ttttgaacga acttggagaa gtagataaga gatcactgca    337680
     agaaagaata catgaactaa tcccttcctt tacattagct tttgagaata gcattccaaa    337740
     tctattctct tccatttcaa tttctaatgc caaatgagga aaaggtagta caaatcaatg    337800
     aatatttgta ttagatatac tctaattttt tatatcttac acactatatc aaagaagaaa    337860
     cataacctct tattttctgc aggtatatgt ttctttttat cattttagcc aagaagactc    337920
     tttcctcaag gagcgtgaag agtcacagcc cagtgagtag gtgggaaagg aggaatcatc    337980
     taatatatat tggatgatac ttttttgttt tttgaacaaa aaggatattg aaagggtctt    338040
     gatatgaaga tcaaaccctt ttcaatatgt ataattattt cactgcctct tttaattctt    338100
     ttccagcttt aaaagcaggt gcttttgaag ccgcgatttg catttcttca cctgtttgtg    338160
     ggttacgtcc tgtacgtgca gatctttcac gtacttcaaa tgtaccaaaa ccaagagtct    338220
     gtactttatc tccatttgct aacgcatttg tgattgtatc taataacgct tgtgttgctg    338280
     cagcagcatc tttttgtgta agttcagctt tttctgctac tacttttgtt aattctgttt    338340
     tattcatttt ctgcacctct tcatatgtaa ttaggtgact attataacgt gtgattactc    338400
     atgatgcaat tatacatagg aaaagacata gcaagagcta gaggacaatt tctgtgtaaa    338460
     aggcataaga aggatattaa ttatcgcgct aaactctgtt catatttctt tacatcttcc    338520
     aaagttttaa atattaacac atcaaaaact cctttttcat tcccacatac gacaacaaaa    338580
     ccatctgtcg cttccaaaac tctaccgacg ccaccatctg taagtgtaat actggtgaga    338640
     tgttttacgt ttagtttttc ttcttttcga atgtaagtag ttatgggtgt tcctacagga    338700
     aatgcgtctg tgatctcttt tgttgtatat gtgccatcat ctattgattg agttttagct    338760
     gtaatagaat cagtttgagt ggcacatcct gttgaacata ttaaaagaat tccagtaata    338820
     atacttacac aagctttttt taccattcac aaaatcctcc tataactgtt cgtattgtca    338880
     acccatttag ggtaacaaat tatatatacg aagtttgttg gtttatgtga gtcgtaaatt    338940
     aacaaagata caggtatttt gccagaatgt gtttcaaaca aaagaaaaga cacccaaagg    339000
     tgccttcctg cgactggaac catcgtaata tggtattggg tgccaacccg attattattt    339060
     tatcagatta agtaatttgg gttgttgaga aatataattc aaatctatat tttgtttatt    339120
     tttgcttcgt tagctttttt gtagtggatt cttcaatctg ttcagattta cttttaattt    339180
     catcggttat tgctatcttg ctacccgggc gcacacaata acagtattta ttgcaccaga    339240
     accaaaaaag ttaaaagtcg aaacgtatgt tattattata ttgagaatta taaattaaag    339300
     gtggcatctg gaagggaata gttataaatg aaaacaatga aggggaagtc attttttagc    339360
     attgatatta taggttgtat cctttgcatt ataatgctta ttataagtct tgttaatttt    339420
     agaacatggg tacacccttg tttatttctt gtctgcggac taattttcct cattaatata    339480
     gtaaatactc ttaagggaaa agggcgtaat tcaaattaaa ataaaattgt atccatataa    339540
     ccaaaaaaaa gctattcttt ttgtagaaat atacagagag gatggcattt tttataaatt    339600
     ttttgtttta agatgaactt caatgatttg ctgagggatt atatcaatat tttcctcctt    339660
     cacttttaga acagcttgct agagggtggg atttttttta aagaaaggga gcttttgcga    339720
     tgttaccaga ttatataaag atagctcatg agatagctaa aaaagcccat gttggacaag    339780
     tagataaagc aggaatggac tatatcaaac accctgagac agttgctagc tttgtaaata    339840
     cgaccgaaga gaaagctact gcttatttgc atgatgttct tgaagatact gagataacag    339900
     ctgctgattt attaaatgct ggtatacctt ataacgtagt ggaggcagtg caggtactaa    339960
     caaaagagaa atacacgcct tattttgagt atctgagcaa agtgaaagaa aattctcttg    340020
     cccgtactgt caaacttgca gacttaaaac ataattctga ccgctcacga cttgctagaa    340080
     taacagataa agacctaaaa cgattggaga agtatcgcac agcgattaag tttttagggg    340140
     aataaaagaa acagcaactt ctttagttgc aatttcctag aatactaatt gtttaaagaa    340200
     attacttcgt gcaaatatta aatgatccgc gtatataatt tttaacaaaa tgtaaaaact    340260
     agtatacaaa atgttaaaaa ttatatacaa aatgttaaaa ttaggataaa gtgtttatag    340320
     gaggtggggg tagttgttaa acaaccggat agttgtctgc cgtgccgaaa aaggttggac    340380
     acagcaagat ttaggagaga gagtaggtgc tagtcgacag actatcgctt ctatggaaag    340440
     gaataaatat aatccctctt taattcttgc atttaaaata gcccaagctt ttggaaaacc    340500
     attagaggaa gttttcgaat ttaaggagga ataaacaaat ggaatttata aagtatgctg    340560
     taattattat tatagtttta tcatgcttaa gtgaattata tatgtttaaa tttcaaaaaa    340620
     gccaagaggc aagagatgag agaggtttag atattcaata taaaactact aattttttat    340680
     ataatactct ttatctggga atagttatat tatttctcct taacatactt caatatatta    340740
     cagcagaaca atttgtgaat atcctcttat atttctttat ttctttaggg ataataaaag    340800
     ttgcttattc atattggaga aggagctatt aaatataaaa agaaatacta aaaataaggg    340860
     ggcatatttt taatatattt gttcctgaat taataataga ttaatttctg cggaggtatt    340920
     agtacttaat attaggagaa attggccgca gcttactaat ataattatag atacgcctat    340980
     gtacttaaag aataaataca gagtttttat aagcgtggaa aaattgcagt ttcaagtgaa    341040
     actgcaattt ttaattcatc ctttccatta taggggaggg gctttgaagt gtgctaagat    341100
     aaagtcattt tagtaaactt gcttcatttt aaaataagtt tgaatgaagg agacaatttg    341160
     ctaaatacac tatgttgttc atttccttct tgattcatac ctgctaaagt atgatagatg    341220
     tcacttatgg tcactcgaat atctattact aatttactct atttaaaaaa agtagctgca    341280
     caaaagcgca gctacttttt ttcatacaaa cattattatg caaataaaaa ccttaacgta    341340
     aacttgcgct taatggtact tgagaataaa ctttgaaatt actaccataa gtaccgtgtt    341400
     gagaaaatga ggaagaaatt gagctgttcc aacttttgta ggtagatcca gatgtatctg    341460
     ctcttagaag tacgtttgaa aagctagctt ggctaaaaga attacttcca gtatcttcaa    341520
     cgccctgaac catttttact ggttcatatt gagaaaacgt accatataca ggttgattta    341580
     catatttagg acttccattt acatacatag taaccgtacc atttccgtta ttaactagtt    341640
     taaggtttac tcgatcacca tctttaattg atgtatcata ctgtgtgttc caatacttac    341700
     tgttttgacc tgattcatta tatcctgaat taagaaatac tttatatcca cttgatgttt    341760
     ttgaaatacc accctcaact ttagatgctc caatacctaa ataccaattc acatatccat    341820
     ccttaacaac aactgatttt ggtagattta tatcagctgc aatcccggta tagttactat    341880
     ttgtaacact ttttacagca ccttctgtag ctgcaaaact tgtagttgca aacattgata    341940
     gagcaattag aagtgaacca actagatata tcatttttct cttacttttc cttaatactt    342000
     gtttcatttt aggtccccct taatttttat tattaaattg catggaaagt tggccaacta    342060
     actacgactt acaaatcaaa gatacattag gtttcattta atgtatatat ttccctgtta    342120
     taagtcattg aaatgtcaaa caaattgaat atttcatatt tatcaatata gggggagttg    342180
     acagaataaa atagtccttc tatttgactt taggaaggtt ttgtaattaa tattattaaa    342240
     atctataaac tggttgggta taatacgcaa taccattcat ttgtgagaga tagaaatgga    342300
     attaatgcag gggattttca aaaggggata tcagaaattt ttagaaatgg aataacaaca    342360
     aatgaaataa attaaaggct gttgtaaagg catctatgta tgagaaggtg gtaggaatga    342420
     gaagtaaact ttgtagttac tttgccttgg atgaaagaag atttaataat tgtttaatag    342480
     ggttcgtttc ctagttaata cgtagttcct ggggggaggg gagaatgcct aaaatagaga    342540
     atagatttgt tttaaccaat ccttttcaaa ataaaaatag taacgcgaat agtccgaaac    342600
     acatttgttt cggactaggg attcacaatt tctctcattt tgattaaaca attttgcgga    342660
     ttaaaagttg aatattttga ctatttaagc aggacaaatg atattacgtt aatcaataga    342720
     tacttcaaca gagacactcg gtattgtggg tgatggtgta tctccaccat taaaggaaga    342780
     aggttgtgat acatgtaaac taatcatgct acatgctaat gcacttacta ctaccatact    342840
     taatacaatt ttttttattt ttttcattac tttaacgctc cttttctcaa atgattctta    342900
     ttggcattat tgctaatgta gaaatatttg ctcgccttaa catgattatc tgcctggtaa    342960
     aattggagtg ctaaaatctc tgcatgttct tttacacaat cccacatgcc ctctttttca    343020
     aaataagaaa ttgcatcagt aactactttt tctagtttaa ttctaggcag ttctgtgatt    343080
     agttcattta aaactgcgaa acggtgctta tattcctcat ttccggattc atttgtatat    343140
     ttcattccct gctcgatata tgattttgct gtttcaacgc cttctaattt ataatatgct    343200
     cttgctaaga caaataatgc tttaaaatgg ttcggtattt tatttataat ttcagaactc    343260
     tgtcggatcg ccaatggata taaatcttga atattatata accagcccaa attgtaacgt    343320
     actcttaata ataaatgttc tttatcatac ttcttaaaaa catcaataac cgtattgaga    343380
     cattcttcag ctctttcaaa ctctcttaga tctatacaag ataaaccata tacattgtcg    343440
     cataaagcaa tattgatttc atatcctaca tgattcaggt atatttcttt cgcttttact    343500
     acatgttgaa tcgcttcaaa tggttgataa gactgataaa agtaagttga aattctatac    343560
     ttaaactcgg ctttttctac ttcatcaggt atatcaatta aaagttcttc cgccttttca    343620
     aaatgtgttc tcgcttcagt ataatttgct ataattgtag agtggattgc cttaaagaaa    343680
     tgatagtagt aagctaaaaa tgaaaattca tctttgatat tagggagctc ttctatttta    343740
     ttaaaagaat ctttagtaat actcattcca tctaccaaga ccttatatct aaaattcagt    343800
     agtgaataat agaatgataa atattggtct gtttctattc cttttaaatt ttcttgtact    343860
     tttagatatg tttgttttgc ttcttttaca tgatataaac gaatttcttc ataccattca    343920
     tgtaataatt ccatcaattg cttattactt ttttcttgaa cagtcataat atcccccatt    343980
     tctatgtaaa ggcttattct gataataaca ggaattagat aaattaaatt taactacgat    344040
     ttttttcact aatatacaga atattctgaa ttaaaataat gtccatgctt ttaaatttga    344100
     aaaagtatgg ttaagccagt acaagttttg ttaatgcttt ttttgattta ttaactgttg    344160
     tctattgaat acttcttata agaggcggcg tagcactata gtagaaaaag agagagctta    344220
     tactgttatg gtattgagaa atacgtaggg cttattaagc atcaagggat tcctcgaaaa    344280
     taaatagaag tatatccata tctatttaca ttgaagaggg agcgttggtt tatgataagt    344340
     tttggggtta atttacgcac tattattagt tatacacaag agagtaggaa tcttaataat    344400
     atacgtattt taagtaagtt gggtataaga ttatttgata catatggaga accattacct    344460
     gtatcagatg ttaatcgaga attagtaacg gcattaaaat gccaagacat aaatacgcaa    344520
     agatatatgt taagtcattt acaaggttag aaaaaccgat attatgctgc gtttttccat    344580
     acatatgttc tatccgataa accaaaaagt tatcatcaaa ggtttgtgaa attttatttt    344640
     cttaaattga gtgaattacg tagtaatatt ttaaaattat ttaatttggt actatagttt    344700
     gtatcaccat gaaatgtata aaactcgtct atgtcaataa aaacagaata aagaatgtgt    344760
     aatgaagtac ccatccaatt attatgtgta taacaattgg atgggtattt ttttacttat    344820
     tccaaaatag ggacaaagct aaatgcaacg gatcgttatc aaaacgcgag tgtacaaatg    344880
     taacaaatga aatttctatt cataagtgtg gttcttctat ttaatcaagt atgatttaat    344940
     actttcttag ttttggttaa ggaaatttat atacttaaag taaagggggt aatttttaat    345000
     gaagggggag gagaatttga aaatgctcaa ttcagttgct cctaaacaaa taaaaaatga    345060
     agatttacca tttgatattt cctggatgac cgattggatt gtagactggt ttggttcttt    345120
     gtttaatggc ggcagtgatg taataaaaga tgggggaaat aaagtagatg gtgtagtcca    345180
     tgcgagtgtg cctgcatttt ttgatgtgat tttccttatt ctttctgtag taattttaat    345240
     ttcattatta gtttttggag cctctttatg gtttaaacat ataaagtgga aaaaaagatc    345300
     tatatatttt ggagtaggtt cgtttattct cattctatta ataaggattc taccagtgtt    345360
     aatgttgaca acacgttctt ttgattttca aacctttatg agtaatatgg tgggcttaat    345420
     tacttctata attttaggga cagctgtatt aatgttttta atatcgctag cattaggtat    345480
     gctttataag aaatttgaac atcccaaata tggaaaatgg agttcaagtt tgagatatag    345540
     ttcaattttt atatttgtaa tgacattgat agtaccggcc ttgctgcgtc atttataatc    345600
     tttgtttata taggggaagg aggaatagtg caggtaattt ctataatgtt tctgtgtaat    345660
     tatgctagtg ctcgttctcc tctagatttc tgagttaagt ctaatacatt aaaaagaatt    345720
     ttgttgtatg aagttttggc aaagggggag aggtactagt gactactttt gttgtaatgg    345780
     tgagtatatt cttaattctg tttgtaattg gtcccaaagc gactaagaga aaagaagaaa    345840
     gagatagaat tgaaaaagaa cataaagaga aaatggaggc tttagaggaa gaaaagattg    345900
     acttagatat taatgggact aaagtacggt tacacaagaa gccaaagcta aagaaaagta    345960
     tatataaaat aaagggtaac aggtaattac tcagttttat ctcaacgttt ataatacata    346020
     ttaagtatta gcgtatatgt aaactgtgca gggggttgtg atgggggatg tggggatttt    346080
     ttaaacggaa aaagccagat aaattgtcga aagaagaaag aattgaaata tattttaaag    346140
     agaaagagga tgttcttcgg aaatcaagat aggtattatc agattttcag tttgacttcg    346200
     aatttgtaag tgaagatttg cagcatgtac tttttctaga taaattgtct agaaaaatag    346260
     cgtatataca actttctaat gcagaaaaag aacctgagat aatagaatta aagagaatga    346320
     atgggtttgg tatacgctat gattcacaac aactaggtat ttatcgggat ataaattacg    346380
     gtttaaatat tccgtatgct gaagaaaaat ctgttcaaag tcttgaacca tcaaaaatgt    346440
     tcaccatgtt tttaatttct atttatttta tactctcttc tgattgtata aatgaagatg    346500
     agagagttat tccattctat gacaaggaga agagcagatt ctacaaaatt atgaatccga    346560
     tctcttagct gatgtggaag attatgaatc agtaacaata gaagtcatag atgcaatgga    346620
     tggatatcag tttgaagagt ttgttgcaca gttatttcaa gatatgggct ataagacaga    346680
     ggtaacgagt agttcaggag attatggtat agatgttatt gcgagaagaa aagggttaaa    346740
     tattggaata caggcaaagc ggtatagtga taaagtacca aacaaggccg tacaagaggt    346800
     gattgctgga attgcgttct acaatttaga tcagggttta gttatcacaa ataattatta    346860
     cacgaaacag gcacaaaatc aggcgaagag taccaatgta ctgttatggg accgtgatat    346920
     actgcagcaa aaacttcggg aagtatacgg agatacgcaa aatcttgaca aacgagaata    346980
     gtggatggta attagatatg ttgaaattaa ttgaaatcaa gaaataagct aaaaaaatcc    347040
     gaaactagta gatcttaccc ctgaagagga aacgaatatt cgaaaaaata ctgagttcga    347100
     tatgctgtat aagagtaacc ccgttttgta tgaaaagtag aaagaacaga ctactgaaat    347160
     agtctgttct taaataaatg atacaattgt agagctttta cactagaatc aattattcgc    347220
     aggtcgtagt actatgacat ttattatttt gaaatttttt gcacccattt agaatgacca    347280
     ataaatgggg acagattata ttgattattc gtatatgtaa accctttaca ctaattttct    347340
     ttcggaagta caattgaact gtaatcaaat agtaaatcac tatgaaaata acaattggta    347400
     accaaattcg atagtatgaa tccactaaaa gaggactgaa catgttcatg ctaactagta    347460
     tgtgcgtaat acccacaatt gctgggaata gtaatacgaa gaataactct ttataaatcg    347520
     attttgttaa caattcccga cgaacaccga ttttatgaag catttaataa cgcgttctat    347580
