(data stored in SCRATCH3701 zone)

EMBL: CP000908

ID   CP000908; SV 1; circular; genomic DNA; STD; PRO; 5471154 BP.
XX
AC   CP000908; ABEC01000000-ABEC01000016;
XX
PR   Project:PRJNA18637;
XX
DT   21-DEC-2007 (Rel. 94, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 5)
XX
DE   Methylorubrum extorquens PA1 chromosome, complete genome.
XX
KW   .
XX
OS   Methylorubrum extorquens PA1
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Methylobacteriaceae; Methylorubrum.
XX
RN   [1]
RP   1-5471154
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Saunders E., Brettin T., Bruce D., Detter J.C.,
RA   Han C., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Marx C., Richardson P.;
RT   "Complete sequence of Methylobacterium extorquens PA1";
RL   Unpublished.
XX
RN   [2]
RP   1-5471154
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Saunders E., Brettin T., Bruce D., Detter J.C.,
RA   Han C., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Marx C., Richardson P.;
RT   ;
RL   Submitted (05-DEC-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 4c7b40ffa9775c3b80a3a18b5abedb8f.
DR   BioSample; SAMN00000030.
DR   EnsemblGenomes-Gn; EBG00001118187.
DR   EnsemblGenomes-Gn; EBG00001118188.
DR   EnsemblGenomes-Gn; EBG00001118189.
DR   EnsemblGenomes-Gn; EBG00001118190.
DR   EnsemblGenomes-Gn; EBG00001118191.
DR   EnsemblGenomes-Gn; EBG00001118192.
DR   EnsemblGenomes-Gn; EBG00001118193.
DR   EnsemblGenomes-Gn; EBG00001118194.
DR   EnsemblGenomes-Gn; EBG00001118195.
DR   EnsemblGenomes-Gn; EBG00001118196.
DR   EnsemblGenomes-Gn; EBG00001118197.
DR   EnsemblGenomes-Gn; EBG00001118198.
DR   EnsemblGenomes-Gn; EBG00001118199.
DR   EnsemblGenomes-Gn; EBG00001118200.
DR   EnsemblGenomes-Gn; EBG00001118201.
DR   EnsemblGenomes-Gn; EBG00001118202.
DR   EnsemblGenomes-Gn; EBG00001118203.
DR   EnsemblGenomes-Gn; EBG00001118204.
DR   EnsemblGenomes-Gn; EBG00001118205.
DR   EnsemblGenomes-Gn; EBG00001118206.
DR   EnsemblGenomes-Gn; EBG00001118207.
DR   EnsemblGenomes-Gn; EBG00001118208.
DR   EnsemblGenomes-Gn; EBG00001118209.
DR   EnsemblGenomes-Gn; EBG00001118210.
DR   EnsemblGenomes-Gn; EBG00001118211.
DR   EnsemblGenomes-Gn; EBG00001118212.
DR   EnsemblGenomes-Gn; EBG00001118213.
DR   EnsemblGenomes-Gn; EBG00001118214.
DR   EnsemblGenomes-Gn; EBG00001118216.
DR   EnsemblGenomes-Gn; EBG00001118217.
DR   EnsemblGenomes-Gn; EBG00001118218.
DR   EnsemblGenomes-Gn; EBG00001118219.
DR   EnsemblGenomes-Gn; EBG00001118220.
DR   EnsemblGenomes-Gn; EBG00001118221.
DR   EnsemblGenomes-Gn; EBG00001118222.
DR   EnsemblGenomes-Gn; EBG00001118223.
DR   EnsemblGenomes-Gn; EBG00001118224.
DR   EnsemblGenomes-Gn; EBG00001118225.
DR   EnsemblGenomes-Gn; EBG00001118226.
DR   EnsemblGenomes-Gn; EBG00001118227.
DR   EnsemblGenomes-Gn; EBG00001118228.
DR   EnsemblGenomes-Gn; EBG00001118229.
DR   EnsemblGenomes-Gn; EBG00001118230.
DR   EnsemblGenomes-Gn; EBG00001118231.
DR   EnsemblGenomes-Gn; EBG00001118232.
DR   EnsemblGenomes-Gn; EBG00001118233.
DR   EnsemblGenomes-Gn; EBG00001118234.
DR   EnsemblGenomes-Gn; EBG00001118235.
DR   EnsemblGenomes-Gn; EBG00001118236.
DR   EnsemblGenomes-Gn; EBG00001118237.
DR   EnsemblGenomes-Gn; EBG00001118238.
DR   EnsemblGenomes-Gn; EBG00001118239.
DR   EnsemblGenomes-Gn; EBG00001118240.
DR   EnsemblGenomes-Gn; EBG00001118241.
DR   EnsemblGenomes-Gn; EBG00001118242.
DR   EnsemblGenomes-Gn; EBG00001118243.
DR   EnsemblGenomes-Gn; EBG00001118244.
DR   EnsemblGenomes-Gn; EBG00001118245.
DR   EnsemblGenomes-Gn; EBG00001118246.
DR   EnsemblGenomes-Gn; EBG00001118247.
DR   EnsemblGenomes-Gn; EBG00001118248.
DR   EnsemblGenomes-Gn; EBG00001118249.
DR   EnsemblGenomes-Gn; EBG00001118251.
DR   EnsemblGenomes-Gn; EBG00001118252.
DR   EnsemblGenomes-Gn; EBG00001118254.
DR   EnsemblGenomes-Gn; EBG00001118256.
DR   EnsemblGenomes-Gn; EBG00001118258.
DR   EnsemblGenomes-Gn; EBG00001118260.
DR   EnsemblGenomes-Gn; EBG00001118262.
DR   EnsemblGenomes-Gn; EBG00001118263.
DR   EnsemblGenomes-Gn; EBG00001118264.
DR   EnsemblGenomes-Gn; EBG00001118265.
DR   EnsemblGenomes-Gn; EBG00001118266.
DR   EnsemblGenomes-Gn; EBG00001118267.
DR   EnsemblGenomes-Gn; EBG00001118268.
DR   EnsemblGenomes-Gn; EBG00001118269.
DR   EnsemblGenomes-Gn; EBG00001118270.
DR   EnsemblGenomes-Gn; EBG00001118271.
DR   EnsemblGenomes-Gn; EBG00001118272.
DR   EnsemblGenomes-Gn; EBG00001118273.
DR   EnsemblGenomes-Gn; EBG00001118274.
DR   EnsemblGenomes-Gn; EBG00001118275.
DR   EnsemblGenomes-Gn; EBG00001118276.
DR   EnsemblGenomes-Gn; EBG00001118277.
DR   EnsemblGenomes-Gn; EBG00001118278.
DR   EnsemblGenomes-Gn; EBG00001118279.
DR   EnsemblGenomes-Gn; EBG00001118280.
DR   EnsemblGenomes-Gn; EBG00001118281.
DR   EnsemblGenomes-Gn; EBG00001118282.
DR   EnsemblGenomes-Gn; EBG00001118283.
DR   EnsemblGenomes-Gn; EBG00001118284.
DR   EnsemblGenomes-Gn; EBG00001118285.
DR   EnsemblGenomes-Gn; Mext_R0001.
DR   EnsemblGenomes-Gn; Mext_R0002.
DR   EnsemblGenomes-Gn; Mext_R0003.
DR   EnsemblGenomes-Gn; Mext_R0004.
DR   EnsemblGenomes-Gn; Mext_R0005.
DR   EnsemblGenomes-Gn; Mext_R0006.
DR   EnsemblGenomes-Gn; Mext_R0007.
DR   EnsemblGenomes-Gn; Mext_R0008.
DR   EnsemblGenomes-Gn; Mext_R0009.
DR   EnsemblGenomes-Gn; Mext_R0010.
DR   EnsemblGenomes-Gn; Mext_R0011.
DR   EnsemblGenomes-Gn; Mext_R0012.
DR   EnsemblGenomes-Gn; Mext_R0013.
DR   EnsemblGenomes-Gn; Mext_R0014.
DR   EnsemblGenomes-Gn; Mext_R0015.
DR   EnsemblGenomes-Gn; Mext_R0016.
DR   EnsemblGenomes-Gn; Mext_R0017.
DR   EnsemblGenomes-Gn; Mext_R0018.
DR   EnsemblGenomes-Gn; Mext_R0019.
DR   EnsemblGenomes-Gn; Mext_R0020.
DR   EnsemblGenomes-Gn; Mext_R0021.
DR   EnsemblGenomes-Gn; Mext_R0022.
DR   EnsemblGenomes-Gn; Mext_R0023.
DR   EnsemblGenomes-Gn; Mext_R0024.
DR   EnsemblGenomes-Gn; Mext_R0025.
DR   EnsemblGenomes-Gn; Mext_R0026.
DR   EnsemblGenomes-Gn; Mext_R0027.
DR   EnsemblGenomes-Gn; Mext_R0028.
DR   EnsemblGenomes-Gn; Mext_R0029.
DR   EnsemblGenomes-Gn; Mext_R0030.
DR   EnsemblGenomes-Gn; Mext_R0031.
DR   EnsemblGenomes-Gn; Mext_R0032.
DR   EnsemblGenomes-Gn; Mext_R0033.
DR   EnsemblGenomes-Gn; Mext_R0034.
DR   EnsemblGenomes-Gn; Mext_R0035.
DR   EnsemblGenomes-Gn; Mext_R0036.
DR   EnsemblGenomes-Gn; Mext_R0037.
DR   EnsemblGenomes-Gn; Mext_R0038.
DR   EnsemblGenomes-Gn; Mext_R0039.
DR   EnsemblGenomes-Gn; Mext_R0040.
DR   EnsemblGenomes-Gn; Mext_R0041.
DR   EnsemblGenomes-Gn; Mext_R0042.
DR   EnsemblGenomes-Gn; Mext_R0043.
DR   EnsemblGenomes-Gn; Mext_R0044.
DR   EnsemblGenomes-Gn; Mext_R0045.
DR   EnsemblGenomes-Gn; Mext_R0046.
DR   EnsemblGenomes-Gn; Mext_R0047.
DR   EnsemblGenomes-Gn; Mext_R0048.
DR   EnsemblGenomes-Gn; Mext_R0049.
DR   EnsemblGenomes-Gn; Mext_R0050.
DR   EnsemblGenomes-Gn; Mext_R0051.
DR   EnsemblGenomes-Gn; Mext_R0052.
DR   EnsemblGenomes-Gn; Mext_R0053.
DR   EnsemblGenomes-Gn; Mext_R0054.
DR   EnsemblGenomes-Gn; Mext_R0055.
DR   EnsemblGenomes-Gn; Mext_R0056.
DR   EnsemblGenomes-Gn; Mext_R0057.
DR   EnsemblGenomes-Gn; Mext_R0058.
DR   EnsemblGenomes-Gn; Mext_R0059.
DR   EnsemblGenomes-Gn; Mext_R0060.
DR   EnsemblGenomes-Gn; Mext_R0061.
DR   EnsemblGenomes-Gn; Mext_R0062.
DR   EnsemblGenomes-Gn; Mext_R0063.
DR   EnsemblGenomes-Gn; Mext_R0064.
DR   EnsemblGenomes-Gn; Mext_R0065.
DR   EnsemblGenomes-Gn; Mext_R0066.
DR   EnsemblGenomes-Gn; Mext_R0067.
DR   EnsemblGenomes-Gn; Mext_R0068.
DR   EnsemblGenomes-Gn; Mext_R0069.
DR   EnsemblGenomes-Gn; Mext_R0070.
DR   EnsemblGenomes-Gn; Mext_R0071.
DR   EnsemblGenomes-Gn; Mext_R0072.
DR   EnsemblGenomes-Gn; Mext_R0073.
DR   EnsemblGenomes-Gn; Mext_R0074.
DR   EnsemblGenomes-Gn; Mext_R0075.
DR   EnsemblGenomes-Tr; EBT00001709616.
DR   EnsemblGenomes-Tr; EBT00001709617.
DR   EnsemblGenomes-Tr; EBT00001709618.
DR   EnsemblGenomes-Tr; EBT00001709619.
DR   EnsemblGenomes-Tr; EBT00001709620.
DR   EnsemblGenomes-Tr; EBT00001709621.
DR   EnsemblGenomes-Tr; EBT00001709622.
DR   EnsemblGenomes-Tr; EBT00001709623.
DR   EnsemblGenomes-Tr; EBT00001709624.
DR   EnsemblGenomes-Tr; EBT00001709625.
DR   EnsemblGenomes-Tr; EBT00001709626.
DR   EnsemblGenomes-Tr; EBT00001709627.
DR   EnsemblGenomes-Tr; EBT00001709628.
DR   EnsemblGenomes-Tr; EBT00001709629.
DR   EnsemblGenomes-Tr; EBT00001709630.
DR   EnsemblGenomes-Tr; EBT00001709631.
DR   EnsemblGenomes-Tr; EBT00001709632.
DR   EnsemblGenomes-Tr; EBT00001709633.
DR   EnsemblGenomes-Tr; EBT00001709634.
DR   EnsemblGenomes-Tr; EBT00001709635.
DR   EnsemblGenomes-Tr; EBT00001709636.
DR   EnsemblGenomes-Tr; EBT00001709637.
DR   EnsemblGenomes-Tr; EBT00001709638.
DR   EnsemblGenomes-Tr; EBT00001709639.
DR   EnsemblGenomes-Tr; EBT00001709640.
DR   EnsemblGenomes-Tr; EBT00001709641.
DR   EnsemblGenomes-Tr; EBT00001709642.
DR   EnsemblGenomes-Tr; EBT00001709643.
DR   EnsemblGenomes-Tr; EBT00001709644.
DR   EnsemblGenomes-Tr; EBT00001709645.
DR   EnsemblGenomes-Tr; EBT00001709646.
DR   EnsemblGenomes-Tr; EBT00001709647.
DR   EnsemblGenomes-Tr; EBT00001709648.
DR   EnsemblGenomes-Tr; EBT00001709649.
DR   EnsemblGenomes-Tr; EBT00001709650.
DR   EnsemblGenomes-Tr; EBT00001709651.
DR   EnsemblGenomes-Tr; EBT00001709652.
DR   EnsemblGenomes-Tr; EBT00001709653.
DR   EnsemblGenomes-Tr; EBT00001709654.
DR   EnsemblGenomes-Tr; EBT00001709655.
DR   EnsemblGenomes-Tr; EBT00001709656.
DR   EnsemblGenomes-Tr; EBT00001709657.
DR   EnsemblGenomes-Tr; EBT00001709658.
DR   EnsemblGenomes-Tr; EBT00001709659.
DR   EnsemblGenomes-Tr; EBT00001709660.
DR   EnsemblGenomes-Tr; EBT00001709661.
DR   EnsemblGenomes-Tr; EBT00001709662.
DR   EnsemblGenomes-Tr; EBT00001709663.
DR   EnsemblGenomes-Tr; EBT00001709664.
DR   EnsemblGenomes-Tr; EBT00001709665.
DR   EnsemblGenomes-Tr; EBT00001709666.
DR   EnsemblGenomes-Tr; EBT00001709667.
DR   EnsemblGenomes-Tr; EBT00001709668.
DR   EnsemblGenomes-Tr; EBT00001709669.
DR   EnsemblGenomes-Tr; EBT00001709670.