     cttttgatgc gccagacaaa actttaaaca ttagacaact tgccatcatt gttaagaaca    347640
     caattccaac gaagaagccc ataaacataa gtccgctgaa tagaccatga atgtcattgt    347700
     atagttgata cttactattt aatgcttcag acttcgcgtt tttatattta tctacctgca    347760
     attccattct cttaagtatg aattataagc atctgttttc ccagcaaaca cgatataata    347820
     gtgagggata ccgctacatg cccatcaact taaggaaaat aactgttcca aaaacgataa    347880
     aaggaacaaa tgaatttact cctttttcac ttgaattcca catgacattt agtatcaatg    347940
     attccaaaag caactttaca tgggaacgga ttttttcctg ttgaagcagc acgcatacat    348000
     gaaagtaccc aataatccaa ttctaaaggt aaacggaata cttggatact actatcatcg    348060
     ttttttactg ttacgattgg tgtatttacc ctagttgtag taaaaccgtc agttgttatc    348120
     attgctactg catcattatt atgaaaacca gcgcttaaaa cctcgtaaat tattccatcc    348180
     ttctcattga taatcatagg tatatttaaa tagggatagt tatttatatc attatgaata    348240
     actgttcttg ctgcgttctt tcgtatctga ttcccttgca ttttatacac tcctttataa    348300
     caatacaaac gtttaaatct attctatttt acatccagta tatccgaaaa ttgtagtgtc    348360
     aacttattat aaaaagcatc cgtacatatg atagcgttat ttagcgaatc tatatcgatg    348420
     atggtcatat agttagtaag taaatagccg ccttcataat atgtaattag tatttcttct    348480
     tcggacaata aggaacataa aagcatgttc ttaatcagtt ctttttcttc agaggttaaa    348540
     ataggagatg ctactttatt tttctcttta atcatttcac gaattccggc gaatcgcgcc    348600
     cattttacca ttcctcggcc ttgttgcata ttagcgttgt tcatgctttg tgtcccccta    348660
     acagtgtgtt tctgtatctt gctgttgcat tatttgtata cgaaattcct cttaatatgc    348720
     tattctctcc aaattttgtg cgtatttcat ccgttacttt cgttagcttt atctcttgtt    348780
     ctctttgcgt gacattatca aaaagtgaaa tttgttcttc tctttcttga agtaggtttg    348840
     ttaaggatat gtttgtgcta cgaatggttt cgctagtata ttgctgattt gaactatctc    348900
     atttttactt cgtttagaag aaggaattcc taagtaaaga gttctatcga actctaattt    348960
     attaggctag ttccacagtc cttgcggtta gaagccttat cgttgcattc tttagaagga    349020
     gtcatcttgg ttaaaatgat aaaaaatgtg aaaatcgaca tctaagatga ccctattcag    349080
     taggattaaa taattgtaca ttgtaattat ttttaaaaac aaaaagaaca tccgttctta    349140
     ttatacacga acgttggttc ttttataaag aggtttttaa aatttcttaa aattaatttt    349200
     tttgttaaga agaatatgta acaaaggggt aaaatcccta acaataaaaa agtagtggag    349260
     agataatgtt attgatatag catatttaag agacataact ttagggattt ttaaacgttt    349320
     tatgagtcca ggagttggta gatatgattc atatagatat tgatatgttg atttatcaaa    349380
     gagttcaaca gttctttagg tccaaattat acataaagga aagataatat tttgttctga    349440
     tgaagaacaa aagttcaatt ttgaaatgca ggctttaaaa atgtatttaa aattgaatga    349500
     ggaataataa atcaacggag caacttccag tgacttcata aaagatgcac taagggaagt    349560
     tctatttacg tatgtctaaa atacagaatt ttacttaaag attgtgaaaa agtgtctttt    349620
     tattttctca acttttgaat tgctatagaa caagaactct tcctatagca attcatgagt    349680
     taagaggaga gaaaagtata taaataatta aagttaaata ttataataat atagtgaaat    349740
     aggacctctg tttcattaag aaatgtgtat gttctgattt gaaatttaag atgtatgaaa    349800
     tagccacttg tatattgaac ggcgttgaag ttacgcaagt aatgaaggcc aacttaactt    349860
     ataggtgaaa tctacttaaa atgaagttag gttcatacat aagttatttg gaagtgcatc    349920
     ataatctgtc attaaatagg ctttattggg tctatatttc tatcaaatgt tttgcaactg    349980
     aaccctcttt taatttactt caagccaatt gtaagaagaa aaatgaaaag tggtttcatg    350040
     ggtttgttgg ttttctatct ttttcagttt tttcacttcg ttttgacgct taagagtatt    350100
     ctctctaata cggtctacaa gattattagc gaaaaatgca ggttcgtatt caattacttc    350160
     gccttgggat aaatactttt tgacgttcat agcatgttta cctattgcat ttaatacatc    350220
     taccttgtgg aatgttgtaa ttccagcttc tgcaagtatt ttcttcacaa cgttaagtgc    350280
     ctttagatcg ggacaaatcc caacttgttc aaggatagga tttaataagg cataattatt    350340
     tttttgtaaa acaatattat ttttaagttc ttctattggt tcttcatcta tttttgattt    350400
     agaagattta tttgggtttg tatcattctc gttgggataa atctcactaa ggtcaagata    350460
     actagaataa atattattag gatgtacttt ttcctcccct aggggtggag ttttctcctc    350520
     actaaggggt gtactttttc catcactagg taccggaatt tttccttccc tagtaatgga    350580
     atttttctta tctacttttt ttacaccgta tttatctata gctgtagcta tacactcttc    350640
     taatgttttt aatggttctt tcttcttttt cttacgcatc ttaacatgtt tgtagaattc    350700
     tttctcacct aggaaatgtg ctaatgacgc tccactagga tcgggttcat tcaagtagat    350760
     tcgattagcg cctccatcta ctgattctgt ggatacaagt tcttcagcta taagctcttc    350820
     cataaacttc gtaacagttt tgtttgaaat atttaatgag aattcgattt cttgattatc    350880
     taaaatacaa taaatatcac ctttttcatc tacgaaggca ggcgtgtcgt ttccgttatc    350940
     aactgaaatt tgtgttgtat atatagataa attaaatcga tctcttatta acatgtatag    351000
     taatttcgca ccgatactta aattctcacg atattgtttt ttccaaatga aaactttagg    351060
     tagtttgtag aactcttcgt ttggtatatc ttttatatta attctctttt ttaacataaa    351120
     aaagcctcca gattcattgg tagtataata gtttgcaaag gacaaaagat taaaaaggta    351180
     aagagcagta tttttgtatt attaaacatg atagattttc ataatagaac aaatacaaat    351240
     tgaaatatta ttttaagcat tccaatttag actcaaaacg aaaatgtaag tgtccttact    351300
     tttaaatttt gtcctaggct cgatgtggcg aacatcgcag cctatttttt aggttaattt    351360
     ttatgaaatg tctcgaaaat gtattgacaa attgaattta atgatgttta tttttcttgg    351420
     ttttatcata caagggacaa atagcgattg caatcaactt ttttacaaat actaacttta    351480
     gttatttaat gacaaaaatg ttattttcac taaaaaacaa tattaacttt gttaatctag    351540
     tgtttattca acaaaatagg atatattttt atttgttaca tgaatgaaat atgtcgataa    351600
     tgtcatttat ctgaaagata ggaaaattaa gtgagatatg gtttttgtaa ttaagtaggg    351660
     gctaaagctc ctacttttct tgtgttttta aagtttacaa tttttttctg aaatgaagtg    351720
     gtgcttttga taaaattact agcatttttt aaatcaagtg tttatgttac ctacattaag    351780
     aaaacattag gaggaattat ttttgaaaag ccttaatatt actatttata caattaacag    351840
     tgcagaagga gaaagggttg cagaaaaatt agccaagtac gatttaatgg tgacaaataa    351900
     acatattgta cgagatcgtt ttacttttac tgagttcaaa gctttgttag cgttaacaga    351960
     caacggttta gatgacttat taactcaacg tggtagtaca attgattttc ttactgaaca    352020
     agggattgat cttgatgact taacgttacg tgaagcatac aatgtcattc ttcaaaatcc    352080
     gaagttgcta aaaacaacta tcttgacaga ctggaacagg attgcatttg ggctaaacgg    352140
     tacgaagatg ttccttccac gacatttaag aaagcaagaa caacggaaga tgtacttaaa    352200
     accagaagca caaatcgagt acgaggaagc tagttgaata taaaagttac taatcatgtg    352260
     tagtaatttg aaaaaaattt cgacttaact gaaatatttt agtgtattcc taatactagt    352320
     agggttaaag atataattaa tcaccttgtt agttatacaa cattacatac atgaagaatt    352380
     cataagggac aagttaagtg tgaagattat tatggcgaat tcttgaagaa tatatcaagt    352440
     ttttagaaac aattgcaata ttgttttgca ttgtattgtc aataaagatt ttaaccaatc    352500
     cttagtatgt gaaggttttc taattatcta tacagaattg aaatcattac ctaataggaa    352560
     gtattaggtc tttattattg gcagggtaag ctgaatgagt tacgaacgga tgttagaaaa    352620
     tatttcaatg gtaaaagaac atatggtact ttgggacata ttaagtgtag taacgaactt    352680
     gctgtgattg agggattgac taatgtagta agtagactgt aattacatac ttgattatta    352740
     agacatattt agcatttgtt cgcaattttc aatgcatatt tgaagttatt aatcggagta    352800
     atagatcgta aaggacctgt tttgattgga tgagaattga cttatcgaat cagtggtctt    352860
     tttttatttt tagtggattc tactgtattc ctctataaaa atataatcta atctattgaa    352920
     aaaacaaaaa actatgtgat aaaggatttt tcaaatgaca aatatactaa aagaaattta    352980
     tgtaaataac gaactagatg tactagtaga cactaatacg gaggtgttag aagcagcaaa    353040
     actaatgaag agactacaat ctcatattag cgaattctcc tacaatttaa aatctagtgg    353100
     aatgcaggag aaggaaattg tttgtggtgg acagattcag agtattgtaa acatgaataa    353160
     tctaagtgat actgcgagtg ctaatattgt ctatgtaaca cttaatgatg gttttggtga    353220
     gctactaatt gtagtaccag taactttatg gcagaaactc agtgctaaaa aaggtgatgt    353280
     tgtaattgcg agtgggaaaa tgtttgcctt aaaaagagat tgtaaattca aatcaagggc    353340
     aaatacagat attattgttt cacatggatt tgaacctttt cgtgtgttag tgagagaaat    353400
     taaattatta ccagaataaa gcgtgggata acgtcttatt gatttaatga aaattacaag    353460
     tgtacaattt tcttctgacc tattgacttt ttgttctcaa atggttttgt ttgtacatac    353520
     aaaaaaatat aacgtcgaat cctcttaaag cgactcaaaa taagaggtaa gatgaggtgg    353580
     gctgatgcac ttcataaaat acagtctgta gttttaaaga attcaaaagg aatatgaaca    353640
     gattggcaac agaagaatta ggaccggtag aaggtagtgt tctggatgca gtaccagatg    353700
     tagttgttcc tcacgtatct ggttttctag ttagaggaat tatacattgc attacattaa    353760
     aaacaaaaga agatttctta aacactaata aacacctctt aactagagtg gattttcata    353820
     tttttgaaat tgcagatagc gaacgctata taaatcgagt aacaaataac taagcaaact    353880
     aagacaatac aggaggattt taactatgca aaaaacatta gctaaagaat acattgaatc    353940
     tgtagcaaag gctttattag aaacatctcc aagagaggta atagaattta aaacagtatt    354000
     aaatgcacac ccacaaggta atgaaactca tgcagggatt aacgaagtaa tttctcgtat    354060
     tttcactgat ccattattga cagaactctt atctattgta ggaattgaat ctgaagagaa    354120
     aacagtacaa gaaccaattc ttgctagctt attagcttct caaatttcaa ctcaacaact    354180
     ttctaaacaa attcgtgaac aagtagcgaa agtagatatg gattcttcag taatgattcc    354240
     ttacatgaaa ttagaaccaa aggctaatct tgcagctttt atcaaggaac aagctgcttt    354300
     caataaactt gtagaagaca taaaggctca attcgaagtg aataccaaag aagattttgc    354360
     tgcaaatatt aaagatcaag tagaacaaca aagacctgct aagactactg agggaaaaat    354420
     aaaaagtatc cttgatgaag ttgttaacga aatcattgaa gacggagctg ctagtcaaac    354480
     agtttgctta gaccctagtg gaattaaggt ttacgaaatt ctattttctt ctgttttcta    354540
     taaaaaggca aatatgttag gttttaaaga gtctgtagag tacaagcacg aatacacagc    354600
     atatatccta agtgaacttg ctacttattt agttgaagaa gaaggcttta aactatcctt    354660
     tgaggtggta gaagataagg tagtagcagg tttagcttaa tagcctggta ttaaagagaa    354720
     tataggatgg aaaaggctac ccttgttttt tagaaatagt gtagtagaca aatggtaaaa    354780
     acagtgcggt acagaaaaaa atagacatat cagttctctt catttaggag cgctcaataa    354840
     agtagattaa gtttaacctt gaactaaaaa taggaagtgg ttaatttagt cgtgcatttt    354900
     aatctatacg gaggtgtacg actatggcca ttccagttat acaaaatctt gtggctgcaa    354960
     gtaaatatcc aatcaaagct ccttattcta tgaacgcaga gtatattaca gtgcataata    355020
     cgtataatga tgctcctgca aaaaacgaaa taaattacat ggttggaaat aacaatgagg    355080
     tttcatttca ttttgcagta gatgatattg aagttattca gggtattcca gttaatcgta    355140
     atgcttggca ttgtggagat ggcagtggga atggaaaccg aaaatctatc ggtgttgaaa    355200
     tctgttactc gttgtctggt ggtccaagat acgaaaaagc tgaaagttta gcaattaaat    355260
     tcgtcgctca actgttacga gaacgcggat ggggaattga tcgtgtgcgt actcataaga    355320
     gttggacaga gattggtgtt cgaaacggta attctagagc agttaagaat tgcccacacc    355380
     gtatcttaga tgaagggcgc tggaatagtt tcttagcagc agtacaagct gaacttactg    355440
     gtacgggtgc aactatagca ccaccagtaa ctcaaccccc atcttcagat ggtattggtg    355500
     ttgttgagat tcttgttcca gaacttaatg taagggaatt tgctagcttt gattcacgag    355560
     ttgttaagac agtgaaaaaa ggtgaaatgt atcaaacttg gggactatct aatggtctat    355620
     acaatgttgg aggaaaccag tgggtgtcag caggtcctgc ttatgttaag tttactcctg    355680
     caggaagttc taatggaaat ccagaaaatc tagcgggaaa acgtgatcca attgggaaaa    355740
     ttacaactac tgcaaatcta aacgttcgta cacaatcttc tacagatggg gatattattc    355800
     gtactatccc taatggagaa acgtggaata tctacgatat tagtggtgga tgggcgagag    355860
     tgcatgatgg ttgggtttct ctagcttatg caaatctaac aagatattaa tttccaaaaa    355920
     agtaggcaca tgttgtgtct gcttttttat ttagataatt taaaagttat tattgacttt    355980
     atttgatcat agggttttat taataatcta gcaaatatat ttaaaattaa attaatagat    356040
     tttaggatgg tcttcgctgt gaggaagaag accctagtat tcgatactag attaggggag    356100
     tggtaggagc ccttaattta aatataaaaa gtaaataccg gaaaataaaa gagaagtact    356160
     tatgatttta aatactattt cttcttcgct tagctgttag agcgcttatc ttacacacat    356220
     agagttacag gttcaagttc gtcattttaa aaaattatag ttctatagct ctgcatagcc    356280
     tatgcggtag cacggattaa aataccgttt gggtcgtttg tttttaataa aacgaaaagg    356340
     agtttgatat tagttgaaaa catttttaag caacttagtc ccaagggttt ataagactag    356400
     aaatacaata attatttatt ggctaggtta tgaattagta ctaggtaact aatgtaacga    356460
     taatactaca gatatactaa tggtcgaaga ggattcctag ctaggtgggt agtagttggt    356520
     aaggtttacg cgattttgta acctgttctt tctggtaact tatgattatt ctctcactcg    356580
     tactattaac agattagata tatttaaaat actatatacg cctaatgtaa agagtttact    356640
     tgtgtagaaa aaaactacgt gggaaagctc tttttttacc ttgattttta atttttaagt    356700
     gcttacgttt tgagaggagt tatttattaa caactcataa aagcagtttg acgttgtttc    356760
     attaaaaaca ttttactata acatgaaatg tttaaggagt acttctattt tcataaatca    356820
     tgacactact aatgataatc atattttaat agaaatatgt aggtatttct ttcaaaaaga    356880
     tagtaaataa actatcagca gtctcctttt aataaactta tagagaaaaa tagggaagaa    356940
     atgcaatctt cacgtgtcat aaatagaagt gaagttttta tacaggattt taaagaaaag    357000
     taaaatctcc actaaatcgg ctgtatttct gtcgttaaaa cagcttcatg actatgtggc    357060
     aaatgaaaca tttttaccaa attaattaaa cattagttgg aggtaattta ttatgcatca    357120
     aattattaca attacaggtc gcttaactcg tgatcctgag agtaatacgt atggtgaaaa    357180
     gacagtttgt cgttttgctg tagcagtaga tgatgggtat ggagataaaa aaactactga    357240
     tttctttaat gtatctgttt gggggaaaat gggtgaaaaa gtacaaagat accaaaagaa    357300
     aggttctgtt gtgcaagtaa tcggtaaaat gaaatcttct aagaaggata aaactacgta    357360
     ctgggaatta cgcgcaaata acattgtatt ttttaccttt gataataata gtaatcaaca    357420
     acaaaataac tttgaaatgt tcactgatga cataaatatc agtgatgatg atttaccatt    357480