DR   EnsemblGenomes-Tr; EBT00001709671.
DR   EnsemblGenomes-Tr; EBT00001709672.
DR   EnsemblGenomes-Tr; EBT00001709673.
DR   EnsemblGenomes-Tr; EBT00001709674.
DR   EnsemblGenomes-Tr; EBT00001709675.
DR   EnsemblGenomes-Tr; EBT00001709676.
DR   EnsemblGenomes-Tr; EBT00001709677.
DR   EnsemblGenomes-Tr; EBT00001709678.
DR   EnsemblGenomes-Tr; EBT00001709679.
DR   EnsemblGenomes-Tr; EBT00001709680.
DR   EnsemblGenomes-Tr; EBT00001709681.
DR   EnsemblGenomes-Tr; EBT00001709682.
DR   EnsemblGenomes-Tr; EBT00001709683.
DR   EnsemblGenomes-Tr; EBT00001709684.
DR   EnsemblGenomes-Tr; EBT00001709685.
DR   EnsemblGenomes-Tr; EBT00001709686.
DR   EnsemblGenomes-Tr; EBT00001709687.
DR   EnsemblGenomes-Tr; EBT00001709688.
DR   EnsemblGenomes-Tr; EBT00001709689.
DR   EnsemblGenomes-Tr; EBT00001709690.
DR   EnsemblGenomes-Tr; EBT00001709691.
DR   EnsemblGenomes-Tr; EBT00001709692.
DR   EnsemblGenomes-Tr; EBT00001709693.
DR   EnsemblGenomes-Tr; EBT00001709694.
DR   EnsemblGenomes-Tr; EBT00001709695.
DR   EnsemblGenomes-Tr; EBT00001709696.
DR   EnsemblGenomes-Tr; EBT00001709697.
DR   EnsemblGenomes-Tr; EBT00001709698.
DR   EnsemblGenomes-Tr; EBT00001709699.
DR   EnsemblGenomes-Tr; EBT00001709700.
DR   EnsemblGenomes-Tr; EBT00001709701.
DR   EnsemblGenomes-Tr; EBT00001709702.
DR   EnsemblGenomes-Tr; EBT00001709703.
DR   EnsemblGenomes-Tr; EBT00001709704.
DR   EnsemblGenomes-Tr; EBT00001709705.
DR   EnsemblGenomes-Tr; EBT00001709706.
DR   EnsemblGenomes-Tr; EBT00001709707.
DR   EnsemblGenomes-Tr; Mext_R0001-1.
DR   EnsemblGenomes-Tr; Mext_R0002-1.
DR   EnsemblGenomes-Tr; Mext_R0003-1.
DR   EnsemblGenomes-Tr; Mext_R0004-1.
DR   EnsemblGenomes-Tr; Mext_R0005-1.
DR   EnsemblGenomes-Tr; Mext_R0006-1.
DR   EnsemblGenomes-Tr; Mext_R0007-1.
DR   EnsemblGenomes-Tr; Mext_R0008-1.
DR   EnsemblGenomes-Tr; Mext_R0009-1.
DR   EnsemblGenomes-Tr; Mext_R0010-1.
DR   EnsemblGenomes-Tr; Mext_R0011-1.
DR   EnsemblGenomes-Tr; Mext_R0012-1.
DR   EnsemblGenomes-Tr; Mext_R0013-1.
DR   EnsemblGenomes-Tr; Mext_R0014-1.
DR   EnsemblGenomes-Tr; Mext_R0015-1.
DR   EnsemblGenomes-Tr; Mext_R0016-1.
DR   EnsemblGenomes-Tr; Mext_R0017-1.
DR   EnsemblGenomes-Tr; Mext_R0018-1.
DR   EnsemblGenomes-Tr; Mext_R0019-1.
DR   EnsemblGenomes-Tr; Mext_R0020-1.
DR   EnsemblGenomes-Tr; Mext_R0021-1.
DR   EnsemblGenomes-Tr; Mext_R0022-1.
DR   EnsemblGenomes-Tr; Mext_R0023-1.
DR   EnsemblGenomes-Tr; Mext_R0024-1.
DR   EnsemblGenomes-Tr; Mext_R0025-1.
DR   EnsemblGenomes-Tr; Mext_R0026-1.
DR   EnsemblGenomes-Tr; Mext_R0027-1.
DR   EnsemblGenomes-Tr; Mext_R0028-1.
DR   EnsemblGenomes-Tr; Mext_R0029-1.
DR   EnsemblGenomes-Tr; Mext_R0030-1.
DR   EnsemblGenomes-Tr; Mext_R0031-1.
DR   EnsemblGenomes-Tr; Mext_R0032-1.
DR   EnsemblGenomes-Tr; Mext_R0033-1.
DR   EnsemblGenomes-Tr; Mext_R0034-1.
DR   EnsemblGenomes-Tr; Mext_R0035-1.
DR   EnsemblGenomes-Tr; Mext_R0036-1.
DR   EnsemblGenomes-Tr; Mext_R0037-1.
DR   EnsemblGenomes-Tr; Mext_R0038-1.
DR   EnsemblGenomes-Tr; Mext_R0039-1.
DR   EnsemblGenomes-Tr; Mext_R0040-1.
DR   EnsemblGenomes-Tr; Mext_R0041-1.
DR   EnsemblGenomes-Tr; Mext_R0042-1.
DR   EnsemblGenomes-Tr; Mext_R0043-1.
DR   EnsemblGenomes-Tr; Mext_R0044-1.
DR   EnsemblGenomes-Tr; Mext_R0045-1.
DR   EnsemblGenomes-Tr; Mext_R0046-1.
DR   EnsemblGenomes-Tr; Mext_R0047-1.
DR   EnsemblGenomes-Tr; Mext_R0048-1.
DR   EnsemblGenomes-Tr; Mext_R0049-1.
DR   EnsemblGenomes-Tr; Mext_R0050-1.
DR   EnsemblGenomes-Tr; Mext_R0051-1.
DR   EnsemblGenomes-Tr; Mext_R0052-1.
DR   EnsemblGenomes-Tr; Mext_R0053-1.
DR   EnsemblGenomes-Tr; Mext_R0054-1.
DR   EnsemblGenomes-Tr; Mext_R0055-1.
DR   EnsemblGenomes-Tr; Mext_R0056-1.
DR   EnsemblGenomes-Tr; Mext_R0057-1.
DR   EnsemblGenomes-Tr; Mext_R0058-1.
DR   EnsemblGenomes-Tr; Mext_R0059-1.
DR   EnsemblGenomes-Tr; Mext_R0060-1.
DR   EnsemblGenomes-Tr; Mext_R0061-1.
DR   EnsemblGenomes-Tr; Mext_R0062-1.
DR   EnsemblGenomes-Tr; Mext_R0063-1.
DR   EnsemblGenomes-Tr; Mext_R0064-1.
DR   EnsemblGenomes-Tr; Mext_R0065-1.
DR   EnsemblGenomes-Tr; Mext_R0066-1.
DR   EnsemblGenomes-Tr; Mext_R0067-1.
DR   EnsemblGenomes-Tr; Mext_R0068-1.
DR   EnsemblGenomes-Tr; Mext_R0069-1.
DR   EnsemblGenomes-Tr; Mext_R0070-1.
DR   EnsemblGenomes-Tr; Mext_R0071-1.
DR   EnsemblGenomes-Tr; Mext_R0072-1.
DR   EnsemblGenomes-Tr; Mext_R0073-1.
DR   EnsemblGenomes-Tr; Mext_R0074-1.
DR   EnsemblGenomes-Tr; Mext_R0075-1.
DR   EuropePMC; PMC2408644; 18474084.
DR   EuropePMC; PMC3621897; 23593113.
DR   EuropePMC; PMC4161386; 25211235.
DR   EuropePMC; PMC5585157; 28919881.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00435; ROSE.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000908.
DR   SILVA-SSU; CP000908.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003779
CC   Source DNA and bacteria available from Chris Marx
CC   (cmarx@oeb.harvard.edu)
CC   Contacts: Chris Marx (cmarx@oeb.harvard.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5471154
FT                   /organism="Methylorubrum extorquens PA1"
FT                   /strain="PA1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:419610"
FT   gene            44..1549
FT                   /locus_tag="Mext_0001"
FT   CDS_pept        44..1549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: nwi:Nwi_0001 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28430"
FT                   /db_xref="GOA:A9W767"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A9W767"
FT                   /protein_id="ABY28430.1"
FT                   /translation="MHLDGSMSDGDGGNGRGSVDLPAAWTRVKRRLRAELGEDVFASWF
FT                   ARLELETVDGGVARLTVPTRFLKSWIESHYIDRVLTTFRAEADGVSRIEVGVRGPSGPA
FT                   RPSAGVPAKPNATSGPLNRLHAIATPAALQGPGPMIETEIASPRGDSASVDLNGAPLDA
FT                   RLSFANFVVGRSNALAHAAAERIARSDSDGALYNPLYVHAGVGLGKTHLLHAAGHAARE
FT                   AGRRVIYLTADRFMYGFVNALKTQNALAFKERLRAIDLLILDDVQFIQGKSIQTEFGHT
FT                   LNALIDSGRQVVVASDRPPTELEALDERVRSRLAGGLVVEIGGLDEGLRASILSARLDA
FT                   VRQSHPNFEVSPAVSAYVARAITANGRDLEGAVNRLLAHATLTGAPVTVETAETAIRDL
FT                   VKNREPKRVKIEDIQKLVASRYNVSRSDILSERRTAAVVKPRQIAMYLSKVLTLRSLPE
FT                   IGRRFGGRDHTTVLHAVRKIEKQIGEDAVLGDEVELLKRMLQD"
FT   gene            1870..2991
FT                   /locus_tag="Mext_0002"
FT   CDS_pept        1870..2991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: xau:Xaut_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28431"
FT                   /db_xref="GOA:A9W768"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A9W768"
FT                   /protein_id="ABY28431.1"
FT                   /translation="MRVTVERAALLKSLGHVHRVVERRNTIPILSNVLLRTGENGLQLK
FT                   ATDLDIEVTETVAADVLDAGATTVPAHVIYDIVRKLPEGAQVSLETSGETGQMTIRSGR
FT                   SRFALGALPEGDFPDLAAGELPHSFAIPAAELKQLIEKTQFAISTEETRYYLNGIYFHT
FT                   LEVEGALKLRAVATDGHRLARVETDAPEGSRGMPGIIVPRKAVAEIQKLVDDGGESVQV
FT                   ELSPAKIRLTFAGGVILISKLIDGTFPDYQRVIPTGNDKRLTVERDAFAKAVDRVSTIS
FT                   SERGRAVKLAVSEGRLALSVTNPDAGSATEELDVDYEASALDIGFNARYLLDITAQLQG
FT                   DTALFKLADPGSPTLIQDRDGAPALYVLMPMRV"
FT   gene            3032..4186
FT                   /locus_tag="Mext_0003"
FT   CDS_pept        3032..4186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: rpb:RPB_0004 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28432"
FT                   /db_xref="GOA:A9W769"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A9W769"
FT                   /protein_id="ABY28432.1"
FT                   /translation="MDILPGGPRLTRLIARDFRNHVDLDLATTRRFVALVGENGAGKTN
FT                   ILEAVSLFCPGRGLRRADLATMARVGGPGGFAVSATLEASEAEHRFGSGYEPPGYDGRG
FT                   TRVCRIDGANAPSPVAFSEFLRIVWLTPDFDGLFRGAAGDRRRFLDRLVLAVDAGHGAR
FT                   VSAMERALRSRNRLLDERPDDGRWLDAVEREVAELGVAVALARRETVERLDRLIAETRD
FT                   DAAPFPWASLRLEGDLDDLVAVWPALEAEDRFRRALMQGRHRDRAAGRTLIGPQTTDLV
FT                   VRHGPKDVPAATASTGEQKALLIGLVLAHARLVRAMSGLAPLILLDEVAAHLDPRRRGG
FT                   LFDALEALEGQVWMTGADPALFAELEGRADLIGVADGRLVPAGA"
FT   gene            complement(4190..4594)
FT                   /locus_tag="Mext_0004"
FT   CDS_pept        complement(4190..4594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0004"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   xau:Xaut_4793 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28433"
FT                   /db_xref="GOA:A9W770"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A9W770"
FT                   /protein_id="ABY28433.1"
FT                   /translation="MFVDASAIIAIIAREPQAETLTARLEEAPVRYTSAVAVLETVMAL
FT                   RRLGAGSIAQAEQLVRHLLEHADIEEVPITTRESAAAIAAYARYGKGQGHPAQLNLGDC
FT                   FAYACARTRNVPLLFVGNDFSQTDIAAALA"
FT   gene            complement(4594..4833)
FT                   /locus_tag="Mext_0005"
FT   CDS_pept        complement(4594..4833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0005"
FT                   /product="Rv0623 family protein transcription factor"
FT                   /note="PFAM: Rv0623 family protein transcription factor;
FT                   KEGG: acr:Acry_3269 Rv0623 family protein transcription
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28434"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:A9W771"
FT                   /protein_id="ABY28434.1"
FT                   /translation="MPLNIRSEEVNRLAEKLASQARVSKTEAVRMALANELQRRESSLP
FT                   LSERIKPIQDAFARWPKTGMKADKAFFDDMNGES"
FT   gene            4936..6783
FT                   /locus_tag="Mext_0006"
FT   CDS_pept        4936..6783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0006"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: rru:Rru_A0089 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28435"
FT                   /db_xref="GOA:A9W772"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9W772"
FT                   /protein_id="ABY28435.1"
FT                   /translation="MTARLDEARAALKKTFGYDDFRPGQDEVIGAVLDGTDVFAVMPTG
FT                   SGKSMTYQLPALVDAGLTVVVSPLIALMHDQVQQMHAFGIEAATLNSTIAETASRETWR
FT                   KIRSGELRLLFVSPERLLMDGCMEALRGAGVRRLAVDEAHCVSQWGHDFRPEYREIARA
FT                   REALGNVQTLALTATADAATRAEIAERLFPAGRPPRTFVHSFDRPNIRLTFQPKDNPTR
FT                   QLERFLRDRRAESGIIYCSSRKRVEQLADTLKGDGFNALPYHAGLDQVTRARNQDTFLQ
FT                   EDGVVMTATIAFGMGINKPDVRYVCHSDMPTNIEGYYQEIGRAGRDGLPSDTLTLYGLD
FT                   DMALRRRQIDEKEISEERRRVERRKLEAMIALCEGAACRRQSLLGYFGEASERCGRCDL
FT                   CRGGIALIDGTVAAQKLLSAIVRTGQRFGAAYVCDVVHGKESESIRRNGHAALKTFGVG
FT                   NDKPVAAWRALLRQLFAAGAVAENTDGYGGLVMTEKGEAILFGRETIEVRPDPEPKKAE
FT                   PRSRRATPRDDEANALSEADEALFQHLRGLRATIARAEGIAAFMVFPDRTLIEMARSKP
FT                   VDLWALRTVHGVGERKREAYGERFTDTIREFLADAKRAG"
FT   gene            complement(6841..7179)
FT                   /locus_tag="Mext_0007"
FT   CDS_pept        complement(6841..7179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28436"
FT                   /db_xref="UniProtKB/TrEMBL:A9W773"
FT                   /protein_id="ABY28436.1"
FT                   /translation="MIKSIFAFAVAGLVALPAVAMAIDYAFRLHNRAEGYSITGFYTYQ
FT                   NGRWSRNWIGGSINPGQSASLDWNSNDGDCVVPFRVKWRDYGSDDFKLDWCKGVSNVYM
FT                   KDKGFTYD"
FT   sig_peptide     complement(7111..7179)
FT                   /locus_tag="Mext_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.735 at
FT                   residue 23"
FT   gene            7495..8181
FT                   /locus_tag="Mext_0008"
FT   CDS_pept        7495..8181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28437"
FT                   /db_xref="UniProtKB/TrEMBL:A9W774"
FT                   /protein_id="ABY28437.1"
FT                   /translation="MRTADKQIADILVRFGEPFAGNVWRVQGTAVIYHKTLERIAAHTK
FT                   IRFDPPTLLRSERDEAVILVTGHMPGEKAGEERVEWSIGEALVNVNYRVSGRQAAYVYA
FT                   MAEKRAKDRVILKLIELHGLVYSEEEADEFRQNQPMAIRAVDEDFDAPPAFDEVTEQEA
FT                   DLKRLIDEAESINAVTDLMLDERTQGILNAMPHGTREEVRDYAKARLRALGWPPAKKGG
FT                   RGSRAA"
FT   gene            8303..10504
FT                   /locus_tag="Mext_0009"
FT   CDS_pept        8303..10504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0009"
FT                   /product="helicase, RecD/TraA family"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: acr:Acry_3541 helicase, RecD/TraA family;
FT                   TIGRFAM: helicase, RecD/TraA family; SMART:
FT                   Helix-hairpin-helix DNA-binding class 1; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28438"
FT                   /db_xref="GOA:A9W775"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:A9W775"
FT                   /protein_id="ABY28438.1"
FT                   /translation="MNTSVRPSDLDCGTPLDMLAGSVERVTFHSAETGFCVLKIHARGR
FT                   RDLVPVVGHAPAIAAGEWLTASGRWVTDREHGLQFRADTLQVTPPTGIEGIERYLASGQ
FT                   MRGIGPMMAKRIVACFGEAVFEIIEAEPARLTEVEGIGRKRAARIVKGWAEQKAVREIM
FT                   IFLHAHGVGTARATRIFRTYGGDSLKVMAEDPYRLARDIRGIGFRTADAIALRLGLARD
FT                   APQRLAAGVSYALQTAMDEGHCGLPVERLVRLAAELLDVAPDLVRLAAALVLREGREVV
FT                   ADTLRGEPCLFLKGLHGAERVIAMRLAERAAGLPPWAAIDFALARPWVEAKTGKTLSAS
FT                   QAEAVGLVLRSKLCVLTGGPGVGKTSTLDAILRILTAKGVRVLLAAPTGRAAKRMAEQT
FT                   GLEARTLHRLLEIDPRNGGFQRNEDNPLDCDLLVIDETSMVDVPLMHALLKAVPERAGL
FT                   ILVGDVDQLPSVGPGQVLADVIASGTVPVARLTEIFRQAAQSRIVVNAHSINTGRMPAA
FT                   PAKGEDSDFYLVEIEDADEGVETLIELVTRRIPRRFGLDPTRDIQVLTPMIRGSLGSRN
FT                   LNNALQRVLNPSPSAEVERFGWRFAPGDRVMETRNDYDRDVFNGDLGTISAIDAEDEAL
FT                   VVDFDGRAVIYPFNELDTLVPAFATTIHKAQGSEYPAVVIPVVTQHRTMLARNLLYTGV
FT                   TRGRRLVVLIGQRRALAMAVREGTSRRRWTKLREWLDAA"
FT   gene            10657..11832
FT                   /locus_tag="Mext_0010"
FT   CDS_pept        10657..11832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_1822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28439"
FT                   /db_xref="GOA:A9W776"
FT                   /db_xref="UniProtKB/TrEMBL:A9W776"
FT                   /protein_id="ABY28439.1"
FT                   /translation="MFYLPGFDPREPETYWGLFRRESRITAELRGMAIAVGDPVRSADG
FT                   ISLDWDVDSQVEGEATRVRYSLLRWDDIVRDRFPRSNLRRLVSLPGLWWRLWRSGYLRK
FT                   FQREARRFYRVIVSVHQFYVVFVLASLALAVAAVTLTPLAALPTLAGIALVPLLAYATL
FT                   TLVTHLTRGKPLYVTHLVDDTAFTHDHASGRETAMRERLGPWAERIRAAEGRASEIVVI
FT                   GHSSSSFLAFECLDRILKADPEFGRRGTPVTLVTIGSVIPWLTLDPLAEEARGSLGRIG
FT                   GDTAIGWLDIRASWDWLSIHLRDPVSASGLPAPPPGRFAVMRVEIEDLIEPALVARRRW
FT                   NLFRMHFQLLMSSRDRKAFDYVAFVAGPEPVHAAVERCRTQRPATVSAEFT"
FT   gene            12023..14248
FT                   /locus_tag="Mext_0011"
FT   CDS_pept        12023..14248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0011"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: bra:BRADO2785
FT                   phosphoribosylformylglycinamidine synthase II (FGAM
FT                   synthase II); TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28440"
FT                   /db_xref="GOA:A9W777"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A9W777"
FT                   /protein_id="ABY28440.1"
FT                   /translation="MFRNDVPITPELVRQHGLTPDEYERFRALVGREPTLTELGIVSAM
FT                   WNEHCSYKSSRKHLRGLPTSGPHVIQGPGENAGVIDIGDGLACVFKMESHNHPSFIEPY
FT                   QGAATGVGGILRDVFTMGARPIAALNALRFGSPDHPRTRHLVSGVVAGVGGYGNSFGVP
FT                   TVGGLVGFHRRYDGNILVNAMAVGLARTDAIFYAAATGVGNPIVYLGSKTGRDGIHGAT
FT                   MASAEFDESSESKRPTVQVGDPFAEKLLLEACLELMASGAVIAIQDMGAAGLTCSAVEM
FT                   GAKGDLGVELHLEKVPTREEGMTPYEMMLSESQERMLMVLKPGMEAEAQAIFVKWGLDF
FT                   AVIGHTTDTLRFVIKHNGETVADLPIKELGDEAPLYDRPHIANTHQPVIAAASVEASVP
FT                   NAEALKRLVGSPELASKRWVYEQYDHFILGNTVQKPGGDAAIVRVEDGPKGLAISTDVT
FT                   PRYCEADPVEGGRQAVAEAWRNITAVGARPLAITDNLNFGNPEKPEVMGQLVGCLKGIG
FT                   EACLALDFPVVSGNVSLYNETNGVGILPTPTIGGVGVIDDVECHATVALKREGDVLVLI
FT                   GRTEGWLGQSLYLSEIAGREEGAPPPVDLAIERRNGDFVRSLIVSGIADTVHDLSDGGL
FT                   AVALAEMAMAGGLGAALPAAPEGVPVHAYLFGEDQGRYLIAVPAEAAADLLYSASAQGI
FT                   DAATVGIVAGDSLVLPGEETISVAELKAAHEGWFPAYMASQPAAPAA"
FT   gene            14276..14512
FT                   /locus_tag="Mext_0012"
FT   CDS_pept        14276..14512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0012"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: rpb:RPB_3710
FT                   BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28441"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A9W778"
FT                   /protein_id="ABY28441.1"
FT                   /translation="MPMDAREIESMIREALPDAHVEIKDLAGDGDHYAATVISAAFKGK
FT                   TRVAQHQMVYGALQGRMGGVLHALALTTGVPQD"
FT   gene            14586..14921
FT                   /locus_tag="Mext_0013"
FT   CDS_pept        14586..14921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0013"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: ret:RHE_CH02304 glutaredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28442"
FT                   /db_xref="GOA:A9W779"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9W779"
FT                   /protein_id="ABY28442.1"
FT                   /translation="MTDVNSTIKNEIDSQDVVVFMKGTPQFPMCGFSGQVVQILNYLGV
FT                   PFKGVNVLDDMAVREGIKAFSNWPTIPQIYVKGEFVGGCDIAREMFQSGELQQFLSEKG
FT                   VPVKSAA"
FT   gene            14994..15896
FT                   /locus_tag="Mext_0014"
FT   CDS_pept        14994..15896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0014"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   pna:Pnap_4563 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28443"
FT                   /db_xref="GOA:A9W780"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9W780"
FT                   /protein_id="ABY28443.1"
FT                   /translation="MHDVIIVGGGPAGLNAALILGRARRTVLLCDASQPRNAATPLTWG
FT                   LFTRDGTPPFDLRAKGRADLDRYETVECRDVAVTEAARDADGFTIIQADGTVERARRLI
FT                   LATGLAQDIPEIEGFDTYWGTGVHSCPYCDGFEVRDRPLVVYGRGHGGCGLALELTGWS
FT                   QDVTLCTSGHDGDLSDKDRDRLARNGVRVIEAEIERLEGDGSRPTCLRFRDGSQTPCTA
FT                   LFLMPFACSPSPLITQLGCELDETRSVVPTREYEKTNVPGLYVAGDASRRVQFAVVAAA
FT                   EGAMAAFAINAEFVAEATR"
FT   gene            16005..16889
FT                   /locus_tag="Mext_0015"
FT   CDS_pept        16005..16889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0015"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: mes:Meso_3700 SMP-30/gluconolaconase/LRE-like region"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28444"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:A9W781"
FT                   /protein_id="ABY28444.1"
FT                   /translation="MTPPVHPHTPRVAVACCCTLGEEVVWDARDGSLLWVDIENPAIWR
FT                   HWPASGETVRLPLDEKIGFAVLTPDPDRVVAGFKSGVAALRLSDGSRTPLVRPDDYPAG
FT                   NRLNSGNAGPDGWLYFGSMDDAEEAETGGFHRWDGARVETFGSRAAVTNGPVVSPDGRR
FT                   VYTIDTANGLVQVHALEDGRIGEARPLIRFEEGWGKPDGLTLDAEDHLWICHYGAGRIT
FT                   RFDPDGHVAYVVPMPTPLVTKCAFGGEDLSTLYVTTCLRGRDPTLEPMAGHLYKVETGF
FT                   RGFPANLLALPQT"
FT   gene            17075..17290
FT                   /locus_tag="Mext_0016"
FT   CDS_pept        17075..17290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28445"
FT                   /db_xref="UniProtKB/TrEMBL:A9W782"
FT                   /protein_id="ABY28445.1"
FT                   /translation="MPVFDGKYLTEHGESEALLAMILRPTPKAREEALERGRMRLERAT
FT                   MLAELAPAVPGTTLAAVKRADILPVD"
FT   gene            complement(17318..18154)
FT                   /locus_tag="Mext_0017"
FT   CDS_pept        complement(17318..18154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpa:RPA1577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28446"
FT                   /db_xref="UniProtKB/TrEMBL:A9W783"
FT                   /protein_id="ABY28446.1"
FT                   /translation="MPETIEPRKGATGQPIAQPSPVEMLKQAVAGGPKAAAKATPPAAV
FT                   PTRKAFHLGANGRLAAASVAALVGGVCLGLVAAPQERSGAALAQVQAEFSAGRSEAARF
FT                   AQEIDRLARTVTALRDASEAARGDTKALGHTVTDRLSRTEQTLDKRLANFTETVARVER
FT                   DQAERLTSAIAQWEKKLQPVAAAAPAKSEAKPETRAAEPTQTGSLPDKPKSDTLEGWAL
FT                   RDVYDGVAVLEDRRRRLVEVGRGDAVPGIGRVEAIERRGRQWVVVTRQGVITPQAW"
FT   gene            complement(18512..20557)
FT                   /locus_tag="Mext_0018"
FT   CDS_pept        complement(18512..20557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0018"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; SMART: PAC
FT                   repeat-containing protein; KEGG: pst:PSPTO_2717 sensory box
FT                   histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28447"
FT                   /db_xref="GOA:A9W784"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9W784"
FT                   /protein_id="ABY28447.1"
FT                   /translation="MSSTEERVLILTPRGRDAAVIEGVLDRSGIHATVCANVAAWLTGL
FT                   REGAGTALVTEEALADGDTADVFAWLDAQQPWSDFPFIVLATRQAGRRTQSAAELLRRL
FT                   GNVVLLERPINAETLTSAVVSSLRARRRQYQARQHLLERERAQEQLRLANEELERRVAE
FT                   RTREVETAHETLAFALDAAGMSSWDIDYVAGTHRRSPRFDAVFGYAGTGQSWDRETFLA
FT                   HVVDEDRETAEDAFANVPKTGRLDLECRIRRADGAVRWIAMRGRVKSGEADRPERIAGI
FT                   LMDRTDKHVTEEALRQAQKMEAIGQLTGGVAHDFNNLLTVIVGGLDMMLRRPDQPDRVK
FT                   RLAEAAMGAARRGEQLTQQLLAFSRRQMLRPQTLNPNRLLLDFRPLAERAATGAVELAF
FT                   DLDPALDPIRIDPAQFESAVLNLIVNARDALEGRGGHARIAVTSRNVRLGTAAVADRGV
FT                   PPGPYVVISVTDTGSGIPPDKLQRVFEPFFTTKEVGKGTGLGLSQVYGFTRSAKGFAQI
FT                   ESEVGKGTTVSLYFPRSTDPAGEEIGPGPVGAIPLRRAGEGETVLLVEDDEQVLGMAVE
FT                   SLEELRYRVIVTRNAAEALEHLHGVERIDILFSDVVMPGGMNGSQLAVEARRVRPDIKI
FT                   LLTSGYVANLDEGQVIGQGELPVLNKPYRRDELARSLRLVLGGERA"
FT   gene            complement(20557..22119)
FT                   /locus_tag="Mext_0019"
FT   CDS_pept        complement(20557..22119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0019"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: bxe:Bxe_B2609 hypothetical protein; PFAM:
FT                   Circadian clock protein KaiC central region; KaiA binding;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28448"
FT                   /db_xref="GOA:A9W785"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:A9W785"
FT                   /protein_id="ABY28448.1"
FT                   /translation="MGHNSTGAASEPMNEAMSTTSTRSGSETRISTGISGLDEVLCGGL
FT                   TPDRLYLLEGTPGTGKTTLALQFLLEGAARKGRSLYVTLSETADELRAAALSHGWSLDG
FT                   IELYELVNEMGLDPDSEQSILHPSEIELGETVREVMARVESLKPERVVFDSLSELRLLA
FT                   QNPLRYRRQILALKQFFAKRACTVLMLDDRTSEAGDLQLHSIAHGVISLDQNPREFGSE
FT                   RRRLRIVKMRGIKFRGGYHDFVLETGGVQVFPRLIAAEHRATFDPTAQSTGSDELDLLL
FT                   GGGLVPGTNTLLLGPSGVGKTTTGLRCMLAALERGETATYYLFDEGLATMIARATLLGM
FT                   DLRPHLGTGRLTIMQIDPAELSPGEFAAIVRQAVEERGSTFVAVDSLNAYLHAMPGEEH
FT                   LILQMHELLSYLNQKGVTTLLVLGQHGVIGEVRTDIDLSYLSDCILLFRFFEASGEIRT
FT                   ALSVVKSRVNPHERTIRELRLSTDGLRVGEALSDFEGVLTGLPAYRGRVEMLKGPRETG
FT                   DGA"
FT   gene            22475..23674
FT                   /locus_tag="Mext_0020"
FT   CDS_pept        22475..23674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28449"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:A9W786"
FT                   /protein_id="ABY28449.1"
FT                   /translation="MNGAYGPEERALVLERQRTLKMAQSAHAYVRGNTLKFYEWLEGLT
FT                   RGTLPEGPPVWICGDCHLGNLGPLADADGRVDIQIRDLDQTVIGNPTHDLVRLGLSLAS
FT                   AARGSDLPGVVTARMLEQMLLGYAAGLGQNETNREPSEPDAVRSVRRRALGRHWKHLAR
FT                   ERLKGVEPAIPLGRKFWKLDTEEREALDGVFQEDAVRHLVLALNGRSDEAEIRLIDAAY
FT                   WMKGCSSLGFLRYAALVGITEPGNKRRLALVDLKEAVAPAAPTAPGVAMPSEPAERVVA
FT                   GARALSPNLGERMLPVRLLGKSAVMRELAPQDLKLDVDQFGREEAVRAAHYLAHVVGKA
FT                   HGRQMDAETRAAWRTEITRGNDVDEGAPSWLWSSVVELAGRHEVGYLQHCRRYVGQEAA
FT                   "
FT   gene            complement(23704..24702)
FT                   /locus_tag="Mext_0021"
FT   CDS_pept        complement(23704..24702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0021"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: pla:Plav_3507 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28450"
FT                   /db_xref="GOA:A9W787"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9W787"
FT                   /protein_id="ABY28450.1"
FT                   /translation="MGHKPLNEQVIVITGASSGIGLATARMAARRGARVVLAARSEDVL
FT                   ADIAAEFGTRATYVVADVGRREDVQAIADHAVATFGGFDTWVNVAGLTVYGPLRKIALE
FT                   DHERLIQTNLWGTVYGSLIAAKHLRGRGGAIVNVGSIASDLAFPFQGLYATSKHAVKGF
FT                   TDTLRMELIAEGAPVSVTLVKPASIDTPLPNRARNYMDREPTLPPPIYPPKEVANAILH
FT                   AAVHPQRDIFVGGGGKLFVMGKEFAPGAYDELASAIIAQQKRTEPPRNPKGALHAPQGA
FT                   GRERGDPPIYVMRSSAYTRATLHPLATAGLAAGLAATAALVLGGKSARRRP"
FT   gene            complement(24825..25511)
FT                   /locus_tag="Mext_0022"
FT   CDS_pept        complement(24825..25511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0022"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: rle:RL2913 putative GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28451"
FT                   /db_xref="GOA:A9W788"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9W788"
FT                   /protein_id="ABY28451.1"
FT                   /translation="MGEGNAMDGMAEGRGLLSDQIRNALTDEIASGVLAAGIALDEQDL
FT                   ADRFGASRTPVREALRQLASSGLVEMRPRRGVVVTRMTPERIMEMFETTAEFEALCVRL
FT                   ATYRMTPLELSALMDLHEQSAEPVAAQDYDTYDALNRAFHEALYRGTHNGFMAEQALAI