     ttaaagtaga ttatttattg gtggaggtga ttatatgagt gatcagagaa ggttacggtc    357540
     ggagttaaaa caagggctcc atcaatttac gatgaccctt tataattctt atagacaaac    357600
     tttatcgcat gaaaaatctg tagaacaatt atccaactgt ttaatagaag agtatgaata    357660
     tttaactaaa caagttatga aacaagaaaa aacttttaat cttggaagcc ttgttgaaaa    357720
     ggtggaaaaa cgtgctaagg atgaaaagga ccccgtaaaa cagtttgagt tgtatgaaga    357780
     tgtggaaatt ctattgcgtg cacaggaact tgttacaaaa tacgaaacgg ggaaggataa    357840
     taaatgaata ttgcaaaatt aatgtctaca attaataagt cttggttttg ataatagaat    357900
     gttttgtcga ttaaaagatg atatgaccca tttcatatca acaaagaaag ataaatttat    357960
     tatggattat aaaatttttt ttactcagtc acaaaacatt aaagattgat ttaatacagt    358020
     acttcctata agagagtcca atacctttga aaatagatta tttctattta atagatgtaa    358080
     actttgtttt tggaggattt gattatattc aatttagggg tgaacaatta aaggataaag    358140
     atattgttgt tattgttagt cagcaaacat ataaattgtt cctaccaata gtttctcatc    358200
     tttattctac gcgcattcat aatacactca atgaagtaga ttcatacttt cctatgttag    358260
     acagttcgga atggtcaact aaaatacatt cctgctataa aaaagtgagg attacgatca    358320
     ttcgttcagt atatattttt tgaaaggaag ggttagctat gctaaagaat cgttcatgtt    358380
     catggtgtga tagcaccggt ataacggaga aaggattttg ctgtatgtgt aaagggaaag    358440
     ggtatatgga agtaattgat caagcagtgt ttgctgcaaa acaacaacct aacttatcat    358500
     gtcttatccg cgctatttct aagcatacga ctccggagca attttcaaac atcatgaatg    358560
     attgttaagt cttagccaat tagttcaaga gctccttgaa agaggctccc tttttttaga    358620
     tttaataccc ttaactaaag tagggagaaa ggtaaatgta ctagggtaaa gatgtttgta    358680
     agtcacttgt ttggtttata tatgtataca agtttaaatt taccagttaa tcatgattat    358740
     aaggaacaag aaagggtcta acctggcttc ctaaaattat taacaacagc aatattaaaa    358800
     atcgctacat tgaaatccct cgcttaatac tctaaagaga tgtttgaaag agggatttca    358860
     aattagggga tgaagctgca tcagaggata tagttcataa gttaatagaa gcttacgagc    358920
     aattaaaaat tcctactagc cttgagaaaa atagtggatt taaaaattgt ggaacttgga    358980
     tatgtggtta aggtaaacta tgataattgt atgcaccaat gagtgaaagc taaatagcaa    359040
     caataataga acttgtttac tctcccttaa gaacatgatt ttgcaaatgt gatttaagtt    359100
     aggagaagaa aaagtaggat atggctctaa tctctgtaat tcgttatggt gattaagtac    359160
     catatcttct tttttggggt gttgcatatg tttaaagata ttttaatgga taataagggg    359220
     gcattaattc gaattattgt ctttgtacta gcttggttga atcagtattt gacttctaaa    359280
     ggctatcaac ctttacctgt attaggtgaa gcagaagttg ctgctgttgt tacatttatc    359340
     gcatcagtgc tgacattgat aaatgataac aaggtaacgt caaagacaaa agaacttaag    359400
     gaataatgtc atcttgtaag acgggcttaa atgctcgtct tattttttta ccgacttatt    359460
     gacgttttca aattaactgc ttacgtttct attgagagtt gtgaagaaaa tttaatagaa    359520
     accaattaga tagaaaatat ttttgtataa ccgaaagggg aagctcaaga tgataattac    359580
     agaacatgcc gtcaggaggt ataagcaacg tgttggaaaa agaactgctt ctaagaaacg    359640
     tgttgtaatg caaattaatc gagatcttgc tcgtgatgta aaataccgca aaccttctaa    359700
     ggttaagaat cattatatat tagtaacatc tagataccaa gctgtttgtt acaaatctag    359760
     agttgttact atcactggtc tgaaagagga tgttaccaac tacaagtata ccactcgttg    359820
     tgatcaggag ttgggtcttg ttgcataagt gtagtaagaa acaaatggcg aatatgagaa    359880
     tgcagcaatt tgtaaattat gtaaaaagat tcggatttat aagaatactc aaggaagggt    359940
     ctagaaatta gaaaccagaa agaaaagcaa acagctggga atgccgttta gaaaaataca    360000
     gatttaaaac ccgggattac ttaatggtaa aagataaaaa agctataaat ataagtttta    360060
     aaaaataatt attaatccta agtatttgtt tttacatata tatttgaagc gttttgagaa    360120
     aattgacccc actgcgttat ttcgttttga tgaaacatat ctactttatt tatctagtga    360180
     gatcattcaa tcaagaaata aaaaatccga gagggaaata aaaagataag ttagtgagaa    360240
     tatttagaaa gatgacaata atttcattga atgtttatgt aaagttaatt ggtatcttaa    360300
     aatggagtat ggcaaaatta ttagagtgta atacatatgt ttttatatct tagggggtga    360360
     aaaatttgaa ttcagcaaac ttgggttggt ttgttttatc tcaaacaatt ttgggaattg    360420
     gcagttatgc aattatgtgc gccatattct gtttaaggtt ccatcgaaac attacgatga    360480
     tttctctact ttcatttttg actagtatta ttaattactc catctatttt aataaacaag    360540
     aaggtattgg ttatttagta ccgattatag gaatgctgat aactttcctt tatttagctg    360600
     ctatagagaa gctttctatt atgtgggcac ttgtagtgac tgttgcagga ggtgtcatta    360660
     tacctcttat tattcaaatt atgatcatat ttgcttcact tggatttttt agtccttctg    360720
     aattgaaaga gcatatttgg aggaattatg caatggatat tacatctggt tttagctatg    360780
     ctttattagc atttgttctt tattctcaag agtggacttt taaatttgat ttcgaaaaaa    360840
     tacgttttaa atatgagaaa tatatagtga taggaatttc tcttgttgcg gcaattgttc    360900
     tacctgcttc aatgtttatg acacatgtaa aaggtactga tttgaattta atatttttaa    360960
     ctattagctc aactttagta tttattctac ttttaatatt ttccataaga aaagaacgga    361020
     cagaaaaaca gtttgacaaa acaattaagg aggtaaaaac gaatgctcaa aaaaatgatg    361080
     tttaatcttt caatggctgc aactaagatg tctattagta gtatttcttg gtggtgggaa    361140
     tagataatta atgaagaggg caggcatctt tatgatgatg gctttctttt tatagataat    361200
     aatcagattt atttgtaaat aaataaaata tcatagaatc ttcattctaa tttaattagt    361260
     ttttttatgt atgatatagg aaaattaagt ggtaccagta attatatcca agggataatt    361320
     ttacaagaag tgtaagcggg aatgtctatc taaaaaagat gtccatgtgc ttctaatttt    361380
     tagacaaggt tcagttggaa gagtagtagg ttttaataat attactgaaa gaagccgaat    361440
     tcaccatact tattcatata acaagggagt agtaaataaa atgtcaaaca aagataaatc    361500
     aaatatattt gaaaaaacat ttggtgaact actagaaaac aacaaagaag agaatgatgc    361560
     ggtgattgat caatcgagag ataaattaga agaggtcttg ttaagagcag aagggaaaaa    361620
     aatcttatcg catgaagata ggggggaatc aactgaggga tatatttctc cttccattaa    361680
     agatgaaaag ttggaagagt ttgtaggtga aatgccatta cctcctatta atagagaaca    361740
     agaatcaagg gctgtatcta ttggtttaca agaaattcgg gaaatgaagg agtacatgct    361800
     gtatattcat cgttatatga ttaatgaatt taatcgaatt tatgcttcat ttccaattct    361860
     gtttgcaaaa gactttgaag ataaattcgg cactgctcat aaggaattag ccacaataat    361920
     ggaagatatc gagcgtttca ttattggaga tatttataat gtagaggcag tgaaaaatga    361980
     ttttaaactc gttcaaaccc tcgaaggaaa gcggctgtca atcctctatg attttttaga    362040
     atatcaaaat aataaaaaat tacaataaag acttgtaaaa tcaagtgtaa gtgcttatat    362100
     tctgtttgga cattttatat tatggtgtaa atgattttta aggtaaaaca actgttacaa    362160
     attttgcata gggatgaggt agtttatatg gagaacaaac aaatcgtatc atataatgca    362220
     caatcaagag gtcataagac aaaggggaat acatacaaag aacgttacgt cgagaataca    362280
     tgcccggagt gtcaaaatcc tcgtgcatat aaagatgaat ggaaaacaag gattaagtat    362340
     acatgcttaa agcgtgcttg ccgtcatcag tggttcgaaa agaaagagtt tcctgaagtt    362400
     aaagaataaa aataatgtat aaagagtccg ttcttttagg agggctcttt tttattttac    362460
     ttctctataa aaacttctaa ccttctcact actgtaacaa cagaaatata ataatgagag    362520
     gacttgattc aaaatgaaaa caaaaatcaa aaagggaaaa ataatacaga actgtttaaa    362580
     agtcacggca gcaaccgtag tggctagcgg tgtaggattt caattttatg agattcaaga    362640
     gttaaacaaa gaagtgaaat ccttagagaa aaaccataaa caaactgtcc tagaattaaa    362700
     aaccgcgaat gaaaaaaaca aagtattaga agaacaaaaa aaacaaattg cagctaatac    362760
     agaacagctt tctattgaat tagaagaaat aaaaaatgaa aacgaagcta ttaaccaggg    362820
     gaaacatcag tctctagaag agaatcagaa acttcaagca gagaatgcag atttagctaa    362880
     gcaattgcgc gaagcgaagg aatctgccag gccagtgatg cctgaaaaac catcatcaga    362940
     caaatctgat cctcctactg ctaaagatac tagtgtttct agaacgatta tggggattgg    363000
     tactgcttat acattaaacg agccaggagt tacaggtata acagcttcag gtaagacaat    363060
     acaaccaggt atgattgcaa tggatcgctc ggttccaatg ggaacaagag taagaattac    363120
     atgtgattct tatccatata ttaacggaat ttacactgtc gaagatcgag gtggtgctat    363180
     aaaaggaaac atagtagaca tttatatgac agatgctgac agaatgaatg actttggacg    363240
     aagagatatc aagatagaat gtcttaacta gttgatgata tggatatcat tgggcacggt    363300
     tgctgagaaa gtcaggggaa cattagaagg aaaagtaatt ttggtataac tatttattta    363360
     ggtaaacaaa ctgaaagaag tacaatgaat agcgtaatac tttatattaa gaaaaataaa    363420
     attaaaaaag ttgtataaaa atggcccatt gtattatttg atgggccatt tttatgcatt    363480
     cctcaaagaa cgcgaagtaa gtaggagaag atgagtttgt ttcggacaag agatgacagg    363540
     agccatatta atttttccac atacataaag tggtactata taccgaatgt atgtttggtg    363600
     tataatagac gtatatcgaa atggaggtga aagaaatgag gcgcaataaa gtatctaaat    363660
     tttgtatcta accaaattaa gcacaggcac tggtaactaa taaaatagtt ggctatttac    363720
     atgttatatt caatcacttt ctattctctt tgggataacg tatacaaaga tacagggaaa    363780
     ggtttgacat atggtatatg ctttcacaaa ctttctgcca tgaagaaagt gtttattttg    363840
     caaaaagaag tggatagtat tgcgattcag tcgtctattt gcaacattgg ggatgcatat    363900
     acacactttt tcaaaaacta aacagtatcc tttgtttcaa atctaataag aacgaaggaa    363960
     tcttctcatt aaaataaaca gctagtaaag gtagctagaa ttcattaata tatggaaaat    364020
     tatttggaca aagtctcaaa ttaaagaatg aagcgataag gcttctaacc gcatggactg    364080
     tgaagatggt ctaataaatt agaattccac agaaatcttt atttaggaat tttctcttct    364140
     aaacgaagtg aaagtgtagg tagttgagta tagtatgtaa tataaatagg aaggaaaacg    364200
     tttttcgact aaatgaaata aaagtctata catcagaaga attgaaagat aaaatggaac    364260
     ttgacctaaa tcaacattta aaacaggtag ttgaaatgcc gagtatgcta ggtgtttgac    364320
     taagaatgga ttatgaaagt attgcttcta tttcagattg gtatgtaaat aagaaaaagc    364380
     tatcgattat attggcagaa atactgaatt aattagattt tttctatacg atgacgtact    364440
     taaatgtagg attaaattca ttcgtggcaa atatgtcgtg aaagatgatt gaagtgtgta    364500
     aacatttata agtatgcttt caatcttgaa taggtagggc agaattttag gaatacgaca    364560
     aaagtgagaa aatgaagcac aatgtagaat tactccaagt tttaaaagag gatttaagca    364620
     gaaaagttaa tgtacatgta gttataaaaa gtgtttcacg tataaaggtt aaaaaataat    364680
     atgaggaatt tggatgatac ttacaagatt gaacgttact cgtaagtagt accttttaca    364740
     gacattaatt gcattatgta caaaaaaaat tatggaaaga taaacgaatt cactgcttaa    364800
     tttcgccttc taacaggaga ttttttgcgt tgttttcaaa catttcgcac ttaaaagacc    364860
     tgtgggaggg agaaaattgt acagattatt attacttgaa gatgaagttg aaatcggtag    364920
     cacacttgaa atgattttaa gaagcgaaaa ttatcatatt gattggttta ctactggtga    364980
     tgaagcagtc aatgctgctg tatctaatga ttatgactta atgatattag atgtcatgtt    365040
     aaagaaaaca gtgggagagt taaatactcg tatttcaaat ggccttgaag ttgcaaggtt    365100
     agtgaatcaa aaaaagaaaa ttccatattt actcctgaca tcaagaagcg aaccgctaga    365160
     tattatgcaa ggcttagata tgggagcaga agattatata acaaaaccat atgacttaac    365220
     ggtgttgctt gcgagaatcc gaacagtttt aagaagaagt tgtagtaacg atatttctaa    365280
     cggaggaatt actcgatgcg gtaatattga gattaattta ttaacgcaca aagtaattgt    365340
     tgagggtaag catgttcatt taactaaaca acttttcgaa ttattacatt acttcatcat    365400
     tcataaggga caaattattt ctaaagaaga attatataaa aatatttggg gatatgatcc    365460
     ttcagaactt caagaaacaa atactctgga agtaaatatc cgtaggttaa gaaattcact    365520
     tgatgttgat ataatcaaaa cagttcgagg taagggttat gttcttgaag tctctagttg    365580
     ctagaaggat aaaaaataat aaattacata tgaagataat ggcggtggca gtcattgctg    365640
     ttaccttaat tacaataccc attcagctac tattttttgt ttctgttgtt ttaaaaaatg    365700
     gggaagaagc gtttagtcat atcaagtaca gggcgattca gattgaaaat gaagcttgga    365760
     gaattggcgg gggtgataag atacatcagg aattttttga tggaattcta ttaaaaggtg    365820
     aagaaataaa agtttcatct gcagcaaaaa acactgaata cactttctac attaaacaaa    365880
     acgaagaagc aataagtagt gtagataaat acttttcagc ctttttaata gaaactttag    365940
     ttaaaagaca tcaaaaagaa ataaataaat taggtaacat atcaattcgt aacgatgaaa    366000
     caaacggcct gtattatatg acttataagc atacttttaa acatggagat aataatgaaa    366060
     caattatagt aaaaagaaac gtaacaccaa ttgttataaa gctaatagag aaatatcaaa    366120
     aagaattttt tatttactta ttgtatttca ttattgctat aagtatattt atctattttg    366180
     gacttggcct agtatttcgt ttctttggga aagctctgga taaatcattt gtggagttaa    366240
     aagaaaagga ttacaaggct agaatagaca taaaggatag ttatggaaaa gaaataagca    366300
     atgttcagca tcaaatcaat ggtattctcg agcaaatgca aaataatatt gaagttaata    366360
     tagagtccat gcaggatgtt tcacatgagg taaacaataa gttaacctca attaaacaat    366420
     ctattgatgt gctacgattt tacggaacaa ataataaact aattgtagaa caaaaactaa    366480
     agtcaataga tgataatatt gaacaaatta caaaagttat gtctacattt ctcgatcttg    366540
     caaaattaga ccggggaatt tatatggatg ctacaaaatc tcgggatgta aaagaaatga    366600
     ttgagaatta cctacaatat ataaaaaagg tttttcctga ttttgatttt attggtaaat    366660
     atgatgtaag atcgccaagt attcatttta gtaaagaaca ttttgtatta gccttaaatc    366720
     ctatcattga aaatgcagtt aggtattcat tgcagagtaa tgagatagtc attcatattc    366780
     gaaaaggtaa atatttaaac tacgtatata ttgatattat taattggggt attcaaatcg    366840
     aaaaagagga aatcccacag ttatttaata gatattacag agggaagaat attgaaaatt    366900
     caatgaaagg gttcggaatg ggtttaacaa tatccaaaaa agtgatgcat ttatataagg    366960
     ggaaaattca tgtaaagagt tatgaagatg gcaaaaacat ttttacatta atcataccct    367020
     tgcatcagga atcgagaggt gatacctaat gggaaataag attaggaaat ttctcaataa    367080
     ttttgtgaaa cgtgataaac tacgtgtgca agtagtttta ttaaccctta tacttgttct    367140
     tgtttcagca ataccagtca atttattttc tatttataat gagctacaac taacaactca    367200
     aagagaattt gaatctatgt tttccagggt agagaaaata caggacaaaa tagttttatc    367260
     aggaataagt gcatcacagg aacttgattc tgagttcttt aagcagatta gctatccagg    367320
     tgaatcaatg aaaattcgca tgggtgaaca aggagcacaa gattatcatt atgcagctga    367380
     gtatgaacag aatgataaat ttggtatgtt tgaagctcaa atactgacct tattcgtccc    367440