FT                   RSRLSAFRRTQLRQGERILRSRAEHGEILQAIAEGDGDAAARRMRAHMLNAASALGRYV
FT                   ADHASD"
FT   gene            complement(25517..25888)
FT                   /pseudo
FT                   /locus_tag="Mext_0023"
FT   gene            26161..27807
FT                   /locus_tag="Mext_0024"
FT   CDS_pept        26161..27807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0024"
FT                   /product="malonate decarboxylase, alpha subunit"
FT                   /note="TIGRFAM: malonate decarboxylase, alpha subunit;
FT                   KEGG: bur:Bcep18194_A4412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28452"
FT                   /db_xref="GOA:A9W789"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A9W789"
FT                   /protein_id="ABY28452.1"
FT                   /translation="MSGWGRERAARDARIEAGRAHAAGKVVTAADVVALLEAILQPGDR
FT                   VCLEGDNQKQADCLARGLSQCDPARVHDLHMVQSGIVLPEHLDIFEQGIAKRLDYSYSG
FT                   PQGARIARMLYGGQIELGAVHTYLELFARYFVDLTPNVALIAGVSADRDGNLYTGPNTE
FT                   DTPTVVEATAFKNGVVVAQVNEIVDRVPRVDIPGDRIDFVVQADKPFYVEPLFTRDPAA
FT                   MTETQILMAMMAIKGIYAEYGIRRLNHGIGFGTAAIELLLPTYAERLGLKGQIATHWAL
FT                   NPHPTLIPAIESGWVKQVHCFGSEVGMDRYIRERSDIFFTGADGSLRSNRAFCQTAGLY
FT                   ACDLFIGSTLQIDLAGHSSTVTQNRVAGFGGAPNMGSDPHGRRHPSDTWMKAGREAQVT
FT                   GDPALMRGRKLVVQIVETFGEGLVPAFVEQLDALELARKIGLELAPVMVYADDVTHIVT
FT                   EEGIANLLLCRTADEREQAIRGVAGYTEIGRGRDRAMVERLRQRGIVRRPEDLGIEPLD
FT                   ADRSLLAARSIKDLVHWSGGLYEPPAKFRNW"
FT   gene            27815..28123
FT                   /locus_tag="Mext_0025"
FT   CDS_pept        27815..28123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0025"
FT                   /product="malonate decarboxylase acyl carrier protein"
FT                   /note="TIGRFAM: malonate decarboxylase acyl carrier
FT                   protein; PFAM: malonate decarboxylase delta subunit; KEGG:
FT                   bte:BTH_I2802 malonate decarboxylase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28453"
FT                   /db_xref="GOA:A9W790"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:A9W790"
FT                   /protein_id="ABY28453.1"
FT                   /translation="MEKLSFRHTTQRALAGAKAQAITGVVASGNLEVLLERALAPTECT
FT                   VEIETPIRGYGEVWAAVVADFVARSQPGGLRITINDGGARPDTVSLRLLQGARLMEV"
FT   gene            28126..29058
FT                   /locus_tag="Mext_0026"
FT   CDS_pept        28126..29058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0026"
FT                   /product="malonate decarboxylase, beta subunit"
FT                   /note="TIGRFAM: malonate decarboxylase, beta subunit; KEGG:
FT                   bur:Bcep18194_A4414 acetyl-CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28454"
FT                   /db_xref="GOA:A9W791"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A9W791"
FT                   /protein_id="ABY28454.1"
FT                   /translation="MSERIIDPAAKAWATSWYEASARARLDGLLDAGSFREVIGPEQRR
FT                   MSPHLPLFDLPRAFDDGMIVGSGRLDGKPVLVAAQEGRFMGGAFGEVHGAKLVGLLRAA
FT                   LALKPDAVLILFDTGGVRLQEANAGETAIAEVMRAIVQLRAAGVPVIGLIGGRAGAYGG
FT                   GGLIAGTCSRLVVSEGGRISVSGPEVIETNKGAEEFDSRDRALVWRTMGGKHRRLTGGA
FT                   DAYADDTVAAFRQAALDQIGRAPAFDLATLEAEQARLEQRLTRFGDCRDATEIWARLGV
FT                   NDPEAVPALTTADFDTLLASLGETTHDAR"
FT   gene            29045..29761
FT                   /locus_tag="Mext_0027"
FT   CDS_pept        29045..29761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0027"
FT                   /product="malonate decarboxylase, gamma subunit"
FT                   /note="TIGRFAM: malonate decarboxylase, gamma subunit;
FT                   PFAM: malonate decarboxylase gamma subunit; KEGG:
FT                   bte:BTH_I2800 malonate decarboxylase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28455"
FT                   /db_xref="GOA:A9W792"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9W792"
FT                   /protein_id="ABY28455.1"
FT                   /translation="MTLAEILASLFPEGHSVTVAEGLVNGEGPFRGGRLAVIGIDGETA
FT                   LGVDGACRLAGHVLDVVRRGGATPILVAIDSDSQRMSRRDELLGLNEYLAHLAKTLLLA
FT                   DAKGHPTVGLIYGHSAAGAFIATALATRVLVGLPGANPSVMDLPSVARVTKLPLDRLEA
FT                   MAKDTPVFAPGLDNMVRTGAVQSVLDPERSLAEQIAAVIDALPTEDTRDRAGRERGGRP
FT                   VAEAIAAQVVREAAFG"
FT   gene            29754..30410
FT                   /locus_tag="Mext_0028"
FT   CDS_pept        29754..30410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_1273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28456"
FT                   /db_xref="GOA:A9W793"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/TrEMBL:A9W793"
FT                   /protein_id="ABY28456.1"
FT                   /translation="MVEAHRRHDLLDVEPGAWAAAVTARADLAGVPHVAAWVDDGRPVI
FT                   LRRSHPGEEVGLVPVGLPLPPRDGKRRIGLALPPDAVRPRAPVLLSEARAACPPSWAAT
FT                   IEALIALGERHGAAPRPFGSLLWQSLTGLPYLSERSDLDLLWPVPGAIPSRLMEGIAAI
FT                   EARAPMRLDGEILLPDGGGVNWRELHGAGPGTVLVKHRDRLALREAAALLTGDPE"
FT   gene            30407..31267
FT                   /locus_tag="Mext_0029"
FT   CDS_pept        30407..31267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0029"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase MdcB"
FT                   /EC_number="2.4.2.52"
FT                   /note="KEGG: bam:Bamb_1152 triphosphoribosyl-dephospho-CoA
FT                   synthase; TIGRFAM: triphosphoribosyl-dephospho-CoA synthase
FT                   MdcB; PFAM: triphosphoribosyl-dephospho-CoA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28457"
FT                   /db_xref="GOA:A9W794"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/TrEMBL:A9W794"
FT                   /protein_id="ABY28457.1"
FT                   /translation="MSPLAALRALSPWDDRCPAADAIARSAATALRLELETYPKPGLVS
FT                   HVDRGSHADMDADTFRASTAAITPFFRALALAGAAGAPMPALRRIGLEAEAAMRAATGG
FT                   VNTHRGAIFGLGLLCAAAGALKRPGAGALGALVCERYGSAILDGPVLLHAPGARARRRH
FT                   GVGGAPAEAAAGFPSLYRVALPALRRGRQCHPGDAEAARVEACLALIAHVEDTNLLHRG
FT                   GTEGFAFARSEAARFLIEGGVAQPRWRARAEALHRAFVTRNLSPGGAADLLAMTLFVES
FT                   VEASA"
FT   gene            31264..32187
FT                   /locus_tag="Mext_0030"
FT   CDS_pept        31264..32187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0030"
FT                   /product="acyl transferase domain protein"
FT                   /note="KEGG: bte:BTH_I2797 acyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28458"
FT                   /db_xref="GOA:A9W795"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:A9W795"
FT                   /protein_id="ABY28458.1"
FT                   /translation="MTLAVLLSGQGGQHRGMFDLTADWPAAAPVFAAAERVLGQDPRAF
FT                   VRTPGADLHGNRTGQILCCVAALAGWTLVQAAHPARTIVAGYSIGDLAAWGCAGRFDAE
FT                   TILRLAATRAEAMDAAAGDGAGLAGIRGLPIAATETLAAAQGCELAIRNASDSAVIGGP
FT                   SPALETLCVEALAAGALRAVVLPVRTPSHTPLLREASQRFEAALAGMQPMRPQPGAPRL
FT                   ISGLDGAPVFDVHAGLSKLARQISHTIDWAACLEACREYGCDTVLELGPGHALATMARN
FT                   AIPEARVHALDEFRSASGVTEWIGGR"
FT   gene            complement(32325..34709)
FT                   /locus_tag="Mext_0031"
FT   CDS_pept        complement(32325..34709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0031"
FT                   /product="general secretion pathway protein D"
FT                   /note="TIGRFAM: general secretion pathway protein D; PFAM:
FT                   type II and III secretion system protein; NolW domain
FT                   protein; KEGG: aav:Aave_4150 general secretion pathway
FT                   protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28459"
FT                   /db_xref="GOA:A9W796"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A9W796"
FT                   /protein_id="ABY28459.1"
FT                   /translation="MAIRAHVLALTFGLALGPSGAAFAAEPLPGLGYGPRPSGGFILRG
FT                   NDRFIAGEAPAAQALPGGLVSLNLVEAPLPNAAKAVLADTLGLGYTLDPQATGTVTLQT
FT                   GGAVTREALLQMFEAALASRGLVLRRRGRIAQIAPAATDPNAVRAVRGPAAEAGAVAMP
FT                   LRWVSAVEMQAILTSVAPRDVVLRADRARNLLILNGDATQIRALRQTIAMFDVDWMRGM
FT                   STAMLPVRSASPVTLARDMTQMFGGEAAGTGDVIRFIPNEALSAILVVSSRAVYLDRAR
FT                   VMLEQMEVLAAERERQLFVYRIQNRSARELAAVLQGVVAAETGAPVNVSSGSGAAQAGF
FT                   GGGFAQSAGAMPGGFAPGYGGPGGSGYGGSSGSAGLSGVGAPYGAGYGTETATGGAGGT
FT                   GAYGSTGSMPGTGSAGGMSPMGGAGMDGTGGLPAAYGAAPVAYGGGYGAETGMAGGYGG
FT                   AYGARRDAIGVVADEANNSLVISATRNQYDKILRILGRLDAMPTQVLLETVIAEVTLNN
FT                   ELQFGVQWFLKNSGSRFNLAQADTNRSVAQGTSGTDALIKAAARGVPGFNYLLNASDFN
FT                   VVLNALQGVTRVNVISSPNITVLDNRTAKLQVGDQVPIVRQSGQSAFAAGAPILNQIEM
FT                   KDTGVILSVTPRVNKNGLVVLDINQEVSDVVKTTTSEINSPTIRQRRVATSVAVNDGHS
FT                   LAIGGMVQEKAQITNESVPLLGDLPIVGPAFRNRIDGRVRTELIVFIRPKVIRGTVEAD
FT                   RIAEDFRQQFRAMMPIRPVPAPLPMAAMPIGPDGVLRRMID"
FT   sig_peptide     complement(34635..34709)
FT                   /locus_tag="Mext_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(34769..35206)
FT                   /locus_tag="Mext_0032"
FT   CDS_pept        complement(34769..35206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0032"
FT                   /product="ROSMUCR transcriptional regulator"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   ccr:CC_0933 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28460"
FT                   /db_xref="GOA:A9W797"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:A9W797"
FT                   /protein_id="ABY28460.1"
FT                   /translation="MVTDDSCGLEAVTASIIIAYVRNNRLPGAILPDLIRTVHQTLLSL
FT                   GTTTAPPAPDSARPTPAEVRKSITPDALISFIDGRPYKTLKRHLTSRGLDAYSYRARFG
FT                   LPVLAAGRAGSGGRRGSSRLRAARRRADPALSRTYQMSIGR"
FT   gene            complement(35503..35946)
FT                   /locus_tag="Mext_0033"
FT   CDS_pept        complement(35503..35946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28461"
FT                   /db_xref="UniProtKB/TrEMBL:A9W798"
FT                   /protein_id="ABY28461.1"
FT                   /translation="MMPAVCLRDPWSTSAFDPQRLLVQAYTRLILLPARADGSKMAVIA
FT                   RFGTREICLIETLAADAPPESVALRVELYDRARGHAVESMACNDLEEAEAATTELMKDA
FT                   REAVFGCSPQSSGQPCADAAGRWSAFRRSGFRLVERKRGTTRG"
FT   gene            36123..37223
FT                   /locus_tag="Mext_0034"
FT   CDS_pept        36123..37223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0034"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: pmy:Pmen_4447 helix-turn-helix-domain
FT                   containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28462"
FT                   /db_xref="GOA:A9W799"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A9W799"
FT                   /protein_id="ABY28462.1"
FT                   /translation="MPFTANLTATKQEVRSRAAAPSMPPSATGALARLAVARAAASGID
FT                   VQPCLSRAGLSERQIKNRHARIGATNQAALVGLLAEALEDDLFGFHLGQSFELGEIGLL
FT                   YYVMASAPTLRDALCRAERYAAITNEGIAPIYSQSGEVRVSYVGLARHAARHQVEFWMT
FT                   GLVRVAQQLTSLRLSPIHLTLCHPRHAGAREIEAFLGCAIAFDALVDEVQFPSAAGNAV
FT                   LTGADPYLHDLLLGYSEEALAHRVRLAESLRTRVENAVMPLLPHGRPRISEIARALGTS
FT                   QRTLSRRLTEEGLSFESVLEEMRRDLALRYLRDTRLSISRIAWLLGFREATAFTHAFRR
FT                   WTGRSPTEARVERDRALNPSPPQRSS"
FT   gene            37811..38818
FT                   /locus_tag="Mext_0035"
FT   CDS_pept        37811..38818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0035"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: reh:H16_A1682 D-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28463"
FT                   /db_xref="GOA:A9W7A0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7A0"
FT                   /protein_id="ABY28463.1"
FT                   /translation="MRVAVFSAKNYERALLDDLNAGQEHDLTYFDALLEPGTASLAAGF
FT                   TAVSVFVNDSVNRDVLRQLAQGGTKLVATRCTGFNHIDLEAAEEFGIRVVRVVNYSPNS
FT                   VAEFAVGLLLALNRKVHRAYNRTREGNFRLDGLMGFDLVDRTVAVIGTGKIGTIFGRIM
FT                   AGFGCRVIGFDVHRSPEFERIGGRYVEAAGVEEADVISMHCPLTPETYHIVDARTLGRV
FT                   KKGALLINTSRGGLIDTDAAIDALKSGRLGGLAIDVYEQEAELFYRDLSSTVIPDDVIQ
FT                   RLISFPNVIVTGHQAFFTQEALGTILGTTLKSISELEAGHPLTNEVAAPRRLQG"
FT   gene            38822..41194
FT                   /locus_tag="Mext_0036"
FT   CDS_pept        38822..41194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0036"
FT                   /product="Kojibiose phosphorylase"
FT                   /EC_number="2.4.1.230"
FT                   /note="PFAM: glycoside hydrolase family 65 domain protein;
FT                   glycoside hydrolase family 65 central catalytic; KEGG:
FT                   nca:Noca_3421 kojibiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28464"
FT                   /db_xref="GOA:A9W7A1"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7A1"
FT                   /protein_id="ABY28464.1"
FT                   /translation="MLRPRYVPPEDIFPPNPWAFEAVQYDARLAQELTGQAETMFALSN
FT                   GYLGIRGSVEEGTPVQEAGTYLSGFYEHRPISYGEHAYGFPTVGQSILNCPSGTALKLF
FT                   VEDEPFVVPQAEILSYRRSLDLRTGTLNRDVRWASPAGTRLHMQTVRLVSLAHRHLAAI
FT                   VFVLTAEDADVEIAISSELENAPSSTADIADPRLAASLAGRVLHPTGFQAEGMRAMLSY
FT                   RTESSGFHLGCGMDHAVSSERPYFTEQVCSDDFAAVTIRCKLARNKPIVIYKYLSYHYS
FT                   DNSAPARILFQTALTLDRALKSGFQEIVERQRSDVERFWARADVAVEGDNPRTQQTIRW
FT                   NLFQLLQASERSEGHGIGARGLTGRTYEGHYFWDTEIYVLPFLIYTNPVIARSVLKFRY
FT                   DMLDKARARARELGHRGATFPWRTINGDEASAYYAAGTAQYHINADIAYALQKYVNVTG
FT                   DNEFLWSYGAEILTETARLWFDLGFFSESKGGKFCINGVTGPDEYTAIVNNNCFTNLMA
FT                   RENLRYAAQVVRDLKRVHPDRFDALAQRTGLDSSELADWEDASERMYLPYDERLKIHPQ
FT                   DDDFLDLEKWDFAATPENRYPLLLYYHPLNLYRSQVIKQADTVMAMFLLNEHFTHEEKR
FT                   RNFEYYDPLTTHDSSLSVCIQSVVANEIGLPHKAIEYFNFAAAMDMSDIGGNMMNGAHV
FT                   AAIGGTWLALVYGFAGLRDSKGCISFNPVLPKEWSHLSLVLTVRGQRFRIEVDPNSVIY
FT                   TLLSGERLNFSHVGEDLVLSSAEPVITRPTGQGRADA"
FT   gene            41357..42952
FT                   /locus_tag="Mext_0037"
FT   CDS_pept        41357..42952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0037"
FT                   /product="YidE/YbjL duplication"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: TrkA-C domain
FT                   protein; YidE/YbjL duplication domain protein; KEGG:
FT                   nha:Nham_0891 YidE/YbjL duplication"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28465"
FT                   /db_xref="GOA:A9W7A2"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7A2"
FT                   /protein_id="ABY28465.1"
FT                   /translation="MMASVSELVGTQPILALFLAIGLGYAVGQISILNFSLGVAAVLFV
FT                   GLLIGALAPKAQITGPLGLVGLIMFLYAIGILYGRQFFEGLSGPGRIYNVLATVAVVAS
FT                   LLVALGLGAIFDVKLGHTLGIFAGSMVSTAALQAALDTIGNRDPSVGYSVSYPFGVIGP
FT                   ILCLYFMTRRAKPVFPPKPSRFHLGEVTLERLPSSGATLGAVMATLPAGVQIAGVRQEH
FT                   HNRLPDPDLELHAGDALLIAADHAAALDEVATALGHIDQGRLAKDRSDITYQRFFVSKS
FT                   ALTSVRLADLPMPPDVSIRILHVRRYDVDLMPSPDLMLELGDRVGVIVASEQVVAARAH
FT                   FGDTLKSAAEFSYVSVGLGMVLGVLLGLLPIPVPGVGTVTLGIGGGPLIVALILGRLRR
FT                   TGPLSWVMPLPANIVLRNFGLTLFLATVGINSGQAFVTTVTQTGPLMLLIGVAVLLTTV
FT                   AIVLLVGFYLLKIPYDDLLGVACGATGNPAILAYSLRIAPTDRPDICYAMIFPSMTIVK
FT                   VLSVQIIGLLSLSG"
FT   gene            complement(43248..45533)
FT                   /locus_tag="Mext_0038"
FT   CDS_pept        complement(43248..45533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0038"
FT                   /product="Kojibiose phosphorylase"
FT                   /EC_number="2.4.1.230"
FT                   /note="PFAM: glycoside hydrolase family 65 domain protein;
FT                   glycoside hydrolase family 65 central catalytic; KEGG:
FT                   ana:all1058 putative trehalose/maltose hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28466"
FT                   /db_xref="GOA:A9W7A3"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7A3"
FT                   /protein_id="ABY28466.1"
FT                   /translation="MLEVLRPTQEPGWVLTHEGYSVLTESAVESRFALGNGFLGMRAAR
FT                   STGRGPTWVSWLGYIRWASWPRCYVAGLFDMPNTEPPVPALVPVADWSRIRLILDGEPL
FT                   VVREGEILHGMRRLDMRRGVLLSEWTHRTPAQVTAKGHELRLLSLADRSVGLQLQQIVL
FT                   DRDDIDVRLEASFGLAGVGMEPVRLENDLGAWRTEGTGKVVAMAGAASLHLDGALADSE
FT                   RPFPLRWIWRWRSKAGQVAQFARLVAVARAERSEEDPAPRAAATLARSTSVGWRAILKA
FT                   HESAWDAHWSDSGIVIDGDDDLQRALRFAVYHLTSAANPSDDRVSIGARALTGDAYFGH
FT                   VFWDTEIYLLPFYTAVWPEAARALLMYRFHTLPGARAKATLGGWRGALYPWESADTGDE
FT                   TTPDSVLGPDGKPIEILTGKMEHHISADVAYAVWQYWRATGDDDFFRDAGAEILLETAR
FT                   FWASRAVAEADGRRHIRHVIGPDEYHEDVDDNAFTNVMARWNIGCALEALDLLRKGWPD
FT                   RAEALRDKLALDDRELDDWRDAVARIVTGLDPATGLYEQFAGFHGLKQLNVADYVDHAL
FT                   PIDVVIGREQTQSSQVIKQADVVALIALLPQEFPGQGAEINFRHYEPRCAHGSSLSAAM
FT                   HARVAARLGASDTALRYMRETASLDLDLDPNSAGGVRIAGLGGLWQAAILGIAGLNLAG
FT                   DTLELDPKLPPQWDTLSFKVWWRGRSVGLSVSRPMLEARLMDGDGMDVTVAGVTQHLTP
FT                   GSPLRFEL"
FT   gene            complement(45526..46254)
FT                   /locus_tag="Mext_0039"
FT   CDS_pept        complement(45526..46254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0039"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: csc:Csac_0438 beta-phosphoglucomutase
FT                   family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28467"
FT                   /db_xref="GOA:A9W7A4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7A4"
FT                   /protein_id="ABY28467.1"
FT                   /translation="MRPALLAAIFDVDGVLVDSPHERAWREALTGFADPAGFTTSFYQA
FT                   NVAGKPRLEGAREALERLGGPKSAARTAEYADRKQALIDQLIEAGSFEVFPDALRFASA
FT                   LKSAGLRLALASSSKNAAAMLSRLKLSDGRTLLSLFDADLSGRDVPRGKPDPALFLLAA
FT                   EALNTPPLQCVVIEDAPAGITAARAGGMTALGIARLGDEALLREAGADLVVTSLDQVEI
FT                   AALGAGTLRARTVTEPVADA"
FT   gene            complement(46285..48720)
FT                   /locus_tag="Mext_0040"
FT   CDS_pept        complement(46285..48720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0040"
FT                   /product="Phosphoketolase"
FT                   /EC_number="4.1.2.9"
FT                   /note="PFAM: D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase; KEGG: rle:RL0066 putative
FT                   xylulose-5-phosphate phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28468"
FT                   /db_xref="GOA:A9W7A5"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7A5"
FT                   /protein_id="ABY28468.1"
FT                   /translation="MDAILKARRQPKRTARTSELALIDAYWRAANYLSVGQIYLYDNPL
FT                   LVERLTKEHIKPRLLGHWGTTPGLNFIYVHLNRLIKKHDLDVIYITGPGHGGPALIANA
FT                   YLEGTYSEVYPNISADAEGMKRLFKQFSFPGGIPSHVAPETPGSMHEGGELGYSLSHAY
FT                   GAAFDNPDLIVACVVGDGEAETGPLATSWHSNKFLNPVSDGTVLPILHLNGYKIANPTV
FT                   LARISHAELEHLFRGYGYTPYFVEGHDPAEMHQRMASTMDAVLRDIRRIKSDARDKGFT
FT                   GRPFWPMIVLRTPKGWTCPKEIDGRRTEDYWRSHQVPMGEMHDNPAHVRMLEDWMQSYR
FT                   PAELFDEGGRLRSELAELAPTGDRRMSANPHTNGGTLLRDLRLPDFHDYAIPVTAPGAA
FT                   VAESTRVMGRFLRDVMDLNAEARNFRLFSPDENNSNRWQDALEVTNRAWVAETYPWDDH
FT                   LAHDGRVMEMLSEHQCQGWLEGYLLTGRHGFFSCYEAFIHIIDSMFNQHAKWLKVCNHI
FT                   PWRRPIGSLNYLLSSHVWRQDHNGFSHQDPGFIDHVVNKKAEVVRVYLPPDANCLLSVT
FT                   DHCLRSRNYVNVIVAGKQPAPQWLTMDQAVKHCTAGLGIWEWASNDRGSEPDVVMACCG
FT                   DVPTLETLAAVDLLRCHAPDLKVRVINVVNLMKLQPDTEHPHGLSDQDFDALFTTDKPV
FT                   VFAFHGYPWLIHRLVYRRHGHSNFHVRGYKEEGTTSTPFDMCVMNDMDRFHLVSDVIDR
FT                   VPGLAARAAYAKQAIRDKLIDHRAYIHRHGDDMPEVSGWSWSPMATTRGLGSTESDNV"
FT   gene            complement(48862..49362)
FT                   /locus_tag="Mext_0041"
FT   CDS_pept        complement(48862..49362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr3479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28469"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7A6"
FT                   /protein_id="ABY28469.1"
FT                   /translation="MKALLISSAAFAALILTGVAADARGFRGGGGGFRGGGGFHGGGFR
FT                   GGGGFHGGGFRGGIGRPGWGAAGPIAGRPGWGAGRPIAGRPGWGAGRPIAGRPGWGGGR
FT                   VGRGYVVRGGYGWGGYRPYGYGLAAAGVGAAAAAGYYGYRSGYGGCGPYAYYDAYTGTC
FT                   ASY"
FT   sig_peptide     complement(49300..49362)
FT                   /locus_tag="Mext_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.500 at
FT                   residue 21"
FT   gene            complement(49557..49808)
FT                   /locus_tag="Mext_0042"
FT   CDS_pept        complement(49557..49808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28470"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7A7"
FT                   /protein_id="ABY28470.1"
FT                   /translation="MFHGEVMIEKPGFEIRITTTETGSILRAQTEREVATKAESLIRRV
FT                   HARGELIGFSIMGPSATEIGRIKAYLEDVLIEVAQLSI"
FT   gene            complement(50049..51131)
FT                   /locus_tag="Mext_0043"
FT   CDS_pept        complement(50049..51131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0043"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: pmy:Pmen_0268 helix-turn-helix-domain
FT                   containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28471"
FT                   /db_xref="GOA:A9W7A8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7A8"
FT                   /protein_id="ABY28471.1"
FT                   /translation="MFSCAALATGYPSPPENLLPVGLAHLRVAQAIYAVLVELEADPDT
FT                   LMVEAGLDPRLFECHGKLVPYSSLGRLIAIAVERTRCPHLGLLIGQRTTITSLGLLGLL
FT                   LNNSDTIGDALRALEAYLGMLNRGAVVGLGIDNDVAVLTYCPYEPGAEGAVHHSDRALA
FT                   TATNILRAVCGSDWAPLEVLLPRSAPSSTTPYSQFFRAPVRFDQETAALVFPASLLKRR
FT                   IAGADPVLRRRVEDRIRRLESARPSTLKDGLRQHLRAEVIRKRCDVMKTALRLSLGRRT
FT                   LSRRLRAEGTSFKQLANEAQFRVAKRLLADTKMSMTEISAVLDFSEPAAFTHAFRRWAG
FT                   MTPSSWRQGNHSETKREEHQ"
FT   gene            complement(51685..51957)
FT                   /locus_tag="Mext_0044"
FT   CDS_pept        complement(51685..51957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28472"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7A9"
FT                   /protein_id="ABY28472.1"
FT                   /translation="MGKGGAFKKPIDIFAPAFIVSGKRLKTPMATCSIKSVRPTGDRQL
FT                   LVLDCANAVAAQEVRVYMMPQQNGPLKRYYNEQDPAGTGYQRCSK"
FT   gene            complement(52134..53255)
FT                   /locus_tag="Mext_0045"
FT   CDS_pept        complement(52134..53255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0045"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: reh:H16_B1002 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28473"
FT                   /db_xref="GOA:A9W7B0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7B0"
FT                   /protein_id="ABY28473.1"
FT                   /translation="MCQRPPAVVGDIGSHERPSLIGLTRPGVAKAVYLTLVELGANLDE
FT                   LLAEAGLDPRTFDGGRTPVPYASLGRLIALGAERTGCHHLGLLVGQRATLASLGLLGLL
FT                   MRHSDTIGGALRALEAHAGVRNWGAVVGLDIDSEVAVLSYCPYGSEAESTALQSERALA
FT                   TITNVIRALGGSDAALLEVLLPRSAPRDTAPYISFFRAPVRYDQETAALVFPTLLLERR
FT                   IKGADPAARGRVEDRIRKLEAEQPSTLKDKLREYLQAQVMRQRCKAAHVARLRLVPPRT
FT                   LRRRLKAEGTTFKQIANEAQFSVAKQLLANTRMSMAQISAALDFSEPAAFSHAFRRWSG
FT                   FAPSTWRREHQSKCLGREQDENSYSAQTQQPVR"
FT   gene            53426..53734
FT                   /locus_tag="Mext_0046"
FT   CDS_pept        53426..53734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_PD00095 putative insertion sequence
FT                   transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28474"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7B1"
FT                   /protein_id="ABY28474.1"
FT                   /translation="MSSDRRAGREGHGHRSEYEHAPRHPRCFDEATKGDCFWAYVTDSL
FT                   SPVLKPGDTVIPNDHGAHKVVGKRDGVQTAGVQLLLRFTALSLQIIHQLKIVSITQS"
FT   gene            53886..54443
FT                   /locus_tag="Mext_0047"
FT   CDS_pept        53886..54443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28475"
FT                   /db_xref="GOA:A9W7B2"
FT                   /db_xref="InterPro:IPR036444"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7B2"
FT                   /protein_id="ABY28475.1"
FT                   /translation="MDQATRSRLSYDPSDVFWGLPFLRTGISACPGPHPHVARSKAMTL
FT                   RILPPLILAACLASPALAQSAIDRGQPAALIHGNYCGLGNNAPRPPIDALDAACARHDA
FT                   CTPAGGLPSPACNLRFKRETAFISRDPRQPDDLRALAGFMSASAALLPFDPVAPVVGTS
FT                   MPASGPYGPYSPGPYRPAYYAY"
FT   gene            54670..55209
FT                   /locus_tag="Mext_0048"
FT   CDS_pept        54670..55209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aba:Acid345_1413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28476"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7B3"
FT                   /protein_id="ABY28476.1"
FT                   /translation="MEDAMQKLALVSLAALGMGALIAADTAEARGGFGGGGFRGGGFGG
FT                   GGFRGGGGFGGGFRGGGFSGGGFRGGGAVAGGWRGGVGGYRGVAGGYRGGFYGGRGFYG
FT                   GRGYGYRGYGYRGYGYGVGAGLAGLAVGTAVGAAASNYYGGYGYGYDNADYGGYAPAAY
FT                   GSSYPAYGYGGCTCGY"
FT   sig_peptide     54670..54741
FT                   /locus_tag="Mext_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.986 at
FT                   residue 24"