     aacctttttt gattctatta aagcacatat gaaatcacta gatgctactg cagataaaga    367500
     tagttatagt ttttatattg atgaaaaaaa taaagcatat ggtgagattt tacattcttt    367560
     taaacataaa agtcattatg acacgataat cataaaaaaa gatataacac ctaatttgaa    367620
     gatgcaaatg gttaatagca tggaaaactt cctatatatg ttcatttggt ttttcttctt    367680
     ttcagttgtg tcagtattag tatgtttaaa atttattttt aaaccattac aaagtgcaat    367740
     ggattcaagt tttgaaaatg tagtagataa taattatcaa acaaggattg aagatccttt    367800
     gtatggagaa gaaatatcaa aaattgttca tcgttttaat gcagtattag acaggatgca    367860
     tgagcttgta caaaacaacc ttaattccat gcaagatgta tcgcatgaga taaagacata    367920
     tcttacggca atcaaacaat ctgttgatgt tattaaatta tatggaaaaa gtgatgaaaa    367980
     actagttgct gaaaaactaa atgctattga agataatata attagggcaa cggccattat    368040
     atcaactacg ctggaactag cccgtttgaa acaaatccca aatattgata gtgccaatta    368100
     ctatgacgtg aaatatttag taaatttctt gttaagattt aagcaagaaa cctatccgag    368160
     ttttattttt gagacagact atgattctga agatgttgag atatttatag acaggaacca    368220
     ttttttctta atgatgagtc caattcttga taatgctgtt aagtattcaa tgaattcaaa    368280
     tatagttaaa atagatacta tttctaaaag aattgataat atggtttata tttccattgc    368340
     taatacgggg gttgttattg atcaaaaaga gattcctttt ctctttgatc gttattatcg    368400
     tgggaaaaat ttggggaatt caaaacaagg atctggttta ggcttgacca tagctaaaga    368460
     agtaatggat ctgtataaag gtagaataac tgttcatggc acagcagctg gagtaacatc    368520
     ttttatatta agttttccaa aggccattag aagagaagac tcaggaaatt tatcctgagt    368580
     ctttttattt tgatggtgag aaataataat tatatagata cattaatctt aggtggcaaa    368640
     gtatttgttg gagtaatttg gaaatttttt tgataataac tagggctgga ctatttctac    368700
     cccaatctac ttcaaacttg ctgtacattc aaacaataga gattgaatgt attcatcttg    368760
     tggagcttta acgctcgtat ttttttaaat gggctaagat atactccatt tttgcagttg    368820
     tgtcatttga attttgtttg cgttggtatt ctgcaatttc ttggaatagg ctttcttcaa    368880
     gagcttgaat gtcatctcta ttatagttca ttatttcatc catctccaat gtatatatga    368940
     ggttgagcaa gtcatcaatt ttctcttcat ctactataag tctagagaat tcttcaagag    369000
     ataaatctac ccctatatta ccacggtaaa tcttcaagca accacacctc ccttatgtaa    369060
     gtctacacat acctaacata gacagcatct ctgaaatcat tgtatctctt gctttctgta    369120
     tctattaatt tatagatgaa aataatttta taggaagtgt cttatttctt tactttaccg    369180
     gtactataaa agattttacg ctaactaatc gtgtagatag gttctatctc agtcctatat    369240
     ttttttataa ggtaaagtat tgtgtccaaa gtttttgtta gttttttaat gtattaatgt    369300
     ttaaattaat ggattagtcc ttataaaggg tttagaaatt ttatattctc aaaaagagtt    369360
     tcaattcact caattcttct gtattttctt tttagagagt tttcaagaag agaattttta    369420
     aatcttaatt caaaacggtt atatcgtcgt tatctgtcat ttctataact tttcacctca    369480
     aacgttaata aatttaagca caataattcc ttcctggact aacttatttt aagaatttga    369540
     accattagaa atgagggtgt aaagtattat ctaaaatatt taaaggtgag ttagctcaat    369600
     ttagcaatta taagaaaagg taccttttag ctttttagca aatgtggtat aaaggaagat    369660
     ggagtgcttg agggaggaat tagtcatgaa taagcaagaa gcgatagaga tcattaagaa    369720
     ttctttttat catttaatgt tcgaagaaaa tgttaaagtg ggttcaatta atgttctttt    369780
     gtattttcca tctataggca tagcagtgtt agaacctaat aaagatcgaa gacacttact    369840
     tatagaggat aatattgaag atatggatga actctatatt aaaaaagaat tgaaagctaa    369900
     acccatttat ttagatttgg aaaacgatga attcaatatt ggatttgtta tcaatgacat    369960
     actgttggag gcaagatttg caccagcaga gaattttttg gagagtagag gtacctaaga    370020
     gaagggggaa ttattatgta actctttttg aaagtctcaa aatttaatta ttgagtccta    370080
     ttataggagt ataagactta tctttcttga tatgtacctc actataaatg aactatactt    370140
     gaaagaaaga gacgtattta cgtctctctt ttattttgag gaaaatataa ggtttgcgaa    370200
     tttctggtat aactctaagt tagaatgtaa cgctttaaaa tcaaaaagag tttgttcctc    370260
     ttaattctta aattgaaaag ttatgcgaac aagctaattt acaagaagaa agcagagtgt    370320
     tttataatca agtccaacag tgcgtgttgt aatgaaatat ttaggtaata ggtttaaata    370380
     ttttcctcat tgtgaaatta aaatagtgga aacagtaaag aagagtatgc ttcaaaagga    370440
     ttaagaaaat ttatattcat agagtttttc cctttttgag aacatcttaa aattaaaaag    370500
     agaaaagaaa tttaaatttt tatttatttg gtaaaaaata tcaaaaattt gttttaattt    370560
     cttcttattt tttatataat aagaacatca gttcgtaaaa gctagaaaaa tcataaatta    370620
     acagaacaag agggaataga aaaatgagag aaatgagata tgggttatcg ggatatttag    370680
     caccggatgg tattttctat gaatgtgatt acggtaagca tagcgaactt gccaatgagc    370740
     ttattgaaaa atataaaata aaaaataaaa cgaactataa cgaaattgca actaggggag    370800
     aatttttaaa atttggcaca tatccttggt caagtaaaga ggggtgtagt ggttgccacg    370860
     tttttaaaag tctattccac ccattatcta ataagcaatc tatatggata aatgagaatt    370920
     tggataaact tactgacaag caacgttctg aattgaatag attacttgat caagaagagc    370980
     tcataagaaa taaattagct atggagagta agaaagatgt ggaaaaaata cagatttcat    371040
     atagagttgg tacaagatta tcagctgttg gtgtttaacg ctaacatttt tattaatttt    371100
     atttaaatag ataaaaagta ttaattaaat agttattgat gcggtcgccg gagttaataa    371160
     atttagggga attacagcct agaaatacta ggtttaatca aaaggaaatt aaattgtggg    371220
     gataagaaca attagaaaag gaatttgact tatacttttc agttcataac acttgcttgt    371280
     ttaaagcaca ttaactttgt gtattgaagt gactttgagg tatcgaaaca aaatataacc    371340
     gtaatgaata acagactcat attggtgcag ttactaaaat ttttgatttc gatgaagaag    371400
     cttatgttcc aacatagcat aaataacata tagacgtgta ttttacgtgg tactaatatg    371460
     agcatcttat aaaaagaaaa cacgtcaatt aaaaacatat tatggttaat ctaatgacat    371520
     taattacttc aggtgtatac agtagatgcc aggtgatatc ttctcaagat acgaggtgat    371580
     tggggatttt ttaagaacct attaaatgat tccaagctac atatcgatta attatgctgg    371640
     tgatgatgta tttctttcgt atcttacaat agtgtataac ctgtttatag gatttgagct    371700
     aaatccttaa tatagtattg caattctttg tataaatgca ggccgttgag tttgcggaca    371760
     cgatcatatt caaggtaatt ttgaaacaga agatattcaa tttcatatga atataattgg    371820
     ttgcccgaat tattattcta attaccttaa aaaatgtaat accagaaggg atggaaaatg    371880
     aacacaaacc atttggtatt aaagcatttt aaaatttagg cataataaaa aaccacgatt    371940
     actcgtagtt ttctttttta ctaactttaa tcttaacact ttcaatttct ttctctagat    372000
     aatcaaagtt ttgagtgact ttgttttcta agctagtgaa attgaattgt acctctttta    372060
     atgttgtagc aataccttca agctgttggg tgttcttttc taagtttacg aataattctc    372120
     tttcacgatt gtcagagcga agccgatctt ccgctatcat tttataatgg tcttcacgct    372180
     gctctttcat gttttcattc atagaggtca tttgatcctt gtgactatca ctaacactac    372240
     gaacatatcc cataaccttt atggacataa agatagcaaa tagcatgata atcgcaaaga    372300
     gaaccataaa aggtttatca ccctcagtaa tgctaacaaa aatcttttcg ataatgccaa    372360
     tttcatctgg agtcatgcag cgactacctc cttatctgga gctaaatttg taatccgtcg    372420
     cagtagttca tcatggggca aggtttgcac atgaaacttc acctgctttt ttcggtacga    372480
     actcctttta gtacgccctt aaggcgtttt gttttattct cgtctctata taaagacaaa    372540
     tgtttatctg tgcaatgtaa aaataaaaga attaatcaag cgtggattag aatagttcat    372600
     gaaaaggata atagtagtta ctcatagatt atgtctgagg ggaaatttag aggaagtatc    372660
     tgttttgtta ttgttgattt taaaattagt aatttgaatc aagcaataat tgtgtgattc    372720
     gattgatgga ctttccaatc agtttaaatt cgtctgttag gaataggttg tcttaaatgg    372780
     taatagttat ttcgggatat ctataccccg atttagaatc tgtgatgttt gttgttggtt    372840
     tattcatata cgtgaaggta agaagtgtct aattacttca aaaatcaagt aatattggta    372900
     cgtatttttt attcaaacca ttcaatcata ttttcacatt gttttactgt tgcttcgtaa    372960
     tcaatctcgc tcatcttttg ttcttcttct attaatgaag aaatagattt taccaattct    373020
     ttagctagta cattgtcgga gtttttaagt cgatacaata atcgaacttt gttttgaaaa    373080
     gaatatttcg cccattcgtc ttctccgata tatatattaa cttgtggttt atctgaatta    373140
     tcgttttcaa tgtattcgat cattttttaa gcgctccaat tgctatattc acttgcggga    373200
     tcttcatgag cataagaacc acaaactggg caaccttttg tatctctctc atcaattaca    373260
     tactcgatta cgtattcttg ggaacagttt aagcattcca cccatttttc tgaaaattca    373320
     tatttttttc tttgactttt caatttttat cacctctctt acacgtatac aacaaccttt    373380
     agtaatgtat attgtcaaat tcttgtttgg acaattccta actgtagttc atgtttagta    373440
     ttgattttat aataaaggaa aggttgtaat aaattattgt agagaggtgg tgttgaaaat    373500
     gaattatatg aagaagattg atgaagcgat tgagttattc aaaaatttaa ttagtgcaac    373560
     tacaaatgaa gccaagtcgg ctgttcttgc aactaaccag gacaacgaga ttgctgataa    373620
     acttttagtt cttttaaaga ataaaacgtt atatcttcca gccctaactt tgttgccttc    373680
     cattactaag aatgacagca ataaacgttt aaggaattat gttagctttg ttaatgctat    373740
     tgataagtta gaaggcaaaa agctaaatgc atatgtcttt gattacgtac ttcgtcatat    373800
     tgatgaagaa gaattgaaaa tgtacaaagc tattttaacg aatgctgact tagtaccagt    373860
     tgttaaagaa ccagtggatg agactgtgtt agaagaaaaa attcaagaag aagtgactca    373920
     agtagaaaag attcaagaag acgttgagtc agaataattc tatatttatg aaaaaacaag    373980
     cggataagag ttcggcttgt tttttttatc ttgactttct tctaaaaaag gttatgttac    374040
     aaacgctcct gtgagagaag aaaaaggtga gactaaaatg aataatcaaa tgattgtcct    374100
     tgcttaaagg gttatggatg aaattggaga ttaaaaagat cctcacagaa aaaacaacta    374160
     tgactctaat tatgaaaaat aagttattaa tgaaattggg attcagcaaa aggagtaggg    374220
     ttcaagtgag caggtgagca tttcttaaat ccgaatggga ggcatttttc tctttaaaag    374280
     tgtgatatag tctcaacttg tgtagtgaaa tgtggctaca cgtaatggcg tgggttagat    374340
     gtagtgaatc tacctcaaga tactggaatc cgtaaagatt ctatatgaag tgaaatttgt    374400
     aatgttttgc tacaaagaag tatcttgcta cgtggccaac aatcaacagg ttattagctg    374460
     cgacctgaca tccaaaataa acaatcagtt tatgagtttc atattattaa aaataatttg    374520
     agtagtttta gagagagact tttcttcgaa ttcatacctg aaatggcata tttaagggaa    374580
     gtttctgaag caggagataa gtactatgct caaatggtaa atggagagag aggaagaaat    374640
     gaaatatgaa gaaatttatt gagacattaa aaaaagaaat aaaagaaatt cttgactgct    374700
     gcaagaaacc tttatggaaa ttaagatatt tcttttacgg atgggcattg gggggagcta    374760
     taggtacaac ttatttttac aaaattggtg agatagacga atatggagtg cttcttcgta    374820
     tcaccgcagc cataattttg tttattctcc cattggctta tggagagaaa aatgaggtag    374880
     gatctggttg aatctattgt ttaatgtaaa tcctgatatc aagacaatgg attcatttat    374940
     gtaacaaaag atgacttgtg aggcaggcaa agaagtactg tagaggaact ataacaagat    375000
     aaaaaaattt ccaggccatc tttatataca tgcattggga ttgaaaagat tccaagaaag    375060
     aaaaacggca tctttgttaa gaaacaagga gtaattctat accgcggtgg tgcatatgca    375120
     cattacttgg aaggtttttg aatttttaaa tgagtgttta atgggtgact taaaaaagga    375180
     aataaagaga atatatgatg aagaaaaata tcatcactgt aatttgtata ggtttagttg    375240
     ctgatggaaa agggaagaga acccttctta ctgggataat attgtcgacg ttatccagtc    375300
     gagagctcgt ggtttagaag attgagtgtt atatagcaat agcttatata taatgtagcg    375360
     ttcatcatat gatttgaatc ctcatatgtg cttattatgt tatttactcc tttttacttc    375420
     tctctctctt cttgggggcc tctaattaga ggtccctatt tttttgctaa aattggaaag    375480
     gtggtttgca atatgatagt aggcgatatt attgtcgtaa gtggaaagtc tcttatctca    375540
     aagataattc aaaaggtggc aggttctaag tggacacatg tagctttgta tattggtgga    375600
     ggatatatca tagagataga ttggaatact aaatcctcta tagtaaggga aaaatattct    375660
     attagtaatt tagaatgtat ggtgttaaga aataagaatg cgttaacgaa agaacaacaa    375720
     gatattatta tctctacagc ggtttcatat cagagaaagg gttttcgata tgattggctc    375780
     cgattaattt ctctatattt aaagtcgaaa tttccaaata acaaactaat agataaacta    375840
     gatagaagga ataaatttat ttgtacagaa ctggtggatg agattttaaa agaagcaggt    375900
     attgatctgt ttccaaacca aggtggggat attttccctc atgactacct cgcttgtgaa    375960
     caattaatag cgttgaataa agttaaatgg tcgagttata aaaaggctaa ctgaatcttt    376020
     ttactcaagt agttgacttg taagttgcta attttttatg ttttattctt gcttttggtg    376080
     ttactttctt aatgttaact acaagaagac catcaatttc aaggtactcc tatttatact    376140
     tttatcttgt aatgaagtag ttgggagata aaatactttc ctattgaacc ttctaaaaaa    376200
     aatggttatc tttagtaact attataatta tagggggatt tcaatgaagt ttaaaatcca    376260
     atcagatgta attgatattc aatcagtggc acctatacaa gtaattgatt ggggtgttaa    376320
     tttgattcaa gctcctcaaa tgtggtcaat tacaaaagga gaggggatta gggttgctat    376380
     attagataca ggtattgatg ctacccatcc ggatcttgct gccaattaca aaaaaggaat    376440
     gaattttact acaaataatt ttactgacat aatggatagg aaggggcacg gcacgcactg    376500
     tgcaggtata attgctgggt gtgacaactc aattggtatc gttggggttg ctcctaaagc    376560
     tgagctttac attgccaagg tattagcaga cgatggttct ggttcagttg aggcaattgt    376620
     aaagggaatt aattgggcta tttctgaaca agtagatatc atttctatga gtctaggttc    376680
     ttcgaatgat cctggtcctg tcctacaaaa tgcaattaaa cgtgcccatg agacaggtat    376740
     tattattgtt gctgctactg gtaatgaaaa tactcatgtt gggtggccag catcatatga    376800
     tgaggtaatt gcagtgggag cgattaatag aaatcttgat agagccacct tctctaattt    376860
     cggcagtgaa acagatgtag ctgctccagg tgtagatatt tatagtacat atcctgtcaa    376920
     tcgctatgca aaactatctg gtacgtctat ggctacacca atggtagcgg gggtaatcgc    376980
     ccttattcta gcttactatc gtgatattgg caaaaagtta actcctgatc aaatcatgca    377040
     actaattcgt gagcattcgg ttgatcttgg agaaaaaggt gtcgatgata tgtttggtaa    377100
     tggactagta aatgtttgtg aattaatgaa aattagttga aaagaggggg ctccggctcc    377160
     tttttttatt tttaaaattt atttctagat tttttatgaa ccgttttatg ttatctcaaa    377220
     attaccatat atcataagag atatagttct agtgtaaaaa taaaaaagaa aaaattgtat    377280
     atatttctaa cggaatctca ccttatggta gaagtctaaa taattgattg ctgcattctt    377340
     ggtagttttg gatagactga tctcgtaaat taagctgttc tttttttatc atatgtgcgg    377400