FT   gene            complement(55414..57084)
FT                   /locus_tag="Mext_0049"
FT   CDS_pept        complement(55414..57084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0049"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: aba:Acid345_4738 sulfate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28477"
FT                   /db_xref="GOA:A9W7B4"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7B4"
FT                   /protein_id="ABY28477.1"
FT                   /translation="MTGLGSTTRTSTTDAPTKLRSDILAGLTAAAVVLPKAMAFATVAG
FT                   LPVAVGLYTAFVPTLIYGLLGSSHVLSVSSTTTLAILTAAEIGSVVPDGDPARLVATTA
FT                   TLTALVGALLLGARLVKLGFIASFISVPVLTGFKAGIACVILLDQAPKLLGLHSAKQSF
FT                   FIDLASLVRHLPETSLPTLAVAGVTLAVLVGAERLRPHSPVPLVTVAAAVAASWLLGLN
FT                   AWGVATVGEIPPGLPSVSMPDLTLVQALLPGAMGIALMSFTESIAAGRAFVASGDPPID
FT                   ANRELVATGAANLGGALLGAMPAGGGASQTGVVRAAGGRTQAASFVTAALALATMLLLS
FT                   PVLGLLPQATLAAVVIVYSASLIQPAEFRDIFKVRRMEFHWAIVAGIGVLVFGTLQGIT
FT                   VAIVLSLVGLGLQTAHPRISVIARKHGADVLRPLSPEHPDDETFVGLLILRPEGRLYFA
FT                   NAQNVADRIRALIAEHKPRIVALDLSRVPDIEYSALQMLRDGARRTSMTFWLVGLNPDV
FT                   LNMVRRAGLDQELGPDRLLFNARTAIERYKALLAPSAPD"
FT   sig_peptide     complement(56965..57084)
FT                   /locus_tag="Mext_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.764) with cleavage site probability 0.677 at
FT                   residue 40"
FT   gene            57598..58023
FT                   /locus_tag="Mext_0050"
FT   CDS_pept        57598..58023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr3479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28478"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7B5"
FT                   /protein_id="ABY28478.1"
FT                   /translation="MKTLLIASAAFAALILTSVTADARGFRGGGGGGFRGGGIHGGGFH
FT                   GGRAGGFRGGAGGYRRGVAGYRGGYGRVGRYGHRGVGRYGYGYGRYGYGRYGYRPGYGL
FT                   AAAGVGAAAAAGYYGSTYGGCGRYAFYDQYSGTCRPY"
FT   sig_peptide     57598..57669
FT                   /locus_tag="Mext_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.606 at
FT                   residue 24"
FT   gene            complement(58205..58726)
FT                   /locus_tag="Mext_0051"
FT   CDS_pept        complement(58205..58726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0051"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nha:Nham_0861 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28479"
FT                   /db_xref="GOA:A9W7B6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7B6"
FT                   /protein_id="ABY28479.1"
FT                   /translation="MGDLSCYSAVERLCDGRALEIRALRPDDRERMLAAIDHTSAQSLY
FT                   RRFFAAKRHFTDKEIAFFLNVDFREQVALVATADEDGEQAIVGGARYVATRPGQAEVAF
FT                   TVIDEYQRRGIGAALVRHLMDIARAAGLTELTAEVLPDNAPMLKLFERTGLPLSSRREA
FT                   DAVHLVLRLT"
FT   gene            59158..60132
FT                   /locus_tag="Mext_0052"
FT   CDS_pept        59158..60132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0052"
FT                   /product="Phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; KEGG:
FT                   xau:Xaut_3251 phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28480"
FT                   /db_xref="GOA:A9W7B7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7B7"
FT                   /protein_id="ABY28480.1"
FT                   /translation="MSIATIEQAAVETRGHEKYDRLIVAAQALPRLQVAVVHPCDAATL
FT                   GAALEASALGIVEPILVGPPGKIAAAAAALDADIGAFRLVDAAHSHEAAQKAVALVRAG
FT                   EAESLMKGSLHTDELMAAVVRQDGGLRTARRVSHCFVMDVPGHATPLIITDAAVNIAPS
FT                   LEEKRDITQNAIDLAQALGVESVRVAILSATESINAKMPSTLDAAALCKMADRGQITGG
FT                   ILDGPLALDNAIDLEAARIKKIHSPVAGQANVLVVPDLEAGNMLAKSLTFLARADAAGI
FT                   VLGARVPIILTSRADSRLTRLASCAVASLFAAAQRARLPLPEV"
FT   gene            60136..61344
FT                   /locus_tag="Mext_0053"
FT   CDS_pept        60136..61344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0053"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: xau:Xaut_3252 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28481"
FT                   /db_xref="GOA:A9W7B8"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7B8"
FT                   /protein_id="ABY28481.1"
FT                   /translation="MTSVLLVLNAGSSSLKFQVFAFGETADPRRIFKGVFEELSGSPHL
FT                   LIRESAGTIVADQAFHRESLSGHEEALLHVAAWLREHCSGFRLAAAGHRVVHGGRAYSR
FT                   PVRVDEEVLEALERLVPLAPLHQPHNLAPIRILRRRFPDLPQIACFDTAFHRNQPEIAQ
FT                   LFALPHAMTEAGVRRYGFHGLSYAHIASVLAQYDPALATGRVVVAHLGNGASLCALERG
FT                   RSIATTMGFSALDGLPMGTRCGSLDAGVVFYMMREMKLGPDEAERMLYTQSGLLGVSGL
FT                   SHDMRRLRSLAATDPDAQRAIDLFVYRIERELGSLVAALGGLDALIFTGGIGENDVATR
FT                   AEVLRGAAWAGFELDAAANASGGPQVTRGSGPAAWVIPADEEMTIARGTCEALAQVQRE
FT                   PAL"
FT   gene            61361..61855
FT                   /locus_tag="Mext_0054"
FT   CDS_pept        61361..61855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_2306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28482"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7B9"
FT                   /protein_id="ABY28482.1"
FT                   /translation="MEALKTNPQTEHELGDESFMSAAELGAYTAKLKAAKALQTEDRAE
FT                   EARAELIKALSETIEVTPKKVHEIMTSLLYKLRIAAEQGKNELLVMRFPNVMCSDGGRA
FT                   INNFEKGWPETLTGRPRQAFEFWRDRLQPAGYGLKAVIVDFPDGMPGDVGFLLTWETRS
FT                   A"
FT   gene            complement(62921..63733)
FT                   /locus_tag="Mext_0055"
FT   CDS_pept        complement(62921..63733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0055"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   acr:Acry_3208 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28483"
FT                   /db_xref="GOA:A9VXJ2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A9VXJ2"
FT                   /protein_id="ABY28483.1"
FT                   /translation="MWTPTTRRQHSRSGLRYETDLTDAEWAVVEPLMPKPAPCGRPPVW
FT                   TMREILNAIFYVLRGGIAWRLIPKDLPPRSTTYGYFSRWRDDGLFGRINHHLVMADRER
FT                   IGREASPSAAVLDSQSIKTTESGGPRGYDAGKKVKGRKRQALVDTDGRALVLDPQPADV
FT                   QDRDGAVPVLRLSRRTFPFITKAFADAGYAGDRPATATSITVAIVRKPPGQVGFAVQPR
FT                   RWVVERFFAWISRNRRLWKDPEATLASAQAFLYAAAAMILVRRLGRAS"
FT   gene            complement(63895..64893)
FT                   /locus_tag="Mext_0056"
FT   CDS_pept        complement(63895..64893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0056"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rpe:RPE_3641
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28484"
FT                   /db_xref="GOA:A9W7C1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7C1"
FT                   /protein_id="ABY28484.1"
FT                   /translation="MNDNRTHPIEPHTRRQSWLASALVGAAAALGASALYAASKTREAE
FT                   QRYPPIGQFMTVDGVRLHYFEQGQGDPLVLIHGNGTMIQDFLVSGIVDELAKGHRVIII
FT                   DRPGYGYSERPRALWTPRAHATLYQTALERLGVSQAVVLGHSWGSLVAVALALQAPQLV
FT                   RSLVLASGYYYPTLRADVFLFSPPAIPVIGDVMRYTVSPVIGRLILPGLIKAMFAPADV
FT                   PERFDRLMPKELMLRPSQLRAAAEDAALMTPVTVELQQHYRELTLPVVIIVGADDQIAD
FT                   VGRQSERLHHELPGSELIAIPGQGHMIHHLAPKHVIRAIERAFERAPANPA"
FT   sig_peptide     complement(64780..64893)
FT                   /locus_tag="Mext_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 38"
FT   gene            complement(65086..65331)
FT                   /locus_tag="Mext_0057"
FT   CDS_pept        complement(65086..65331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28485"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7C2"
FT                   /protein_id="ABY28485.1"
FT                   /translation="MSFIIEARVSARRFSYHRSSLLSALEHGMSLQAAGMADVRIIDGC
FT                   GRERSPAEVQQLLFGPHLAVKAASSDAERPSGARAA"
FT   gene            complement(65450..66517)
FT                   /locus_tag="Mext_0058"
FT   CDS_pept        complement(65450..66517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0058"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M18 aminopeptidase I; peptidase M20;
FT                   peptidase M42 family protein; KEGG: gsu:GSU2196 hydrolase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28486"
FT                   /db_xref="GOA:A9W7C3"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7C3"
FT                   /protein_id="ABY28486.1"
FT                   /translation="MRHESLEYLKALANAPSPSGYEQGAAKLFREYTQRYADRVSVDSH
FT                   GNIIAALNPDAPMKIMLAAHMDEIGFVVHYIDEAGLLYFSAVGGHDSTIPPGQRVWVYG
FT                   SERTPGVVGRKASHLLDEDEQNKKPKLSDLWIDIGATSRAQVESVVRLGDPITYQYEFQ
FT                   SLLGDRAAARGFDNKAGLFVVAEALRSLSEGGGLAPGVGVYFVASVQEEIGSRGARTSA
FT                   FSIAAQTGLAIDVDHAIDYPGVSRTQHGELKIGEGPSVSRGPNTNPVVFDLLSRAAKEE
FT                   GIPFQVSVSPSATPTDANAMQLNRGGMAVGLLGVAIRYMHTPCELLSLTDLHQCIGLTS
FT                   AYCRRVTQDTDFSPY"
FT   gene            complement(68678..69493)
FT                   /locus_tag="Mext_0059"
FT   CDS_pept        complement(68678..69493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0059"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: stp:Strop_0369
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28487"
FT                   /db_xref="GOA:A9W7C4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7C4"
FT                   /protein_id="ABY28487.1"
FT                   /translation="MSAALREAARSLVVPSLNNPGGAEVSRKAGGSVVTQIDREVELQL
FT                   SEVVMALLPNSLVIGEEKVAADATLLTRIDEEWVWLIDPVDGTANFVEGKGSIAMMIAL
FT                   LYRGKAVVAWILDPVKDALLTTNKSEHALLQLKSTTTPAASNLRGAAWTRYYDNELRSA
FT                   IERRFLSLGDVSPGSKCTGAEYLAVIQGRQDFVLFWRSMPWDHAAGILLLQESGGYAAY
FT                   LNRDPFRPGAKRLGLLVARSQAVWNQVWTTLIEGVPDPERLLVREMNTY"
FT   gene            69694..70113
FT                   /locus_tag="Mext_0060"
FT   CDS_pept        69694..70113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0060"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rpe:RPE_1272
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28488"
FT                   /db_xref="GOA:A9W7C5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7C5"
FT                   /protein_id="ABY28488.1"
FT                   /translation="MSMPKLNGVLETVLYIEDLERADAFYREALGLTCIHSDFRMRGYD
FT                   VGGRGVVLLFPQGSSLHPIDTPGGTIPPHDGSGPSHIAFSIDAEVFAEWENHLAVSGVA
FT                   IEGRTQWPRGGISIYFRDPDGHLLELATPGLWKGY"
FT   gene            70186..71049
FT                   /locus_tag="Mext_0061"
FT   CDS_pept        70186..71049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0061"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcl:ABC0759
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28489"
FT                   /db_xref="GOA:A9W7C6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7C6"
FT                   /protein_id="ABY28489.1"
FT                   /translation="MALQSEPSLSLVRLSEVTLNVASAGPKDGILTILLHGFPEFWFGW
FT                   RHQIDALARAGLHVAAPDQRGYNLSSKPEGIEAYHLDRVADDVIALADSYGAGTFDVVG
FT                   HDWGGIVGWWLAARSPDRVRRLAILNAPHPDVLASYARRHPTQALRVFYFGAFQVPWLP
FT                   ETGLRAANFLAMRQALRLTSRGGTFSDADLKRYQQAWAQPGALEGMLNWYRALRLKHRS
FT                   ELKPIRSPTLIVWGKKDPALSPHLATESLKLCDQGKIEWLPGATHWLHHEEPQHVNNAL
FT                   ISFLSQ"
FT   gene            71265..71876
FT                   /locus_tag="Mext_0062"
FT   CDS_pept        71265..71876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0062"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bja:blr8041
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28490"
FT                   /db_xref="GOA:A9W7C7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7C7"
FT                   /protein_id="ABY28490.1"
FT                   /translation="MAGDDELRFGPLSHSCAHLCIDMQRMFAERTDWCTPWMARVLPKV
FT                   VQIVEAHPRETVFTRFIPAQTSGQGEGTWKRYYERWASMTIEQLGADKIDLVPELTRFV
FT                   PPAEVVDKNVYSPWLGTDLHERLRARSIDTLVVTGGETDVCVLSAVLGAVDRGYRIIIV
FT                   TDALCSSSDEAHDAMLTLYHGRYGQQVETVTTDTLLRSWM"
FT   gene            71912..72652
FT                   /locus_tag="Mext_0063"
FT   CDS_pept        71912..72652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_06523 GDSL-lilke lipase/acylhydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28491"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7C8"
FT                   /protein_id="ABY28491.1"
FT                   /translation="MLSLSYLIDRRKVLAAMNLTLPLPLRSQTCTSGDAIMRHVVLLGD
FT                   SVFDNAAYVRGGPDVVQQLRTMLSEGSQATLLAVDGHVISDVPRQLSRLPGNATHLVVS
FT                   VGGNDALRASGVIERPTRSVAESLHLLAEVQERFQTAYRAMLDAVQAAARPTALCTIYD
FT                   PRYPDSQRRRLIKTALALLNDVITREAFTRRLSLVDLRLLCNEDADFANPIEPSVQGGQ
FT                   KIAQAIAAFLHARLELQGTRVFAR"
FT   gene            72717..73016
FT                   /locus_tag="Mext_0064"
FT   CDS_pept        72717..73016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_2209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28492"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7C9"
FT                   /protein_id="ABY28492.1"
FT                   /translation="MIQILLPLSDNDGQAFSGVEYEGVRSELTKQFGGLTAFTRGPAEG
FT                   LWAEKGGTAHDDIVVFEVMTVELDEAWWASYRRGLEARFRQDSIIIRAQQTQLL"
FT   gene            complement(74421..75104)
FT                   /locus_tag="Mext_0065"
FT   CDS_pept        complement(74421..75104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0065"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   xcb:XC_2149 succinoglycan biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28493"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7D0"
FT                   /protein_id="ABY28493.1"
FT                   /translation="MRSRSWLLLLLFATPANAEPFVGRASVIDGDTLDVSGTRIRLHGI
FT                   DAPESSQLCKDAAGKDYRCGQAAAVALADHVGKRVVTCEPREIDRYGRVVAVCRADAED
FT                   LNAWMVGQGHAVAYRRYTEDYVNVELTAKALRHGIWAGTFQDPSEWRRAKRAGGESSRP
FT                   EAVTPPSKASGCTIKGNISANGKRIYHLPSSSDYERTRINDRAGERLFCSEDEARAAGW
FT                   RAPQR"
FT   sig_peptide     complement(75048..75104)
FT                   /locus_tag="Mext_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            76284..76625
FT                   /locus_tag="Mext_0066"
FT   CDS_pept        76284..76625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28494"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7D1"
FT                   /protein_id="ABY28494.1"
FT                   /translation="MELKITKQDGKAVCSPAELRLPANSNVTINIISQSDSPVMLTSPN
FT                   QFKNDQVLHHDGDLAHAASGDGYTVKQNGKGVLKLRTLAAGEQEYGCASINNQKEVFRG
FT                   KLILSPPSG"
FT   gene            complement(76972..77427)
FT                   /locus_tag="Mext_0067"
FT   CDS_pept        complement(76972..77427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28495"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7D2"
FT                   /protein_id="ABY28495.1"
FT                   /translation="MLKISAFLGATAILALTATSPIAAPCNTQGKQASNEKSSSTDHST
FT                   KNLADGQQPSSPKTVGAMNNLAADRATSAADVTRQAEGKGTMAQQGQSGSGSQGQQTGG
FT                   SASSDADRSTKNLASGQQPSAPKTVGAMNNVGANQLPGKQGQADDGC"
FT   sig_peptide     complement(77356..77427)
FT                   /locus_tag="Mext_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.833 at
FT                   residue 24"
FT   gene            78345..78421
FT                   /locus_tag="Mext_R0001"
FT                   /note="tRNA-Met1"
FT   tRNA            78345..78421
FT                   /locus_tag="Mext_R0001"
FT                   /product="tRNA-Met"
FT   gene            complement(78700..80124)
FT                   /locus_tag="Mext_0068"
FT   CDS_pept        complement(78700..80124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0068"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: GTP-binding proten HflX; PFAM: GTP-binding
FT                   protein HSR1-related; KEGG: xau:Xaut_4392 small GTP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28496"
FT                   /db_xref="GOA:A9W7D3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7D3"
FT                   /protein_id="ABY28496.1"
FT                   /translation="MSEMRPLDEPRLQPPGPPEIEVAANTRTLVVGPYLTRSTAAQASG
FT                   AAEAQNLRSTTARLDEAVGLAAAVDLAVVQAIPLNLPKIRPSTYLGKGRVEEIAGLIKA
FT                   LEIGLVVMDCALSPVQQRNLEKAWSAKVIDRTGLILEIFGRRASTREGTLQVEHAHLAY
FT                   QKSRLVRSWTHLERQRGGFGFLGGPGETQIEADRRIIQERMTRIERDLDAVTRTRGLHR
FT                   KSRARVPYPIVALVGYTNAGKSTLFNALTEAQVVAQDMLFATLDPTARATKLPHGETVI
FT                   LSDTVGFISDLPTALIAAFRATLEDVIEADILLHVRDISHADTEAQAEDVGHVLDELGI
FT                   RSHADRIIEVWNKADVLDKAERTRLLNLSSKGEGQTRNDHDSSAPVLVSALTGEGLSAL
FT                   TSRIEARIARSRSTFAVVLPPEDGAQLHWLYENAEVLDRREEVNGTLHLAVRVAPEKEP
FT                   RFHNRFAGARHLHGAR"
FT   gene            complement(80629..80832)
FT                   /locus_tag="Mext_0069"
FT   CDS_pept        complement(80629..80832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28497"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7D4"
FT                   /protein_id="ABY28497.1"
FT                   /translation="MSRETIKDRYQRTLGYIITENSGRQKAVDAGQRTLGYYYPQQDVT
FT                   KDAGQRTIAHGNGLASLIYDAE"
FT   gene            complement(81062..81523)
FT                   /locus_tag="Mext_0070"
FT   CDS_pept        complement(81062..81523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28498"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7D5"
FT                   /protein_id="ABY28498.1"
FT                   /translation="MSVLKTLKLSAAAPVASANDPLSRAREKLLGQLAEQKEMVGATLE
FT                   GRLYEPLKVAAVRKNAAGERVRVEVARRVRKGWFQDQASTVHFIMRVGGKPLELQPGKA
FT                   AISIGSLDKLPGTIDALITAVRAGELDPQIKEAAAARGLMMAERRKKAA"
FT   sig_peptide     complement(81467..81523)
FT                   /locus_tag="Mext_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.685) with cleavage site probability 0.662 at
FT                   residue 19"
FT   gene            82224..82778
FT                   /locus_tag="Mext_0071"
FT   CDS_pept        82224..82778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28499"
FT                   /db_xref="GOA:A9W7D6"
FT                   /db_xref="InterPro:IPR003611"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7D6"
FT                   /protein_id="ABY28499.1"
FT                   /translation="MHPKIQNLLDAQTDLHAWLECQFARARSYQINRGTQFDLTFADYV
FT                   DLWRLSKLKKVVQLMKAGRLRSRMRHPDRGWVLSWSNKAARKTGVMNKHTASIIQRLTS
FT                   KLRFYLQKGERHTDAARAKIGAAKRGKPLTAAHKEAIRAARTGVAQSEEHKRKRIEAIR
FT                   ATKQRQREERLALIAQAAKTA"
FT   gene            83173..83415
FT                   /locus_tag="Mext_0072"
FT   CDS_pept        83173..83415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr3136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28500"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7D7"
FT                   /protein_id="ABY28500.1"
FT                   /translation="MARYFFDVHDGALHQFDDDGTECATLDEARAQAMQLLPDIAREQA
FT                   LNGGDRHAYTVLVTDEDHHPVYSATLTLTGLWLIR"
FT   gene            complement(83457..84224)
FT                   /locus_tag="Mext_0073"
FT   CDS_pept        complement(83457..84224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0073"
FT                   /product="cyclic nucleotide-binding"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: bra:BRADO3435 putative transcriptional
FT                   regulatory protein, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28501"
FT                   /db_xref="GOA:A9W7D8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7D8"
FT                   /protein_id="ABY28501.1"
FT                   /translation="MSGMPSPEAGEPAFDRCQPLIRKLERFAPLSDADRAVLEQICANP
FT                   RIVPPQTDLVREGDRPDGVFVVLSGFACRHKLRASGARQINAYLVPGDLCDLDVALLDE
FT                   MDHTITTLSTCTVVRLAPELITDLLTHHPQIARALRKNRLVDEATLREWLMNVGRRSSV
FT                   ERMAHLFCELLLRLRAVGLADGTVYKLPLTQADLADTAGITSVHVNRSLRELRQGGLIE
FT                   LQGRQLTILDYARLRALAEFRANYLHLGDRIAA"
FT   gene            complement(84221..84610)
FT                   /locus_tag="Mext_0074"
FT   CDS_pept        complement(84221..84610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0074"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: rsh:Rsph17029_1334 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28502"
FT                   /db_xref="GOA:A9W7D9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7D9"
FT                   /protein_id="ABY28502.1"
FT                   /translation="MTLDQQPSVLLADHDALIAVDLSDALEKAGYSVLGPAGTAAEALQ
FT                   RLAADTPTLAVIDMVLNDGRCTHLARELRQRGIPFLVHSSCRRDHRLTGDVEGAPWLNK
FT                   PALPYDVVTLLDELFLSSSTAVDVA"
FT   gene            84876..85589
FT                   /locus_tag="Mext_0075"
FT   CDS_pept        84876..85589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr2110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28503"
FT                   /db_xref="GOA:A9W7E0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7E0"
FT                   /protein_id="ABY28503.1"
FT                   /translation="MSQPQQSTVRNRLLKALSPSDFALLQPHLELIATELRQPLISPNE
FT                   PVKQLFFPVVGFSSITTQGSGGKVEIGIVGREGLVGAIPLLLGADRTPHDHFVQSPGEM
FT                   LAIRTEALCGAVNESASLHKLLLRFAQVQHVQTGQTAFVNARYQIEVRLARWLLMCHDR
FT                   LDGDELRLTHEFLATMLGTQRTSATLAVQALEGHRLIKAQRGRITILNRKALEDLADDG
FT                   YGLPEAEYARLIEGA"
FT   gene            85589..85849
FT                   /locus_tag="Mext_0076"
FT   CDS_pept        85589..85849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28504"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7E1"
FT                   /protein_id="ABY28504.1"
FT                   /translation="MPRYFFNVRHRPGPAGLAEDREGDELVDVAAAREQALSEAKAVIA
FT                   RDDRPATIRDWMDCSFEITDEDGQLVLTVPFSDTVQEQDED"
FT   gene            85897..86175
FT                   /locus_tag="Mext_0077"
FT   CDS_pept        85897..86175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28505"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7E2"
FT                   /protein_id="ABY28505.1"
FT                   /translation="MTCYTLQLTGDGLPSGAREVPLAELVSTYLRASAPRAFCDVCLAV
FT                   AVREPVEAVHRTVEGLTEPAQFTRKTGRCRTCRSTKRIVTRAERRRY"
FT   gene            complement(86210..86464)
FT                   /locus_tag="Mext_0078"
FT   CDS_pept        complement(86210..86464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr3136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28506"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7E3"
FT                   /protein_id="ABY28506.1"
FT                   /translation="MPRYFFDVHNGHFYPDTEGMECANFEQVRQEAMSALPEIARDAIR
FT                   SSGNDLQAFTVCVRDEANASIYTATLTFSGIRTSNPAAL"
FT   gene            87032..87292
FT                   /locus_tag="Mext_0079"
FT   CDS_pept        87032..87292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28507"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7E4"
FT                   /protein_id="ABY28507.1"
FT                   /translation="MLGECLTADVRENDELHQAELVHCLHLRQQRITRSHQRLVIKGLL
FT                   QPPPDRFQAAEVHHPAPRVERVGFELQVHSERVAVKEPAVR"
FT   gene            complement(88117..88515)
FT                   /locus_tag="Mext_0080"
FT   CDS_pept        complement(88117..88515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr6156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28508"
FT                   /db_xref="InterPro:IPR021341"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7E5"
FT                   /protein_id="ABY28508.1"
FT                   /translation="MRMLMLPLIDEATRELLLANGREPERDHRPVLKLFNPAGPASWLI
FT                   CAMEADGDTLYGLCDLGFGEPELGYVSLEELKEVSAGLAIGLERDLSFRGNHSVSVYAK
FT                   AARIAGRIVEDRDALQAAMGRASGRSVR"
FT   gene            88725..89294
FT                   /locus_tag="Mext_0081"
FT   CDS_pept        88725..89294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0081"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mag:amb4292
FT                   integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28509"
FT                   /db_xref="GOA:A9W7E6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7E6"
FT                   /protein_id="ABY28509.1"
FT                   /translation="MKQARVPTEAEFKRLVAVASQGRHGPRNRAALMLSYLAGLRVGEI
FT                   ASLRWGDLLDGGGKVREQLRLGAAVTKGGHARVVFLNARLRREIEQYRGTLGQPPALLQ
FT                   PVLITQKRSAFSANTLCQLMRSWYDQAGLDGGSSHSGRRWFITRLAHSGISPKAIMMLA
FT                   GHRHLSTTQRYIDVNDEMMRAAVEVL"
FT   gene            89423..90529
FT                   /locus_tag="Mext_0082"
FT   CDS_pept        89423..90529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0082"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   rpa:RPA3511 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28510"
FT                   /db_xref="GOA:A9W7E7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7E7"
FT                   /protein_id="ABY28510.1"
FT                   /translation="MRVAKLLIASCMLATGGTSMASAQFVDPFKVLEEAKRDRLERDRR
FT                   LAREAAERQQKEKVEQAAKVDAQRKLDQQRSAASPGTVPAAVSAEQAGTLLDHAPSSEV
FT                   RNPPVTASIAGSGASEPNQAEALAARGTAVTAALSPDPSTSTTNGVPSPSSIAASPSPV
FT                   DAPGAPLPTITAPGAANATPAPTQLRPLAAPARDMAKPAAAAPARVLITVDKATQRMRV
FT                   TVDGKLRYSWAVSTGRAPYKTPAGTFRPFRLEKEHYSREWDDAPMPYSIFFTAAGHAIH
FT                   ASNATRQLGRPASHGCVRLAPSHAAALFTLVRAEGPGATKVTITNGASAGRTARSRSAD
FT                   VRARGRAHHAQRGPSDIWQAGFGNAWTE"
FT   sig_peptide     89423..89494