     tttctactct ggaaaaaatg gatacagctg tgtaaaaata tttgaatcct aacatagacg    377460
     gaattacttc tttataaagg gattatcgtg ttctacgatg tgttatggat ttgaaatatg    377520
     aaaaggctgc aaagctttcc tgaaaaagcg ctttgcagct ttttaattcg ttgtgttatt    377580
     taggaaaaaa ttaattgtat ttcctttcga attaaaaata tcaaacaaat atatctatta    377640
     aactttcact ttgatatatg tttttttcat tctccaagag tcatttgttt gaagtgacga    377700
     cggatatgtt tatccaattc aggttcatgc tgacaatctt aatgttacct atataattca    377760
     tatttatata ggaccggatc catgaaacca agtcgctcaa gttttctata agatgccgta    377820
     gccttttcat aggaggtgta gcgatgagat atatatttta atgtcatcca tgtatcagag    377880
     tgatagaatt gcagtcctat ataataggaa ctatcatcca ctttgataac ggatactctc    377940
     gttggatagt ttttcatgta atcatctttc tatgtgtttg tatgacaatt tgttattttt    378000
     catagtgaca gtaatgaatt cgttcatgat aatctccttc tatttaatag acgacttaac    378060
     ctaaccctct gactggaaaa tttatagact tgtaatatgg ttgagaatgt gatattgaca    378120
     tgggaattgg tagttatata ttaaaaaaaa gagagtggtt attctttaaa tcttaatttt    378180
     gtttcacacc agacgttagc ttagtcaaca tctgtttaat tgttttgata tcttccttaa    378240
     aagttctact cgagagttat cctctaatgg gatttctgct ttgtataatt aagttgaaaa    378300
     taaaaagaac gcaatctgtt gaggatgcat tctttgttgt ggattcatag tcgtgaactt    378360
     gttcagtgca aatcccgtat atcattttgt aattcaaaaa gtacaaaaga ttcgtctgtg    378420
     taccaagtta agtataggag attcggtgat gaagctaaca gtatttgatt gagaaaatat    378480
     gacaaattgg ttaggttatg cctgaagtca tgaaaggagg gcgaggacat ggaaggactt    378540
     aggtacgaac gatttgaaca aaacttactt gatcattggg tgaaacttaa ggagtcagca    378600
     aaggtgggac taaagactac tgttgtttgt cttcaaatga acaatggatt tgaagtagtt    378660
     ggacaatcag cttgtatgaa tccagatgag tacgactatg aactaggtgt ctattacgct    378720
     acaaaagacg cgcttaaaag aatcgctgat attgtagctt acattgaaca tgaaggtacc    378780
     ttttaggtgt taagtcaaac gagaagcgcg tgatggataa tctatgctct taagtgtttt    378840
     aaccttttca aaatgaacca tacttaaaaa ccttgaaata acatttattt aagtaactca    378900
     cctacatgag gaatcaaaat gaatttcgga aagtattaat tttagctttg gcaaaaaact    378960
     ttaagaatag tgttaatcgt gtcgtaggca aatttccttg atgaggagaa tccattatag    379020
     cagacgttag atcattcgct ggttagtaat gcttagtcaa atcattttta tcatatacag    379080
     aaagtaggta ctatctatgg ctactaaaga gcgtgaaatt gaaacttacg atacatctag    379140
     ttttctacaa aagaacaggt caaaggttgc aatgggtgca gttggtggtt ttgcctatgg    379200
     agcgaaacac ttaatacaaa ctcaacctgt gcaaggttta gtaaaaagtg aaatttttga    379260
     tgaggaaaaa ggaattttca agaaagctaa aaagggaagt agaatgcaat tttctggaaa    379320
     gaagcttgga actgctatcg gcaagggaca ttatgctgtt actgctactg ttttagatgt    379380
     aggacgccga attgaaggat atgatgatac agaagagatt aaaggagaac aagaatttca    379440
     acttaggaaa aaaatgaaga agcaaagaga gaagaataga aatttatatg ggaacataaa    379500
     tcaaggagaa gtcgtattta atctttttga atccagaaca ggtcatcata agatggggaa    379560
     tgctaaattt aattagagtg gagcagtgta tgatttcaat tgcagataac ttgttaagaa    379620
     gcatgaaaaa tactaataaa ctccttaaaa aaagtaattg atgtagagaa gtttattcgt    379680
     tctaaaacaa attgttcaag tatgtctact attggatatg cgggtcccaa taattgagca    379740
     tcaaatataa tggtgactca gaagttaaaa gtaggtataa aaaatcttga aatttatcca    379800
     tctagaagca agagtaaata atccaacaaa ttcaccagtt aaaaattttt agagaagaaa    379860
     aattagaaag cacttctttg gtagaggcta ttaaacgggc tgatatagat actcttcaag    379920
     cagtaggtaa agtgataagt agcgattagt acaaacgggt gctatacgta gttctttagt    379980
     tagtggttgt ttgaaactaa tgattaaatg cgtatacata cgcaaatggg ggattcgaaa    380040
     gacatggatc ctactactaa gcaaatatgt agaatttata caaaagcaag aaagatcact    380100
     atggggtgac ctatctagcg aattaaaaca agtattacct caaaaacaaa tgtctcaagt    380160
     aacagaagga attttttaat ctaataaata ggaggataaa aaatggctat tttaaattca    380220
     attaaaaatt ttgctaaaat aggtgttcta aatacaaaaa aggccgtaaa tggtgttaaa    380280
     aatgctccaa ataatattat taagagcact tttattgata caaaaaataa gaaaaagaca    380340
     ttggctaatc tttacactgg taaaagaata aatccaaaac actttgctgt tgttggaggg    380400
     ggatatcttg cttttaatca agctaagatg agttttgaat atcaaatgga acctcttaaa    380460
     cgagcgacca tgaatgacta tcagtatatt ggatcgccag aaattatgat gtacgacggt    380520
     gtagggcaag aaagagtttc taaaaattta aatgttgatg gaagtattgt atttgatctt    380580
     cacaataata gaagggggta acctagatga aagtaaagtc aatgattaag acattaacct    380640
     cacctcaagc tatatttgga tataatgttg caagaggctt acatgggggt gacagcttag    380700
     gtacatcggt ggctaaagca tctattaaag gggttttaag tgcttctaac cctgttttgt    380760
     ttggggtggt aacctgggga agcttagcgc aaaaaggtta ctggggttta ttagaattca    380820
     atcaccaaag ggagcaatgg tggaaagcgc agtatgcaac aagtaacgta gttgggggta    380880
     actttttaga tacgcgaggg gctcaaacaa tgagacaagc agctgtacag gctatacagg    380940
     gaagtaagat gaatgcaaga agtgcacttg gtggagaagc taaaatatta agcccttact    381000
     aagttactac acatctagaa ggtattagag aagaggattg gaaatatgag tgaaattatt    381060
     aatcttgaac gtgaaatgct ccaaattatt cacgatcctg ttcaaagggg agaacatcac    381120
     ctagggggga gcccaagttg gtatcaagag caaattattc gacagtcaca tcatcgcgaa    381180
     ggtttacgtt atggtgagcg tgtcggcaaa tgtatagaag aaaaccaacg aattataaat    381240
     tctaacacgg gagaatataa atcgatagga gagctttatc agtcccaact agatggtatc    381300
     gctacaccat tattaacatt gaatgagttc tatcaattaa agaatagtaa agctttttcc    381360
     attgaagata acggtgttca agatacgttt gctgttgtaa caaaacatgg agcacgagtt    381420
     acccttacaa gaaatcatcc aatactaaca gtcgatggat ggaaagaagt agatgcactc    381480
     tgtatcggag aaagaattgc tacacctaag ttcttaactg tgtatggcac aaaacaagta    381540
     gaaaagaata aacttcgaat tcttgcatat atgctcgctg cggggcgttt aaataagaat    381600
     agcattagct tccaaatacg ttatgaaggt gttggtgagt cgttgcaaaa atcttgtgag    381660
     gcaattggta ttacaacgta tcatgagcat cataagaagg cgacagtcta tctaatggac    381720
     tttagaagtt ttgagtttta tagggagata gaagaaaaaa aaatcccttc atttatttac    381780
     gagttggata gagatcactt agcgttcttc ttaggaagtc tgtattcggc aggtggttgg    381840
     ttttgcgccg gacgtattag tgaaattggg tatgctacta agtgtcgaaa atttgcatta    381900
     gatctaaaac acttactatt acgttttggt atccaaacga atttacttca aaaagaaatg    381960
     aacggttctg tttattacca tcttatggtt tatcactgtt cctctatttt attattcctc    382020
     gaacatttag ctacaccaga gcgtaattat gaagcagtcc aacaaagagc actgaaaatg    382080
     aaaccttctg aaccaacact ccctaaagaa gtatggaaat acattgaaaa ggaacgaatt    382140
     gttaaaggaa tgacgaaagc tgaagtggta ggaaagggta atcgtcgcta tcgtacagaa    382200
     aaaggtatct ctttaagtaa tgctcgtgaa tatgcagaga atttacaatt tgcaatgtta    382260
     cattacttaa ttgattctca tgtaatatgg gaagaagtag tagaaatcat tccttatggt    382320
     aagagacaga cttatgatgt cttcgttcca gagactcata acctagtagt tgaagatatt    382380
     cttgtattta gtccatgtac aaatgtttag catagataga aatttagttt acaaatgaag    382440
     aaaaagagta agtgttgcta ctacgatttc taacatcttt acgatatata acacctttgt    382500
     aatgcccctt caggtaatca ttcctgctgg taacgtggtg aacgtaggga aactctaatt    382560
     tttttaaaag gaaataatcc cctgatctga ggctatattg agtacgttcc taatataaat    382620
     aacaaggtgc aacgactatt ccattggatg tgaaatgcgt caacaggagt tgagtccata    382680
     cgggtggttg aagcaccttg attcagagca ttacgatctt cttctatacc taggagggag    382740
     gatgatagag tcaccatcat gtaagagtat gaacagttca tgaggaaata ataaaatagt    382800
     agcgtgtatt atgaaaatag cagaagtaga ctatatgagt gataaaaatt ttgaatctat    382860
     attcatcatt atcaaagaag catctataat cctatttact ccaatatgcc gaagagggac    382920
     attcctcaaa acatagactc ctcaaaacat agactcaaat gaaaatgcat aaagacgtaa    382980
     aaatgaataa aaaacgttta ggatatgagg acatactacc ttactggggt tgcttatgaa    383040
     catgaggtac ttgctgaaat ttaagtattt aataaaaata tattgacgga gcagcaagca    383100
     ttggttacaa ctacactaca ttactaactc ataatagtcc atttgctata gatattgaat    383160
     ggataaaaat tgagcagtta cataagttgt tgttactcaa tactatcttt acgattttca    383220
     tcatacaaga ctagagtttt ggaaaataga tatattattt ggggaatttc aacttattag    383280
     ccgtgttaaa atttctaaag cggagtttac atcaggtaat tcagctaagg agattattga    383340
     gcaggtaagc ccacatttac ttgcttagac gaacatgttt taaatggatt attgttcgga    383400
     ttattagtgt tcattaataa ataacctaaa tgaactataa tttttattaa tatatcaaac    383460
     actatgaaaa taacgaaggt aaagaaaata tctatcaatt cgtgtaaaca gcaggaacgt    383520
     tcagttagtt ctaatgattt agaacaaata gagaaagaaa acccacccaa atttaaaaaa    383580
     gaacttgcaa agtttggggt tgaggtattt gtggttccga tatgaacatg ccttcccgcg    383640
     gagggtagta ataaaggcga caggtatccg cattgggcct gttgcttttt ttataagaag    383700
     gaggacaaca atatggatga attattagga aaaaaagttg aactggatac cgaattagag    383760
     cgttccatta ttgaatacag accacgcgta aagtatgaac caaataaacc ttttactgtt    383820
     aatttaccaa cagaagaaat cataggggaa gatcaaaagg aattcgatga agatggttcg    383880
     tttattccgg aagaaaagcc agctaaacaa tatgataaat ttgtaggtac actagagctt    383940
     attaatgaac ttattgaata tattgagaaa aaaatgaaag gcttacaagt tcctatttct    384000
     atagaagaac ttgagaagtt atatgagtca caaccatttt ttgaacaaga tataggggac    384060
     gaaggtttca ttgactttga aacatatcag aaaacttttg aaaatccaga agcacctgca    384120
     aactcactta ttcaagatat tgttcattcg tacgcagaag atgtggaggg tagcttagag    384180
     ttagaatttt atgaagatct aaaagagttg cattccatag tagaggaagg atatttctta    384240
     tttaaagaaa ctgttttaaa gaattatctt gatggaaata ttcctaagac accagaaaac    384300
     aataacggtt ttactgagca aattgaaaaa gcagtcaaga agcaaaaaca atggtttgat    384360
     caagttacaa acctctatag gaataatgag agtaaatatt atgatgccct aagaacacag    384420
     tacggttcac ctgaattctt caagataagt gatgaatata caaaaacaaa gcgcccttat    384480
     gacgttgtgg ttcgtaaaga aaagacactt aatgaggtga gttctcttat agatggtctt    384540
     cttataggtt cacaagattg ttctgaatct attaaatttg gattagctat aggtagcgag    384600
     attgatggtg aaggggttat gaatttatta gaaaatcagg cttctacaaa agaacaactt    384660
     accggtttgc tcaaattaac tcagctatca ttgaagttac aacttaatca acaaattgaa    384720
     gataagaaac aatatcgaga cgtgttaaaa aacattaaca atctttctcg taaaaagcgt    384780
     gcgcatgatg aattattaat ggcattggaa cttcgaaata cgatgtacct aaacatgtac    384840
     gattcattgc aacatttgga atctccaagc aaggcacctg gtgtggaatc attcctaaat    384900
     caaatggccg ggggattaag tcttgtacaa gaacagtatg actcatttct acaagatgta    384960
     tatgcaatgt atatgtctga atacgaagta agaaaagaaa aaatcgataa aacattaaac    385020
     aaggaaaatg caagagcagg ttattctttg gtatcagagt acctataaaa gaggtttact    385080
     tcatcctaat ccatataagg gtagatgaga aaacgctggc caacttatag gaggctctat    385140
     tccttttgaa tatggtgaca ttagacaaag aaaataaagt gacctaagag gtgaatccag    385200
     attgttcagt ttatctcgag atgaattatt ttttcatcgc tgaaaaacat actattggga    385260
     tgtactaaaa gtaggtagaa ggtgtttttc aacaaaactt aataactggt aaaaaaatta    385320
     aatgtagaag cagattggga taaatttgga caaccttctt atgaaaatga aggtacatgg    385380
     aaataacaaa tgtggatcat actcaagatc taggaaagta ataaactatc tacaaaatct    385440
     actatactaa ggtagaatct gtaagaagta agatgcgtgc tatccgcata tcagaaatac    385500
     aagattttaa acaatacaat attttaatgg aggggtaaga atgtatacgt acaatcaact    385560
     tattttccct tctcatatgg aaaagaatac tcgttttcta gtattagcgg gcttttcttt    385620
     aaatgggcca gtagggacac cttttatcat tcgagataac atagagccat cttatattct    385680
     tggtgattgt cgcctgacgg aaaacgtaag tatggcaaaa aaatacggaa tcaccccact    385740
     aatccttcgg ttaaatgggt ctcatggaga atgcgttgtt aatcatgatg aacttaatac    385800
     tccagctttc cgatttaaaa cattagaagc aacagatgag tcaaataaca tagctattca    385860
     cttatttcca acgtatatga ttattaaagg cataaacact agttattcat acctgttcgc    385920
     tgattacaag ggagtagatg acctagcttt tgctatcaaa caagatcttt attttgggtc    385980
     gggagaagta gatgtagaag ttatcaatca aattccaata aaaggattat gtacttctga    386040
     gaaacacgtt agatttactg gggcggatga tggcttccat tatgtaagta atcatagcaa    386100
     tccagactca gaagataaga ttcaaatgca attacagcta ttaaaagata gttttattac    386160
     tgaagatgga agtgaggttt tctttacagg agaattaagt agttttcaag tagatacact    386220
     cctatttaca gatatacctt acgagaaagc acctggacag ctatcctcta tatttgggga    386280
     atttgccaag actaagacaa ctgaacaatc tattttctgc tcagttgttt tatgctctga    386340
     tttattctct aaaagtcgtt atacggtaac aggagaagat acatacgaga ctcaagtaca    386400
     attacttgta gaaaaagcct ctattaatac agaagaacat cgtcatttag agcacataga    386460
     agttgtagtt ggtatacaaa actctgagaa ccctaaatat tcctttatgc cagttgcagc    386520
     aaattatgct tgtatgcgat ataaactgcc gaatttccat aattcagcta caaataaaca    386580
     actactaaac ataaatacat tacaaaatag agaactcaaa aaggtggaag ttgctaaatt    386640
     aacaagtagt ggttatatat gtatagtacc atcaattaaa aaaggatttg ttccttattc    386700
     ctcaagaaat ctttaccttc aaaacaaatt ttattcaaaa cctcattatc tccggagtat    386760
     aggttacgat gttaatcgaa ttgctggatt ctttaatcaa tacattgggg aaccattaag    386820
     cttcgtatta cttcaatcta tcatcacaca agttgatgcc ttcattgata gtcttgcaga    386880
     agatcatcca atctacagag atataaaaat ggaagtctta cattatgatc aagaaaatct    386940
     tactctatct atttcatttg agttatatgg ggagattgaa acggttagaa cttcctttac    387000
     ttatatttcg tcaagtgagg tgagtgtttc atggcagtag aaatcaataa gccaacccaa    387060
     gcaaatggtt ctatggacta tgaagacatg acaaagacaa ttaagcattt actagatgct    387120
     gcttggggaa ctcagtgggg aagctttact ccggaagaac caactgtgac agttgacaag    387180
     cctgtagaat atccagttat catacattac cttaagttaa tgcaaccagg actaattggt    387240
     aaaagcatca gagaaattaa acctcgtcaa cgttaccttg cttttaatga agatcctaaa    387300
     ggaactctac cacctgcaac taaggtttat ggtcaggtat ttgatgcaga aattgttttt    387360
     gagatttggg aagaaaccaa tgcgcgagta gacaagctca caaaggagtt tcgtcaaacg    387420
     cttgcaacat tcacgggatt ccttaaagag aaggggctta aagaacttca attcgtaaag    387480
     atggaaacag acttatcaaa aacaaatata agtaatgcta gtaaggttcg tagacttgtt    387540
     tattttgcta agtttgaaga attaacagaa gttcctgtag atatccttcg tgtgatagat    387600
     gttgtagaac agaaacttca ggaaaccaca aaaacgttaa gaaacaaaaa aatccaactg    387660
     gatgaatagc gcttgtcgct tttcaaatat aacaaaataa agaggaggca aacctatgct    387720
     ttatgaaaat cttcctggca ttaatgtcac attaaaagat ggtggcttaa ttgtcccaga    387780
     acgaggcgga tcagaatcga tcctaatcat tgcgccatct cttgcgaaag atgctcctga    387840
     agaaccagta ttaattcgta gttcaactga acttgtacaa gctggattcg gtgacttcta    387900
     tgttgcagga gaagttaacc caattgctgc agaatggaaa gctgctactg atgcaggagc    387960
     tagaatggtt tacctagtag cccttaaaga aatcagctta gagcgtgctg ctgaacttga    388020
     gaaaaatgca attgatgctt atgtggctgc aggaaaccaa ctagtagatg cccaagctaa    388080
     attcaaagac gttttagttg gctctacaga agctgttcgt atgcgtcgaa aatttatcta    388140
     tttctacgac atgctaatga gcgaccttct tgatttcact gtggatcacg tagttcttaa    388200
     aggggttaca cttgaggacg aagctactaa cttagttggt gagtttttca ctgaagttcc    388260
     aaactctgaa gatttccctt acattagtgg aatggttact tcttcttatg taatcgagtc    388320
     tcactctatt aattacccag tagaaatcaa aactggtaca agcgatacgc tagtagtaaa    388380
     ggttgatggc aaagatgtaa cgtttacgct tcctgctaaa acttacaatg gtagttcatt    388440
     aacaatagct gacctagtaa aagacttgaa ggctgttatc gatgcagatg caactggtat    388500
     caaagttaat gtgagagaag acagtggtaa aatcgtcctt tacttcgatg ctcctgcttc    388560
     tatccaagct ggtacaacag ctgctggtct tcaattagat aagcaagtag caacatggaa    388620
     gaaaacaagc tttggtgtaa ttcaccgcgg ttcattcgct caaacagttg ctgattattg    388680
     ttcaatgaag actttaatga aatcagccgc gatcggatac attggggtta aatctccagt    388740
     agatacgaaa gtttctacaa tccgcaaata tgtggacgaa ctatctaaga ttgatacaga    388800
     aatctctcct tatcttcaag tagtggggtc tgaagtggga gtaatcatgc caacaacaaa    388860
     ctcaatccac tatgtaaatg gtgcgactca ctacgctgca ctactttcga ctcttcgaaa    388920
     agaaagtgca cctacaaata aaccgataaa aggtgttaaa gctatccgct ttgattactc    388980
     tcttcgccaa ctttctaaac tgactagcaa gaaaatcgtt acattccgtt tgaaagattc    389040
     aactcaacta gttgttacag acggaatcac aactgctcca tctattgtaa tggccggaaa    389100
     agtacgtgaa agtgactttg ctcgtttatc tacgcttcgt atcacccagc ttgctatcca    389160
     agttgttcgt gaagcagtag aaccatttat tggtgaagcg aacgaaatgc cacaatataa    389220
     cgcaatgaac actgcgatca agtctgcatt agagaaaata cgcgaagcag gcgcgattca    389280
     aggatataaa ttctcaattg aaaaccttgg agtatactta gatgaggtaa ctgtaacttt    389340
     agaaatcatc ccggcatttg aattacgtcg tgtacaagtt caagttaact taactcctcc    389400
     tgagtatatg ctacaaggcc ttagcaagta agaactatta atgagaagag gggatcaaag    389460
     cccctctctt atataaaaga ataacaggag gttattaacc tatgagtaca acagcttctc    389520
     gatatagtaa aactttcact acttacggtg gctctgacat cgtatgtaca tttaatggac    389580
     aggtagttgg ccaattacaa gctattactt actcagttac tcgtgaaaaa ggacctgtgt    389640
     atgtaatggg tgatccaaac ccaaaatctt tctctcgtgg ttgagatgta gccacctttc    389700
     tatggtgaca tagaatgaca aactccgtga actgctggaa acccctaaag cttttgttac    389760
     tacaacgtaa ctagaaatgg taagcgtgaa tgttgaaaaa acaaatgata attataataa    389820
     tgttatgaat ttatagattt atggcatatg aaataatggg caatcagcag ccaagctcct    389880
     gttccgaaag gatggagaag gttcaacgac tagagtgtac tacctgaaat ggtaatgaga    389940
     cttattagtg cggagcaagt tgaaagccca tataaaatgg cgatgcttta atgggcgaat    390000
     tcacaccaaa atataactac aaaagtaact ttattaaaaa cattgattca ccagaatatt    390060
     ggtatattgc aagaatgtta gcctcagatg taagagacat cctttgtccg gataaaacga    390120
     ttgaaataaa aaagaactcc caagcaaaat tttaaatttt cataacacca tgatggctca    390180
     gcattttaaa aattgttttt aaaaaggaaa aaagaaaaat atttagaggt gtgttattaa    390240
     cttgaagata tagtctagtc cgtctgtaaa acagagttaa agtatctcga aagagacggt    390300
     gtaaacgaaa cgtggtatcg caggaagttt agtatttact atcttcgacc gtgatgcact    390360
     atttaatctt aagcaacaag ctgctgttca ccgtcatggc ctaaaccaaa cggatgcact    390420
     tgctagtacc tctactcaag tgttagatac tgatgcaaat gctgcagcat taactcagcg    390480
     taatgactta gtacagggat ggcagacaaa acgtaaggcc aacttcatcg atgaaatccc    390540
     tccatttgat attactatca acttccttaa cgaatatgga caagctagta aaatggaaat    390600
     ctacggtgta gagattctta acgaaggaat gggcttaagt gtagatgaca acactacaga    390660
     aaaagcttgt actttcattg ctcgtaatat tgttgagatg cgcccacaag atgattggga    390720
     agtagaataa taaaacttaa agaggtgctt cggcatctct ttttgtattt ggtagcaaaa    390780
     atattatcga gtggttatgt tctgtttata gaaaaataga aaggcaggtg tcttcatgag    390840
     tagtagatat cagaagactt atacgagttt tgctggtaca gatattgttg ctgttgtaac    390900
     tcctgaaggt ggtaaatctg tagtgctagg tcaattacaa acaatctctt attctgtgta    390960
     tagaccaaca gctccagtat ttgctttagg acaaattgca gctaaaggtg tagtccgtgg    391020
     tgcaagaact gtagcaggaa gcttaatttt cacagtgttt gaccgccatg tattatacga    391080
     aattatgaaa gatcataatg cgaatggaaa cagttgtcct attaataaaa gtgacgagct    391140
     gccaccattt gatataacaa ttaattttat gaatgaatat gggcaatctt caaaattggc    391200
     gatatatgga attaatctta tctcagaagg tcaaacaatg tcagttgaag acatgattac    391260
     agaaaacaca atggaattca ttgcactaga tatcgaaaca atgaaaccag atgtttttga    391320
     tgaagggtgg taagagatat gagtgatggg gcttatacac cagcaggtaa acctaaaagg    391380
     ggttatgcga attattactc aggaacagat atccgaatct acttcggaga taactggata    391440
     gatgaaattg tagaaataga atggacaatg caagaacaat tagcgccaat ctatggatat    391500
     gcttcttata cctgggataa ggtagctaga ggaaataggt tggttcaggg ttccttttct    391560
     attaacttca aagaagctgg ttatttacaa actgtactta atagtttaag ttctgaaatg    391620
     aaagatgaaa atgagtggtt tagcctagca gaatttaatg gtgaaaatgg tcagagtgct    391680
     cataagaata caaaggttga agaccttata ggtaattttc aagcattagc agatgattac    391740
     gaaaatgcac tgtggggaac aaactctaac tcttcaaagt taatagatag ccgtaaaact    391800
     gacacattct tttatagcac aaatgaaaat gaaaaaaata agaatttgaa agaacatggt    391860
     ttcaatatct tactaactta cggaaataac ccctgtgccg ttagaggagc aggaagctac    391920
     aagaccgttc aaacaatagt tggggtacaa ctaacaggtg tttcacaaag agttgatccg    391980
     tccgggaatc ctatttctga agtatatact tttatagcaa aagatatctc agggaatgta    392040
     caaaaagcgt actagcttaa ttataaggtt tatataacta aattattgta acctttaaat    392100
     ttttataata gtgagagaaa gaggaggaag cataatggca aaacgttttg aaaaagaaga    392160
     agcttttacg gagaatgctc aagaagaaac ttcggttgtt aaagtaggag acaaatttga    392220
     tgaagatgac gtttcaaaag cggaacaaga aatctttcca ggtggtccaa cttataacga    392280
     acttgaaaaa tggaagtcaa tgtatgcagg agaagtatac ttgactgaat tcgatgaaga    392340
     aaacattttt gtatggcgac caattaagcg taaagaatac aaagatattg ctaaaattcc    392400
     aaatgcagat aatttctata aagaagagcg tatttgtgaa aaagcagttc tgttccctgc    392460
     taactatgga tttatgcaaa tgacaaatgg taaagctggt atcccgacac tattacacga    392520
     attggtatta gagaaatcag ggtttgcagc gaaaacaggc gcaatgcgct taagctaaga    392580
     gctaaggagg cgtattatcg cctcctattt ttattgtagg gaggaaacaa catgctaatc    392640
     gatcctaatt tattagatga caaggtaaaa gaattaccta ttgaatttga aacatatgaa    392700
     gaagaggtag attttaagga acaattgcgt atttggcatg agaaacatgg acatatcttc    392760
     atgcaagaaa taagcgatgt actatttttc ttccgtgcat taagtaaaga agaattgaaa    392820
     attgcacagg aagtatacaa tgacgactat gaaagaactg agtatatatg taaaacttgc    392880
     gttatagagc caattattga agactactcg ttagatattt ttgcaggtgt tccggaaatt    392940
     ctttgccttt ctatcttaga ggagtcaggt tatacaaagg ctcaaaaagt taaaatcatg    393000
     atagctagat gggaaaaata tatggaagaa acagaaaatc aacttccatt aataataaaa    393060
     gaagcatttc aagatattcc attaagcgaa attgaatcat ggacaatggc taaaacagca    393120
     gagtattatg tcaaagctaa atggttatta gaaaatatac ggggattaaa attattaagt    393180
     gaagaagaag ttcaacaata gcaaccgtaa ggtggtgaag acgtatggcc gataaacgtt    393240
     atatgggtga agagaaagag aaaaatcatt tgcttagtaa tatagcaaaa acaggttctc    393300
     ttaaaggtgg aggggtaatg gcatatcgta atttttcaat gataggtaaa tctgatgctc    393360
     ttggtgaaac tgcttatgtt agtagaaaat tacgcggtgg ttttgatggt aatatacagg    393420
     aaaagatgta taaaaaatta gaaaattatg tccgtagaaa tattaaaaaa aagcagatgc    393480
     ttaagaatca tctagctcaa aacaatatcg aattcgttaa ccgttattat aaagaattcc    393540
     acaaaagaaa tatgtggggt tttaacaagt ttgaatacgc agctactcaa tcattccgtc    393600
     aaaataaaat ccttgaaaac cttctaaaac tatcttctat taaaaataat ggtggggaca    393660
     agattctcaa cgcccttatc caataccaca atcagaataa aggtattttc aatagtcctg    393720
     ccgattacat taatgacttt ataaagcaac tcgaaaatgg aaaatacgct cctaaagtta    393780
     aattcctaga cgatacgcaa cgaaatgtat ttcagaagca aatgcttcaa actcttgagt    393840
     ggtaccagga tattaaaaaa gtatttgaag aaaataaagg tacaatctta tctcaagcta    393900
     aggcaatgga aaccgcgtct acttatgaat ttatccaaga tgcaattaat caaacagacg    393960
     tattaatgac tcgattaaag aaaacaggtt ttaattacac tacattaaaa gatgctgaaa    394020
     aattagatac agctaccaag cgtaagtatg ggttaatcat tgatgacatt gatgaaaaag    394080
     gaaatgagaa atctattgat gttactgggg agttacgaaa attcttagat aacaataaac    394140
     acaatgacga tttaaatgca ttgttaggta aaaagggaat atctttcgtc tttgaaaata    394200
     tgattcttga tagtaattta tacactcatg ctaaaacagg tgaaataatt gataacagac    394260
     atttaaaagc tggtgctgtt agagcaatag attcttttca gaaaagtatt aaagtcccat    394320
     tctttattaa tagcccaatg gatttaaaat cttggcaagc tttttattct agtctatcta    394380
     aagaagaatt acaggtagta gcttcagagc aattccatag attcgtaagc aacttagatg    394440
     aaaaagggtt tgatagtgta actaaaacga atcaaggagg atatattcgt aatccattaa    394500
     ataatagtga ccatttttat actggtggaa atgtttttcc ttatacagaa tctggcgtgc    394560
     gagatttaat taatgaagga tcgtatctag cgtcatcaca attcggtaca ttctcacgta    394620
     tggataagtc ttatgctcgc tctggttata aaaaagagtt aacaggtagg gatgcctcgc    394680
     aactatacga ggatacttct gttaaagaat taggaaaagg aacatggaag tatataaatc    394740
     tctctgaggg gtttatttct ttaagggaag cggcagttga taaaagtcta ccaaccttaa    394800
     tggaatttat gattcctaca tttggtgaag atgtagtacg tatccctgca atcgaaaaac    394860
     ttcgacgttc attccatcaa ttcgctttaa gggtattaga taatgaggca tccttcttta    394920
     cgcaggatgt cgtgaagaag gatgcaagaa acaagagaat tttatctgaa ttagatataa    394980
     agaatatgaa aggtttagat acattaaccg agtttcaggg ttatgataat atccatacta    395040
     ttgatgcaag acctcgtgaa gcaaagatat tacttgaaga tgttatgaat aacgataaag    395100
     gtaaagctga aaaagaaatt gtatcagatt ttaatatcaa caacctgaag aattatggag    395160
     cgattgataa tggatgggat ctagcgatta acacaaaaat gaatgctagc aatgcggcat    395220
     caaccctagt tgagcaagaa ctagctgttt caaaagatag attagtagga agacatactt    395280
     acagagacgc tttagcaaac gtaaaaaatt caactcaaga tattgaagat attggtcgaa    395340
     ttgatgagtt atcagatttt cttaaagagg aattttatac tgcttcaaag ttaggtaata    395400
     tctatggttt cttaacgaaa acaggagttg agtatgaaga ttcctggcgt gggaaaacac    395460
     ttgtatcatc aatattaagg acttatccac gtcatgattt tttagttgcg aaccatggta    395520
     gtgccttacc agggattggt cgtcgttatg tttctcgtgg ccttaacaaa gtttattatt    395580
     caccaatccg aaataagatg tctgattgtt tgactagtat aataggtgaa tcaacagatt    395640
     tattgcttag tgatcaaata cagaagaatg aaataaaact tcttggtaaa gtatatgaaa    395700
     cacttgttaa gcattattcg gacggaatag gttctgatga gtttgtaaac gacggtatgt    395760
     ttaaccgatt ccctatcttg gcagaaacta atcctaatag tggacagtac aaagtagcta    395820
     agcatcaaat tccgttatta cgtcaatctg gtgggtttac agaaaatatg gataaagagt    395880
     ttgatgagat tacaaagctg attcacgata atcaagatac atattattgg tatgacaaga    395940
     agttctcaaa tgccgatatt caagaaaaaa gtggaacagg ctctaagatt attgatgcaa    396000
     atacgttcat ggttcgagag tttgacactc cagttaaatt aactcagaaa gataaccgag    396060
     atgttattta ttggatggag cagtatttta aactcggtga aaaagataaa attggtttta    396120
     ctagagacct tgttgctcga aagaataata atacatacgg ctcaatggat gctgttgtat    396180
     atacgaatag aagtgaagat ggacattttg ggtttaagac taataaaggt caatcattta    396240
     atgctcttat tggtaatcgt atttggaaga atccatttca gattagcgat gatggtagct    396300
     ccacttctac aaaggctttt aatttaaaca acatggtagc tgttgggaaa tattctgaaa    396360
     tgttaacgca tgatattgtt cctaaaatgc ctttcgccgg aatattagac gataagttct    396420
     tacaggaacg tacaacgatt gaaagttata agagagacca agtatacgat tcagattggg    396480
     gaccttggcc ccagccatac gagggttgga ttaatacgat gataaatacg gttgtttctc    396540
     aaaatccaat cattactggt gaggaaatga aagctatcgg tgcaggaaga attctttctc    396600
     gattaggtaa tgttgcggtt cctcaagtgc gtgaaggtga acgagaaatt aatcagcact    396660
     ttgatcgctt aagttacgtt aagtattatg atctttatga gaaatctagt aaacttgctc    396720
     aaagtaaaga aggtgaaagt gtagaagagt tttttgacga tgcagcagga agaggacgaa    396780
     ataacatagg attaaaacgc tacttaacag ataagaagaa aacattgtcc tgggctaaaa    396840
     aaatgggtta tggtgacacc gaagccgtta aatcaaaaat tgacgaattc tccgatggat    396900
     taggagatat ttcgtctaca aaagaagcta atcaagcaag taagtacata cccttagcta    396960
     ttaagtatcg acaaaaatat gaaggtactc tttatagtat gggtgatact gaagactctg    397020
     gtagcacatc gttaatgaga gccttaaaac ctaaagggaa aaaatatgtc cctcaattct    397080
     ttgagacgac tagcagtaaa gaaggtcaag agattcttca gtatgtttct gaggacacaa    397140
     aagaaatttc acaggatagt tgggggctta gagtagataa acaagaagat attgaagatt    397200
     actttaatac tcattatcta ccaactgaaa attggaatgg atggaacgca agtacaaatc    397260
     tcgatgatat aaaaattaag gttatgcaga agaagggggt aaacccaacc acttctggtt    397320
     attggagtaa ggatcaagct agagtggaaa aaacaggaga aaaagagatc caaatacacc    397380
     ctttaagtag tttgatcaat atcggtcgct tgcgtgatgt gttattagga atgggactat    397440
     cagatgtaga tgtccaatta actacttctt atggtgaagg accaggtgga attaatactt    397500
     ccatcgacat catgaaaaat gtgaaaaatg aaattttaga tggttttaat gcaggggtgc    397560
     attcctcatt attctagaat acattaagcg gcgttcagtc tttttagacg agcgccgtta    397620
     tttattagga gggtattatg gaagatatta aaagagtgcc tattaaaaac agggttttaa    397680
     gacccattaa tgaatcagca gacgacttag gtgaaattag aacagaaaat caaactgaac    397740
     atgcagcagc agaatacaga caaagcgtat tagctcaaac atataatgaa ttaacaaaag    397800
     ataatcgtat tagtacatta ggtatttggg agttggctcg tactccgaat aattttaatg    397860
     taaatgctca acaagcatta gaccctttta tgaaattaaa aggtgatgac catgtattat    397920
     tctttgatat agaagcaatc ggaacacctg aacatatgag aagtaataaa gggttagatc    397980
     tatttgctat gactgagtta tcttttagtg gaactaattt taatggaaaa gactttgtta    398040
     ataagaaagg agctattgtt tcaatggcag tcgctcctga aaaagatgtg tatgctcgat    398100
     taaaacagca aattaataaa ttaaagcaga atccgatgat gtcagtttca caagacgtgc    398160
     attgtacatt actggatcta actaagtata ctgatgcaag taaatttaag agtgctacaa    398220
     gtaatgggaa atcctatatg tctctattag ggcattctcg agttccttct atagacactg    398280
     cctttacaag aaatacaata gaagaaattg aacgtggtct aaacaacttg ttttataaag    398340
     gtacaaaact tgaagatgca ttatctatct tccaaggcca cattatgtct agtaatgcaa    398400
     aattaggtgg atacaatatc caccactacg atttaccagc tattcttggg atagtaaagg    398460
     acacaagtac aaaaaaattc tttaacgatg cagcgaaaaa ttcattagac ttttttcatg    398520
     gatactctgc aacagttaaa aatccatatt cattaaccgg tgctagttta cgacaagaac    398580
     atatttatca agctctttta gcaaaaagaa aaattaaagc cggtaaagaa gcaattgacg    398640
     ggaatccccc tttatttcta tatcatttag caaaagatga tattcaagca aatattgata    398700
     ttgccgggtt tactcatcaa aaaattaaat catttattaa aggagcagaa gagtctccta    398760
     cttatgattt ttcttcatca gcaataaaga aaaatactct agaactaggt caggaattat    398820
     tttcttatca aagtagttac ttcgacaaag ataagtacaa atacaatctt gtgggtaaac    398880
     ttggtaaaga cggaaaaagc atagtacctc gatggggaaa tttaaacacg tcactccctt    398940
     caaatgaaaa cttcgtaatt cgagaattcc tcaaagatgt tgcattaaca ggtacagata    399000
     aaaaaggttt tggcttaagg cttgattcta aagatgtaaa gggtaaaatt cttttattaa    399060
     tgtccgaaac gcaggaggga ttagcacagc aaattcatag ttcattcatg ccaatggatg    399120
     atgcaatttc tagaaatcta cgtgacttaa aagtaaaaca tgacgcttcc ttccgtgaat    399180
     atgaacgaat gtttgacaat aatggatggg aaaagatgaa ggaatactat aactacctag    399240
     agaaagcggg tagtgtagaa gaagatttcg actggagatc atacattatc aaaaatggcg    399300
     ggacagaaga attagctatg aaattccctt atatggtcgc acgattagag ggagaaagag    399360
     atgtctgggg aacagctatt agtactctaa aagcctcagg attaagcgac aagcagaagt    399420
     caattgcact gcgacaaatt aaaagcaagc tagatgagaa aggagataat aaagctcaag    399480
     taactgctaa ggggaataga tttttaaatt ttaattttga taaagaatac aatacaatat    399540
     ttaatgcaaa agaaacgaat tcaattaaag attctttccg ttcttatatt aacgatagaa    399600
     gaggggatcg tatcgggaat ctggaaaagt catataagtt agctcgtatt gatgaattgc    399660
     aagaattaat cataaataac ttcaaacttt caccagatag aaaagcctct aatgatgtga    399720
     aatatcttgt gaatcagatg aagaaggaag ttatgtcggg aaataaaact gaaatagctt    399780
     tgaatgaaat gtctaacctc gttcgtgaaa aggtagaaaa catgggtaca gacaattttg    399840
     ttcgtgaagt aaccaatcag atgacagata gccgtgtaac cgcaattaaa ggtttgatga    399900
     agaacctacc aaatgttatg cgtgaaagta ttgaaaatgc tcgttcattc agaagtgcta    399960
     atgaaatatt aaatggtaat agcccattaa agaaattttt aaaagagcag gataaccgta    400020
     ttaagaaatt gtttgagaag aaatttggta cacatggaat gaatgatcta gacataatta    400080
     gtaggacaag tggtatggct gctaagtatg aagaacttgt tgataagatc atgtcagctt    400140
     acagcaaata cttcaacact caaattcgat ttatggatgg tggtaatccg ctacttattt    400200
     tagctagtaa gaagagtatc atgaatttaa gcgaagtaag aacatatgaa gaattggttc    400260
     gaaaccctag agtattcact attgagcttc catcctttga taaggatatg aaggttaaat    400320
     acggcggaaa ccgaaaaact tctgttattc gttcaggtat tggtgcaaaa ggtgcctatc    400380
     atagtacatc ggtaacagat gctcttaata tgattcttga ttactccaag aaagctaaag    400440
     agctgtctga gatagctgaa agtatagata gcaagaatgc atttgttcaa ataagacaag    400500
     ggcttcgtta tcgtgttgaa aggcaagtag atccagtttc tactgatgca agtcggaaat    400560
     tctacttcga tgataaggga atgtttgata tcaaatcagc tatgagtgac gaagtccgtt    400620
     caagcaaatg ggatatcaca ggatatgcag agtcatggta tcgtgcaaat tctaaccgat    400680
     taggatttag tatttctgcc gacattattg ctcaaaatgc aattgaaaaa ggaatcacat    400740
     tctttgaagc gatgggacaa agagcaaaag ggtacgctat tgccggagaa cttctcaatt    400800
     ttgcaaaagg tgcttctgga ttaaaaggaa gtatggttgg tattaataca cgttctgctg    400860
     caaaaggttt tgttgctact acaaatacag atactcgtac ttacagggca ttaggtaact    400920
     actatgctca tacagtagaa aatccaaatg aaccaattaa ctaccgaaaa gtagaccaag    400980
     aagtcgcttc aagagtgtta cgtaactcgg gtaaagatca atcgttccgc acgaaaaata    401040
     gctttatttc atcacctgca ttcaaagctc ttgatgatgc aaatgaggtt cgtggtatta    401100
     caatgcaaac cggttatatg acaaatgaag aaattgcatt aaaactgaat gatgctaaca    401160
     ctattatgaa atacaagagt atgattgata cagctcaatc taaaaaacaa atcactcctg    401220
     tagaagcaag tcaaatgaag gggtctttag acaaatgtat gatttctact agtgaaggtt    401280
     tggcgtttat ggattacaag ttaatgaaag cttttgatgg aatggacgag gttcgtatta    401340
     atatgaacgc tgaaaaagta atgtttaaca actatattga aatagctatt gaaaaagaag    401400
     ctgaaaaaca aggtcttgct aatggtttat ggaaagagaa aggaattact tttgataaac    401460
     cattagagat tgatataaat tctatgttca atgagaagaa tcatcttact cttggaaaat    401520
     atgaaatcaa caatatcaaa aatgaaattg ttgatgaacg ccgttttaag aaagatgata    401580
     cggtatctat cattggattc aacacagatg acattaataa aagatcgctt gtattaggta    401640
     gacaacgtaa aacaggacat ggatttaaag tagtaactga gggtggtttc catgctacta    401700
     tgactcctat gcttggtgat atcatgagtg atttattcgg cgtagaaggg gtagaacagg    401760
     tgatttctta tcaagtggaa aagaaaggtg ctactgactt accagcatta attcgtggtt    401820
     acgatactca aattcgtcaa caattcagtg gttctgtggc aaataacaaa atcactactg    401880
     actatgctac tgaagaaaga gctttatctt cattctataa ggatgttgaa caaatgcttg    401940
     gtattaaaac gactaataaa gatggtcagt atgtagtgga ttctaacttt ggtttagatg    402000
     gaaaacagct agactataaa ggccgcgaga agctttcgtc taagtggatg gataaattag    402060
     gctttaatcg tgaagtattt gctgacatca caatggccca tgaagcttgg gatcgtcagg    402120
     gtggaattag ccgtgataag gtcacggtta aagagattgg tatgttagac aattccgata    402180
     ttcgaacagg attatatggt ccgggagaat cctctatata tgctaacttt atgcatggga    402240
     tggtttatag gtctcaaaca aagccagaaa ttaaagctca acaaaaagta ttcaagaaaa    402300
     tggttaagat tgttagtaac tatgaaaatg attgggaacc taaaacagga gatgtagtta    402360
     ttgattacac gtctgatggt acggggttaa tggctgatgt aaatgcacag atgaaagatg    402420
     gggtacttca tataagtaag gattcatttg aagagaggcc tcgaaaattt ggtcacaacc    402480
     aaacttttac tgttgaggat tacggcaaaa ctgttatcaa tgctggattg atggagttta    402540
     atttagagtc tggtgttaaa ggtaagaaga ttcaagaaca cttacttagc acaaaaggaa    402600
     cagcatactt gaaacttccg gaatttgcag cgaatcaata cattcctctt cttgatatca    402660
     actcaatgaa actacctggt aatgttaatt acgtcgagaa aacggaattt cttgatacat    402720
     taaaaggcaa ctatacttct attgttagaa aaacagaaga gtacaatgat ttgtttacaa    402780
     tagataagtt ttccgcaagc gatatagcga cgcgacgtgg agttctagaa acggaaatta    402840
     atagagaagt ttctcatctt gttgcaaatc ttagtaattc aacttcgaaa gagggtgtgg    402900
     ttgagcgtat ttctgggaac ttcagcagag ataatttatc agtgtttttt cctcattatg    402960
     gtataaatga ggaaaaacaa agaaatgctg tgatgaatga tatcactaga ctacatgttt    403020
     ctgataaggc gaataacaaa ttagcgggtg atgtaatcac tgcttccgaa gcgttcttct    403080
     cagagaatag cgctgagaac ctcactcttg gaaatctata tggtgctaaa gcatatgaaa    403140
     aaatccgtga atcacttaaa ggtacgggcg taaataatga ctggggaaca gttaagaatg    403200
     gtgaactccg gataggtaag tctgaacacg aaaaatcaat cctagctagt actacttctt    403260
     ctacaattag cagtgtaaac aatacacgta tgagaacgtc tgcagcgttt atgatgatgg    403320
     cagaaacaaa aaaagaacca tttaatgaga cagaaggttc aagtcaaaac gcagaagaag    403380
     taatggataa tagaagagct gttgggccag aaattttctt aaatgaagca gtgccaattc    403440
     atcatacaat gcgtaatgag atgaatgaat cactatcaga tattgcgact gttggtaaga    403500
     aagcattcag tggaagtgct ataagtttaa ctggggatgg gcctatagga tttggtgaat    403560
     tatgggcgac aaacgctcta atgaaaggta caccgacacc agagggcctg caagaaatgg    403620
     caccagtagc acctaaaact ttagggcctc ctacagcccg tataacacct aatcaaaatg    403680
     gtgagtacat taacatttct gtaaaggcat cggctagtaa gagaatgaat cataataacc    403740
     tagcagcgat gataaacaat gaaatcatga caatgtcgaa tgtcaaaatg aacacgagtg    403800
     ttaacgtaaa tgacaattcg aaaaaaattg acagcaagtg gctagagagt gctattgcaa    403860
     atgcgatgaa taagggttat gcatattaat agacaaatga gagttaacat tttgttagct    403920
     ctcatttgtt ttactacaga aaaagaggtg accagagtga aagaaaaaat attaattacc    403980
     tctctaacaa gagttagaaa aaatgcgcct tggcgtgttg gtatatacat aaacgaaggc    404040
     tacacattta ttaatgtagg tgataaaggg aacatagcaa ctagtccaag attcaacata    404100
     tttctttcgg aggtagaaaa gaaagtatct cgttatccag tagatgttag tttctattcg    404160
     attgaggaca atagagaaat ggaagtaaca atgatgcgtg accaaatcat ttacattgat    404220
     tgtggttata attcacacag actattatca agtgctcgtt tctactatga aaaacacgta    404280
     ctttctaatc cattagaatt agcacagcaa aagccggaag aaaacaatgg gttatttaat    404340
     gtgatggaaa aacacgaaga atcaattact tcttcagact acattgcggt tggaagagta    404400
     gagaaagtta cagatggtga tacaattgat gtgaatctaa taaagctatc tgactattta    404460
     tctaaacatt ttaaagtaaa tcaaacagtc acaattcgat ataacggtgt agatacacca    404520
     gaaaaagctc aattaggggc agagaaatac aaagacccta agaacgctaa gtttggaaaa    404580
     acatatggtg ttacaatgca agacatgtac acaatcggag aagaagcgta taaatacaat    404640
     gagacaatct taggaggaag tgcatctcaa aaaccacttg tgattattca ttttgaccgc    404700
     aataaaagtg gagatccacc taaacaagac gctggttatg gtcgctacat agcagacata    404760
     tatgcaacga atgaaaaaag tgctgatatt gtatttgata aggttaaaga tggaacgaaa    404820
     tttgtacatg taaataagtc tctactagta aaaaaatcag cgaagttccc tcaaattcct    404880
     cttggtctat tcccatttgg gtatgcaaat actgcaactg ttcttaatcc gttgaattgg    404940
     attattgagt tagggttaaa agcatacgac actggtactg gttctccatc aaaggaccca    405000
     aatagtgatc ctgatatcgg tagtcctgaa ccgtatgatg aaaatattaa tgagcaagag    405060
     attaatatag gaggaacaac aggaccaact cataacgcct tagatttctt tgggccgtat    405120
     gatgacaggt tatctgtttt cacaaatggc atcaaaacaa tagatgactt aaaaagacat    405180
     tcaaaggtta gaattgggga cgtgatcctt acaatcccac ctatctctat tgaggtaaac    405240
     aaaaccgcga atatctccaa aataaaaaca cttcgtacaa aatcctctgt attagttaac    405300
     cgtggtcaat cacttactac tttaagcatg gatctttatt tccacgatat cgaatcaatt    405360
     aatggtaaga aatatccttg gaagaaagaa tacgcaaaag gggaagaagc taaacatttc    405420
     tacgtggatg gacttagacc attacttgca caatttgcta aagcaccatt ccttccaatt    405480
     gataactact acattaatga cgtattaggt atccgcgatg tagctttaat gaatatcgaa    405540
     gtaacaacgg ttcctaattt cccagaatct ttaactgcta aattaacgct tgttgaattt    405600
     aattcagagg catacttgat ggacaaaagt acactgggcg attctatcaa ctacccaatg    405660
     ctaagatggt actacaatca atctctagcg ggtcgtgggg ataaatatcg tttctttaaa    405720
     ggattggaag gcccaattaa aagtgacatc aaattcactc ttgctgacga aacgttcctg    405780
     gctacacgaa agcacgctat tgattacatg aagaatgcag attctccaga acaaagaaaa    405840
     gtcgagttag agacaaagaa tacggattac aaaaatagaa aagaagatgc atctgttgtt    405900
     aaagaaatct tggatcagta ttatcgttat aaagattttg atatcaaaaa acacacaatc    405960
     attgactact ttagtaagcc aggactagat aaagcatcta caagtattca aggattaatc    406020
     agagacaagt acaaaatcaa aaaagaggaa gcagaaaatg ctattgtgga ggcaggcgaa    406080
     ctattttcta atatatatga taataaatat aaggacgtaa acactatctt aatgcataag    406140
     gaaatctttc tcccttatga gtctcgttta ttctacaaaa tccggtttga ttggaacttt    406200
     ttagagtcat ttaataatcg ttatgatgaa gacccttctg tggtttatga taaaaaacaa    406260
     tatcagggaa aagaaaaaga tggtcttatt attttaaaga aattaaaaga tgcaggtagc    406320
     caaaaaatac ttgaaaataa attcaaggag ttttatgaga aagaaacatt ccgtattccg    406380
     gctaacgata ctgcaatcga cgcacttaaa aaaattgcag aaggcgcaaa gaaaatggaa    406440
     gaagaagtag ctaaatataa aggcgaattt gatgaatata tgaaagtcat tgaagctagt    406500
     gagcgcatga ttccaatgaa agagtaccct atctctggga aggttatccc aatctctatc    406560
     aatgctcgtt tctcaaacga gtttagcatg gcgcatgttc tatctagtga agctgcatcc    406620
     ctccaataca tgggtggtgg agatccttat attgacttaa tcttagaagt ggatgaaagt    406680
     ggcgcaagag atttcaataa tcttatttca acttctgatt actacgctaa gacatacaat    406740
     caaggtatca caaatggata tatcggtatt gagaatgacc ttgctcaatt atttggtatt    406800
     cgatatgtaa tgtttgaaag tatctctgta aacacagttc ctagcttccc tggaagatat    406860
     caaatcatgc ttcaaggtat tgcgtttgat aaaacacagc gtcaacgtga agaacttaca    406920
     gcattacctg gaaacagtaa gcagatggat cttgaaacac tgaagaacaa taaaacagca    406980
     tttgcaaacg accgtatgat tgaagcaaga cttcataaat tagaagttta tccagatatg    407040
     gagcttccaa cttactctca aattaacgat gtattaccag agatagacgc aggtgcaaaa    407100
     gagtatccaa acttaacagg tggaacatat ctagaccctg acttttattt ctctacaggt    407160
     aacacattaa gacagttgat tgaatcaagc taccagggca accatcaagt aaacatgttt    407220
     gatgctacag gtgtagctgc ttatacaagc aatatgtcaa cagacaagct ttttgataca    407280
     actgaggaag actgggaaaa acttaaggca ctgcaagaaa cagaaggtgt agaacctatt    407340
     ggatgggtgt tcaaatgggg ccaagagcaa gaagctgcta aatctgatac tcctaataca    407400
     tcagcaggac ctgttatggc tgatcaaggt ggtactgcat cagtaaagaa tgcagacgtc    407460
     caaaagtttt taacagagaa aaaagatgat gaatttgctt acgaaacctt cccaactatg    407520
     gaagaatgga aaacactttt ccctgatggc gggaacgact atagtacttt ggctaaagac    407580
     cccagcggtg atgaagcact catttatcaa gagattgata gcttagttga taagtatttt    407640
     aagaagtatt actcattccc tgacttcatt gaagagtgtc gtggagattt aaaagatgcg    407700
     gataaatcta aaaaactagt atcttatcag cctgcagaag atctttatta tgcaagtttt    407760
     aacgcaaatc gtaacaagct acatgatgct aacataggca tggttagtga tctaatcaaa    407820
     aaaggaacca ttaaagagcc taaaaaaacg gatcgtatgg attcgaaaga cttccacaaa    407880
     acagaagtga aaatcacaaa agaacgattc atgacactta tgaaagcatt ccttgataaa    407940
     acaagtcaat ggaagcattt caaagggaag atacctactg taagtaaagc tgggcgtgta    408000
     ggaatagcgc aagtagatgt ttcttcaggc gacatgaagg ttgatgaagt gaaacgctta    408060
     atgtataact ggagatacaa tttacaaaca gcagtcaagc aacttgcgga acactacgag    408120
     aagttaaaca agttagacaa agattgtgag aactttgaag ttatttgtcg tccttgggat    408180
     ggaatgtttg ctctatatga aaaaccagat gcgaaaatta aatttgctaa agacattgaa    408240
     gataacagtt ttgcaagtgg tgttattagc cgattcaacc attacgcgac taagccattt    408300
     aatacgttta gcgggtacaa taaagatgtc tataaaggaa aagcgaattt aagcatggac    408360
     gagtacatta caatcggtaa tggtaataag gatgactacg ttgataaact tcttgagctt    408420
     gaatactatg atttatcagt attaaaagaa aataaattaa aagttgactc tgataagaaa    408480
     aacatcaaga aggttatgaa agaacatctt gaaaagatgg acaaggacga actgttcagt    408540
     acttatcaga agcatctaaa gttcttatat gagctaagta aacaggatag caagatagaa    408600
     aaaactgtgg actttttcgg gaaatggagt ctaccaaatc ttgtaacctg gggtaaagct    408660
     ggaaaaatgg ttgataaagc aacagatgta atagcgggaa gtaaaaaaga taagaatgga    408720
     tacgagtatt cacgaaaaat ctttgaaaaa gccgctaagc tttatgagtc aattattgat    408780
     gttgataaga cagctactgc ttcaacagaa tctacggaca ctcgtttata taatgatgtt    408840
     gatccacgcg tattgtatga agagatgttc tacgacttaa gataccatga ccaacgtgga    408900
     agaatgcttc gtgcattccc aggattccaa atgttcatta ttcatgaagg tgattatttc    408960
     gggaaataca agttttggga caatatgtat ggattcaatg ctatccaaag catagacgtt    409020
     catcgttctc gtaagatagc tgcagataca gcagtaatct ctatgactaa cgtttactcg    409080
     aacttaacaa ctcgtcgtac tgatgttgac tatgcagacc gtgagatgaa atggtgggac    409140
     aactacatct ggaatgagat tcctcaagat ctaattgaca aaaaggaaaa cgaaattcac    409200
     aagaacctct tcctggaaac aggagcgcgt atccatttaa gaatgggata tggggcaaca    409260
     gctagtgatt taccaattgt attcaatggt acgatttcag aattggagct tggtgatgta    409320
     attgaaattg ttgctcaagg tgatggaatt gaattaggaa acgtagtgtc tggtgaccct    409380
     gaggatacta atgatggttt attccaagta accgaaccac gagatttgat ttgtagtctt    409440
     atgagttcga aaggaagttg ggctaaagat ttcatgaacg gtgtagttga tgaacgactg    409500
     tttaaagaca accctctagg aatcatgcat tttggtcaac cgttcgactc taacggttcc    409560
     atcgattcaa aaccattggg taacctagta tggtttaacg ataactatgg agaagttgct    409620
     caaaacattt attcctcaaa cggtacacct acattctctc aatggttaca tccaaacgga    409680
     gaacgaaata atatctttga agattttagc tggaagcgtc tatgggataa taagtttaaa    409740
     atcttcaacc caggtgatga agataacgta gttcttaagc tttataacaa tacggtttgg    409800
     gatataatcc aaagtattac gtattctact ccggattata tcgctgctgt tcatccgttc    409860
     gaattacgct ccacattatt ctttgggaaa ccatactggc gttgtgcatt cgaatacggt    409920
     tctcgatatg aatttgaggc ggcagataaa acatggaaaa gataccttac atctcaacca    409980
     aaacgaccat atatgcaaaa taaattctac atgtcggctt atgatattat agaaaataat    410040
     attaaggcca gtgaggataa tatctttaca aacgttatcg ttaactatga cggaaaacaa    410100
     acgcctgtac tttatgcaga tgctgatatt cgttatgaca aacagaaaac acgagtagta    410160
     gaagcggata ttgtagcaaa atttggtgac ttctatactt cagaagttat ggcgacacat    410220
     ttcggacatt ctactcttcg agatagtatg aaagatatgt ataaaggaaa tctattagta    410280
     ctaggagatc ctactgctaa acctcacgat atgatgtata tcaatgatga aattaacgac    410340
     ctacaaggaa atgcgttaat taagtcggta acacatcact tcagtatgga aactggattt    410400
     atcacttcta ttgagccgga tctactggtt gtaaatgatg accaagtgat tcttgaaatg    410460
     agtaagtggt atatgagttt tggacaatcc gttgccgcta cacttgcaat ccgtgctgca    410520
     gcaaataaag ctgggagaaa catgactaag tggattacaa aatctaatag tatccctgct    410580
     aaagtaggga aatgggtttc aacaaaaggc ttaaggcata cagtgaggat ggcaaatagt    410640
     gatggagata tggacaaaat ccttaaaacc cttgatgata tcatttcaaa agaggatggc    410700
     gatgttaaag ctcttcaaca gaaattagca aaagatttcg aagaggcagc ccaaaaagtg    410760
     accaaggaag taggggaaga agcaggtaaa gcagctggga aagcagcagg aaaaacagca    410820
     ggaaaaacag catttattaa gaacacaagt aaacaggccc ttctaaaatc gggggctgca    410880
     tttgcaaaag tcttatcaaa ttctgacgat atagcaaaga tcggtaaagg tgcagtaggt    410940
     attattcgag gggcagcttc tttcactcca gtcggactca ttgttaacgc atcaatatgg    411000
     attggtacgg aaatgttgtt tgaacactat cgtcgtttta aagaaaatct tcaatgtgtt    411060
     gtggcaatgc cattaactta tagaggaaaa gaattaacgg caggtattaa caaccatgca    411120
     ggtatgattt acggtgatgc accaggtcga tatgatgtaa tgttcaatgc gaaatttggt    411180
     gatgataatg gtgaggattt ctttggtagt agtctaataa aactagctaa cttctttact    411240
     ggttcaggtg gagaagacgg tgtgtatgca aaaactgaga aagctcgcca gctaaatgaa    411300
     ttatctaaga agcaacaaca ataattaagg gagaggcata gcctcttctt ttttttgtgt    411360
     taacggtgga aaaaatcaaa ataaatggtt agcttatcac agtaaggagg aatagctata    411420
     tgacagaaaa agaaaaacca aaagacaagc caaaaacgaa tgacaaacaa acgtacaaca    411480
     ttgagacata tgtaaagaaa ataaaagcag cgaaagaagt atatgaggaa cgaaagaaat    411540
     tcctacagag tttctcactc aaaaagaaaa aagaaaagcc aaaagctgac ggtggggaag    411600
     ttgctgctgc atcgggtggt ggcagcgtaa actttaatgg agaattacct acggttgctc    411660
     agtatactgg accagatgtt tacaccgaca aactcctaaa cggaggagtg taccaaaatg    411720
     gacttaaagg taaggtagct ggtactgatc aatggaatca gcatattaaa gaacaagcag    411780
     caaaagctgg tgtaaaccct ctcatgatta aagtaattat ggcaacagaa tctggtgggg    411840
     accacgttaa aacaccaaac tcttctaact gtgttggatt aatgcaaaca gaaaaagaaa    411900
     ttactggtaa tctaggttta gattttggta aagcatgcaa tgatccggtc tataatatct    411960
     atgttgggtg catgattctt aaatcaaaac atgattatgc tggaggcgtt atctctaggg    412020
     gtaaaaatcc atattcagat tataaaagcc tagggtatga gttaaaacaa aacggtcatg    412080
     gggttgcctg gttatataac ggtttcagtg tgcctcttga cggaaaaaac aaggtttatc    412140
     gtggtggata tgtttatgcg aaccaagtaa ctgcgatgta taaaggtttt ggaagagacg    412200
     catacacaga tacaatttta actttggacg ttttatctgg tggaggcggt ggtggcggaa    412260
     gttcatcatc tgctggtggt aaaggaacag gcggaaaatg ggaatatgga aaaacatttg    412320
     caagcggtgc agaagtggtt aaattcttgg atactgtaga tacaactacg attaatggaa    412380
     tctatgtcca ccatacttgg gacccagacc atacaaaggc taaaggtgtg tcactagcaa    412440
     cactaaatga caatatgaga agatttcata cacaaacaaa tggctgggac gatatcgcgc    412500
     agcacttcac tattggtgtg gatgggcaag taatccttgg acgtaatatt acatctgtcc    412560
     catgtagtgc aaaaaactac aatggtacag atgctaatca ccccgccatg tatgaaatga    412620
     taggaaactt tgataaaggt aaagacgttt tgcaaggtaa acagttggaa tcggctgttg    412680
     ctattgctaa atacttttct ggtagaccaa atggcgtaaa gtttcaccgt gaaggattaa    412740
     ttaacggtca ggaaccaaaa agttgtccag gtacaggtgt tgataaaaat tggtttatgg    412800
     gactagttaa tggtggagca aaagcaagtg cattttctgt tcaatcagct cctttatcag    412860
     ataatgagat tgaagagaat tttgcggctg gctgtgacct ttatcaagat ccagtaagag    412920
     agaaagctgt tgaatacaca gccaagctac caccaaccgg agaggaatta gcatttgcta    412980
     gaagtttttc agccaagata agtattcctg ttgcaaaatt aaaagagagt agaattgttg    413040
     ccccggaata cacaagatca agctatgtgg aagactttaa aatgtcatcc agttatgata    413100
     tgaaaaaaaa ttattcccca ttgtctccaa atgaatttat tcatctaaat ggacctcaag    413160
     ataattttta cacaagtgaa gcaagacaag ctttccgtct tcttaaagat cgacttggat    413220
     acagaacttt aagaatagct agagggtttg acccttccga tggagagtca tctcattcta    413280
     ttggtatatc tatggacata tatgctgatt ccacggaaga agcagtttac atagctgata    413340
     ctgcatggat aataggattt cgttcaattg cggttgggcc taattttgtt catgttgata    413400
     tcggaccaga agcagtttgg ggatatgata agctaccaat ctatagagga ccaggtacat    413460
     taaaggcagg tgcattccgt tatggctaca aacaagcaaa cctttaacat agaggtttat    413520
     aagagaaaaa ttaaggctgg taaggaagag tatgccaaga gaaaagagtt ccttgctaaa    413580
     ttcaatctcc ctaaacttaa tgacgatgaa gaagaagtag aagaaaaacc ttctgatgat    413640
     agtaaaaaaa ctgaagacca agggaacgca gttaaagaac ccgatggtgg agttggtaac    413700
     ttcacaggtt ctggtgaact atctgtaccc gcagagccta aatcatacag attcacttct    413760
     gtgatgggtg ctcgttgggg aacaacacat aatggagtgg acttagcccc taatactcct    413820
     ggtgatacca actgcaagat actttctgca ggtgatggag ttgttcttca agctagaagc    413880
     ggagtaggtg ggtttggtac ttggatagtt attaaacata aggatgactt gtatacgatt    413940
     tatggtcata tgcatcctag tacactaaaa gtaaaatcag gagacgcagt aaaaagaggt    414000
     caacatattg caaatatggg tatgcaagga gagtcaacag gtgtccattt acactttgag    414060
     gtttgtacag actttgttaa taacaggaga ggaactacaa agaaccctga agactacgtt    414120
     aatgttcggg caagtgcttc gaaaattgag gtgaattcct ttgcaccaca agccaagttc    414180
     tcagcaaaag ccgatacaaa agaagaagga aatgaaaaaa caatgcatcc tcattacgat    414240
     aacgacggtg cagaactatc agaggaagaa aaactaattg atcagacgta cagaagttct    414300
     ttcccatacc taccggttca attcataggg gattctatta agaaaaatga tatcacaaga    414360
     gagttctttc ttcttaatcg tgttggttgg gctagaacta ccaagtatga aaaaatggtt    414420
     tctttacata aggaaagatt tattcatagt gaaaaatacg atggtcatga aggaaatctt    414480
     tattcaccag acgcaaaaag gttgtttgaa agcttgcttt tgaaaaccca aaaaccttac    414540
     tttgaggtta ttagtggttt ccgctttagt aacgacggtc aactctcacc gcatgaagca    414600
     ggttgtgcaa ttgatatcct tgtcaaaagt atagatgagg ttagagaaat tgcggattgt    414660
     gcatggctat taggtgtgag atcgattgca attggtggag attttgaaaa caacaaaggg    414720
     ttcattcatt tagatattgc tccaaaagga aaagacttta tgtatgatgg agtgcctatc    414780
     tatggtggac caggaaagtg ggtgactcaa tgaattttaa tagtcaaatt caccagtcta    414840
     tttatagtaa agtagttgta ccatctttaa atagattaca aggaacaatt gagggctatg    414900
     taattcaagt agactacacg aagttaacat gtgaagtggt ttactctgat gaaaacagtc    414960
     atgctttgcg aacaatgaaa aacgtttctt tacctaaaga tggagatggc gtatttacac    415020
     aagctgttaa aaatggtgat agggtttcaa tctcctttaa aaacaaatct aaggagtcac    415080
     cttacatttc taccgtatat aaatcaaatc atagtgaaga aaattacatg agcccgtatg    415140
     gtggaagaac aattagacaa tcacgtattt tttagaaagg aggattccta tgaatgaagc    415200
     atatgtaaat aagacatacg gtgatggaga taaagacatt cattatcctt attggcgaca    415260
     agtattgcaa agtgagctcg tcaactttaa agctaaaagc ttagagaagg aattagaaaa    415320
     ctggcaattc attagtgaag atgaaatcgc attgaagcac ccagtaacag gatcaacctt    415380
     taaactttgt gatgatggat ctattgaaat gtttgttaat gaagatactg gtattcgatt    415440
     agatacaaaa gagaatggaa tcatctttta tggtgacagt attcattttg ctacaaagga    415500
     aatgcgaatg cacaccaaac catacggatt catttggaat aaccacaacc taaatcctta    415560
     tctatattac ggtgataagg taggggaaga aagaaacatt ccaaaagctt caatggtttc    415620
     tacattgcaa gatggacaag caaatatcaa tgttccttta ttccaagaac aaaagagaaa    415680
     acattattac gaccaaaaag ttacatccat gattgaagat ctaggaatag aaacttcaag    415740
     aataaagaga ggaggataac aaatgaaagt cgattttcgt ttttcaccgg aaggagattt    415800
     agagcttggt tctcctagct ataatgattt cgatgaatta ctctacgttg attctgttgg    415860
     caatatctca acagatagtt cagaaggttt attaataaga gatattccat tgcaagtatc    415920
     ttacttaagt gagaagcaag taatacttaa cagattaaga acagataatc cagattggtt    415980
     tatccataag gatattggag cagacttatc tgaattaatc ggtctaccca atacaagaga    416040
     gacaggtgaa ttaggtaaaa cgctaatcga aaaaagctta acagatgata agttcatcct    416100
     tccagctgac ttagatgtta gaccagtccc tgttagttct agtgaaatac ttttctatat    416160
     aactgtaaaa agaaaagtaa cagatctagt tatgccagtt ctatttaact tagaacatgg    416220
     tttgttatca gaatatgagg tgaacagtta atgagaaaat caaaagatga aatgctcgaa    416280
     gatgtattaa caagacttcg aactgatggt ggaattactg aaacaagtcc aggttccatt    416340
     gctcgaatgt tttcagaagt aatgatagac gaatttagtc cattctacga tgaattagag    416400
     ctaattattc agatgggctt tgtttcaaca tcaacaggtg gatacctaga ccttattggt    416460
     gaactgttaa actgtactcg tgatggagat gaatcggacg acaactatcg tgcaagaatc    416520
     tctaatcaag tatctgttga acagaatgca aatttaattg ctatacgttt aaaaacactg    416580
     agaattgatg gcgttgcaga tgctcagttc aaaagattta caagagggac aggctcattt    416640
     acttgctatg ttactcctca agtctatcca attgaaaacg acctattaac tcgtgtagaa    416700
     agcattatag atgaagtagc tgcttatggt atgaatgtag aagtaaaaac aagtgagtac    416760
     aaccccgttg atattaccct caacttaatt ttccactcaa aaacaacttc tcttgaaaga    416820
     caacacatcc gcaacaaagt tattcaaaat gtcggagcgt acatgaagca attaaatatg    416880
     ggttccccaa ttattatcaa tgaaattatt cagcgtgtaa tggaaacaag cgaacaaatt    416940
     ctagatatgg aatttaaaaa acttgttgtt aatgaaaagg aatacttcat taagaatgtt    417000
     gagccttcat tagaagaacg atacttctta agaaaaatta acgtagcata gaaa          417054
//

If you have problems or comments...

PBIL Back to PBIL home page