FT                   /locus_tag="Mext_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.516 at
FT                   residue 24"
FT   gene            complement(90667..91758)
FT                   /locus_tag="Mext_0083"
FT   CDS_pept        complement(90667..91758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0083"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Sporulation domain protein; Lytic
FT                   transglycosylase catalytic; KEGG: xau:Xaut_3156 lytic
FT                   transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28511"
FT                   /db_xref="GOA:A9W7E8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7E8"
FT                   /protein_id="ABY28511.1"
FT                   /translation="MRYSRVLIMPNVFITLAAAAGAVVLTAPACAAPEAATETVEQALC
FT                   RLIESSAKARGLPVPFLTRLIWRESSFRLGALSPAGAQGVAQFMPGTAQERGLLDPFDP
FT                   EQAIPHAAHLLADLKRRFGNLGLAAAAYNGGAQRVTNWLAGSGGLPAETRAYVLGITGS
FT                   PVEDWRSSTSPDADPPEAKGADEQHMSGKPAEGAQRGKPAEAEAKAAGPTDAKRESKAA
FT                   EKPRVEQKVASPTCLQMTAALRIPSRAERFAERPPMRGDRDRRGWATSPVEKPVPPPWG
FT                   PWGIQLAANFSKALALQSFSQAQATYAKVIGRARPMIIGTRLRSRGTQAFYRIRLPAQS
FT                   REDADALCGKIRTVGGACIVLKT"
FT   sig_peptide     complement(91663..91758)
FT                   /locus_tag="Mext_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 32"
FT   gene            complement(92148..92423)
FT                   /locus_tag="Mext_0084"
FT   CDS_pept        complement(92148..92423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_4248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28512"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7E9"
FT                   /protein_id="ABY28512.1"
FT                   /translation="MSDTTDTVGVAGDRIRSIIERVERLDEEIKDLMETKKEIFGEAKG
FT                   EGLDVKVLKEILKLRKQDKDERDEQETLLDLYLRAMDAPAPMAEAA"
FT   gene            complement(92517..93680)
FT                   /locus_tag="Mext_0085"
FT   CDS_pept        complement(92517..93680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_1614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28513"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7F0"
FT                   /protein_id="ABY28513.1"
FT                   /translation="MSIHMGGHMVEGAVQADTREGLLFGERPNGSLVHISEVPSGLACN
FT                   CRCPNCGTPLVARRGEQLGHHFGHHNTKGERACAGGPETALHRFAKELLAAKLAFMLPP
FT                   LHRDGEGTARYAGGLHRFDTALLEHRLGAIVPDVIARRADRDLLVEFHVTHACDATKIA
FT                   KIASLGTAAIEIDLSGLALNAPRAELEVAILERAPRRWLHNPKLGWVGDVHGPVTNRIT
FT                   PASSRSLTALERAYASAYREALSTPSQSLARQRVEADGLAFAIGIEVAGIGCFTASPRD
FT                   WQAVILLNALEGALVGRSSIVSAKASLQQSRERGWLRPRFSRLTPAEAKALSAALPSYA
FT                   SPADAIAAWAMALSRQGILVPSSARGQWVIRRETLQRVREARQQKDS"
FT   gene            93748..93933
FT                   /locus_tag="Mext_0086"
FT   CDS_pept        93748..93933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28514"
FT                   /db_xref="GOA:A9VWL9"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWL9"
FT                   /protein_id="ABY28514.1"
FT                   /translation="MLNLSAPRALTFLVSLVLIGLAVASLYMRIPTIGPTVVKFRTWFF
FT                   VAAYAVLALGVVTKSL"
FT   sig_peptide     93748..93822
FT                   /locus_tag="Mext_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.976 at
FT                   residue 25"
FT   gene            94010..94405
FT                   /locus_tag="Mext_0087"
FT   CDS_pept        94010..94405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oan:Oant_1526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28515"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7F2"
FT                   /protein_id="ABY28515.1"
FT                   /translation="MPPREFERRFGLRRFWSTLASLDDFFGELPLLPDATELYEAVRHL
FT                   QPIILTGLPRGNWAEPQKRRWAKRHFPDVEVITTSAALKREHCHPGDALVDDREKYRHL
FT                   WEEAGGIFIHHRDAASSISELRAHAFL"
FT   gene            94529..95107
FT                   /locus_tag="Mext_0088"
FT   CDS_pept        94529..95107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bta:513668 similar to collagen, type XXVII,
FT                   alpha 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28516"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7F3"
FT                   /protein_id="ABY28516.1"
FT                   /translation="MKRRSARPFTVEVKHTRTSHASLADATARSRKGPDLWRGLPLNAG
FT                   DKPAEVRPTPVEPKPVAPAAPVQAEAPVRRVLPSLVPTFAMPVEPEATEERAAVVDERL
FT                   PRVRRPKQQLTKRRLAPAAQVSLMHRAAAKSAPQPRIVPVVTSPALADVPPVTAQPAPA
FT                   KGRAGRRNQQPKTLRLGERWKRRLPRILW"
FT   gene            95151..95393
FT                   /locus_tag="Mext_0089"
FT   CDS_pept        95151..95393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0089"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: rpa:RPA1852 putative transcriptional regulator
FT                   MucR"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28517"
FT                   /db_xref="GOA:A9W7F4"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7F4"
FT                   /protein_id="ABY28517.1"
FT                   /translation="MAEDVQMAADIVEQDRLVTLTTEIVTAYVTRNHVQAAELPGLLRS
FT                   VHAGLLRLSSGSGEPTEERRTLTAAEIRRSIRPEA"
FT   gene            95390..95767
FT                   /locus_tag="Mext_0090"
FT   CDS_pept        95390..95767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0090"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: ccr:CC_0933 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28518"
FT                   /db_xref="GOA:A9W7F5"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7F5"
FT                   /protein_id="ABY28518.1"
FT                   /translation="MISFEDGKAYKTLPRHLTKQGLTPEAYRAKWGLPVDYPMIAPAYS
FT                   AQRSRPALDLGLGRQRMLVTERAVGGLAEPMEVGEPQLAQAASSGIPTTTEVPRRAEQQ
FT                   TRSTKASRVSRSRMMAPLPNP"
FT   gene            complement(95764..96468)
FT                   /locus_tag="Mext_0091"
FT   CDS_pept        complement(95764..96468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0091"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase;
FT                   phospholipase/Carboxylesterase; BAAT/Acyl-CoA thioester
FT                   hydrolase; KEGG: aba:Acid345_1173 dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28519"
FT                   /db_xref="GOA:A9W7F6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7F6"
FT                   /protein_id="ABY28519.1"
FT                   /translation="MQSFTSGGRQIEVEWFAASSVMSAGEGPSSGRPAVLLLHGADGLT
FT                   YAEGYRFAARTFAASGYHVAFVHYLDRTGDRRVAYTRLRQDFPLWAETVRDAVAWLADQ
FT                   PGTDAQRLGIVGISLGAALAFTTAAAEPRVRAIVDYFGPLPDELARERPRLPPTLILHG
FT                   SADPMVPVSHARALERLLQEQGTAHEIRIYEGQGHGLTGPAQLDAAARVGRFLGQHLQT
FT                   AAAETGTSSARA"
FT   gene            complement(96638..97042)
FT                   /locus_tag="Mext_0092"
FT   CDS_pept        complement(96638..97042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_PB00061 putative cytochrome c class I
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28520"
FT                   /db_xref="GOA:A9W7F7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7F7"
FT                   /protein_id="ABY28520.1"
FT                   /translation="MQRRSWIATTVVVLILITAGGIGALWSLRQTQKSEFIKRLTGGDP
FT                   ARAPTLMIKYGCASCHDIPDLHGPSGRVGPSLHALSERVYIGGVTTNTPENLVRWITNP
FT                   KALSPRTAMPVTGISEAQARDVAAYLYVHQ"
FT   sig_peptide     complement(96968..97042)
FT                   /locus_tag="Mext_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.792) with cleavage site probability 0.456 at
FT                   residue 25"
FT   gene            complement(97029..97979)
FT                   /locus_tag="Mext_0093"
FT   CDS_pept        complement(97029..97979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_6905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28521"
FT                   /db_xref="GOA:A9W7F8"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7F8"
FT                   /protein_id="ABY28521.1"
FT                   /translation="MRAMRTGFSIRGLAPSSCIALTLVWSRDASAHGGDVGELWSTGAA
FT                   WTSDLRVLIPLYASALLFLLGTLRLWRRAGYGRGVRRWQVACFWSGWTVLALALLSPLH
FT                   WLGERLFTAHMIEHELMMAVAAPLLVLARPWGTMLWALPVSWRVPIGGTIRHAWLSGGW
FT                   RLASGPFAATLAHAVALWAWHMPGLYDLVLVNPLAHWLQHLSFLASALLFWGALLRGPA
FT                   RRRGYGVAFVYLFLTSLHTGLLGVLLTVSPRLWYPGQVAAAGEWGLTPLEDQQLAGLVM
FT                   WVPAGLVYTIAALVLAGLWIRHSGPLRARQAYATT"
FT   sig_peptide     complement(97884..97979)
FT                   /locus_tag="Mext_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.843 at
FT                   residue 32"
FT   gene            complement(98364..99014)
FT                   /locus_tag="Mext_0094"
FT   CDS_pept        complement(98364..99014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0094"
FT                   /product="putative cytochrome c oxidase subunit III
FT                   protein"
FT                   /note="KEGG: smd:Smed_6356 putative cytochrome c oxidase
FT                   subunit III protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28522"
FT                   /db_xref="GOA:A9W7F9"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A9W7F9"
FT                   /protein_id="ABY28522.1"
FT                   /translation="MSPLRTETRPFEAAPPRVARDLSDLPTYGFGPKSPMWWGTLGFFI
FT                   IEGMAFALALATYFYLVQQNAQWPLAPVPPDHWVGTLNTALLLASLWPNFVADRDAHRE
FT                   DLTRVRRDLVIMSLIALVTVALRLYEFAGLGVRWDQNAYGSITWVLLALHLTHLITDAG
FT                   DTLVLTALMFTRHAKGSAKGKRFSDVSDNAFYWYFVVGSWLPIYLTVYWLPRW"
FT   gene            complement(99011..100927)
FT                   /locus_tag="Mext_0095"
FT   CDS_pept        complement(99011..100927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0095"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I; KEGG: smd:Smed_6355
FT                   cytochrome c oxidase subunit I type"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28523"
FT                   /db_xref="GOA:A9VX44"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX44"
FT                   /protein_id="ABY28523.1"
FT                   /translation="MSDAATAARDLRDTSLDDPAFSARLARVWGTRKGIIGWLSSVDHK
FT                   VIGRRYIATAFLFLFLGGLAAIVMRLQLARPENKLVGPDTYNQLFTMHGSTMMFLFGVP
FT                   IGEAMAVYLVPLMVGTRNIAFPRLNAFSYWVYLSGGLFLWVSFMLNIGPDVGWFAYVPL
FT                   SGPEYSPGKRADVWAQMITFTELSGLCVAVEIIVTVLKQRAPGMSLDRIPVFVWALFIN
FT                   SFIIIFALPAVMIASTFLILDRLIGTQIFNPAEGGDSLLYQHLFWFFGHPEVYIIFLPG
FT                   TAFVSAIIPTFARREIFGYLALVLSLIATGFLSFGLWVHHMFTTGLPQLGAAFFTASSM
FT                   LIAIPNGLQIFCWIATLWDGRPVWRTPLLFVCGFFFIFVAGGLSGIMLASVPIDTQVHD
FT                   TYFVVAHFHYVLIGGNVFPLLGAIYYWFPKFTGRMLSERLGAWNFWLAFVGFNIAFFPM
FT                   HISGLMGMPRRVYTYGPEMGWGNLQLLSTAGALILFASFLVFLWNVVSSQRSGTLAGLN
FT                   PWDAGTLEWATASPPAPQNFDHIPLVTHRDPLWAEPGGLTVVTGLATSYRELVVTSVAE
FT                   AEPQLRETSPAPSIWPLVAALAVGATFIGSIFTPYAVLWGAPPIAAALTGWFWPKNTPE
FT                   DEE"
FT   gene            complement(100924..101928)
FT                   /locus_tag="Mext_0096"
FT   CDS_pept        complement(100924..101928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0096"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome c class I;
FT                   KEGG: smd:Smed_6354 cytochrome c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28524"
FT                   /db_xref="GOA:A9VX45"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX45"
FT                   /protein_id="ABY28524.1"
FT                   /translation="MSARRIIPALLALPLTGCNVVQSPLNPVSPQARDLLWLFWTFTGV
FT                   LAAIWLAVMLALAASLRARREAGADPLATDPQRERRTTILVTGLAVATGLVVLVLTGLS
FT                   YAGQRRLFGEEEAGVTIRVLGHQWWWELQYADADPSRSFSTANEIHVPVGVPVLLNLES
FT                   TDVIHSFWVPSLMGKVDLIPGRTNTLRFTAERAGIYRGQCAEFCGLQHAKMGLLVIAEE
FT                   PDAFERWRAAQIRPRVQPNQDESKAGEAAFVAAPCSMCHQVRGTSAAGRNGPELTHVGS
FT                   RLTLAAGTLPMSRGNLAAWIVDPHGIKPGVNMPLVKLDPGALNTISAYLEGLK"
FT   gene            complement(101936..102499)
FT                   /locus_tag="Mext_0097"
FT   CDS_pept        complement(101936..102499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0097"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: smd:Smed_6353
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28525"
FT                   /db_xref="GOA:A9VX46"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX46"
FT                   /protein_id="ABY28525.1"
FT                   /translation="MSWRATLLFASVLALAGCQREDREARPSPVGSETQEQVALVTLSP
FT                   GEQEPTTYTSGKAREFEGNAYHLSQGKKLFTWFNCNGCHGGGGGGIGPALIDDRWIYGG
FT                   SIENIVQTIREGRPNGMPSFRGRLPDDQIWELAAYVRSMSGNAPTSAAPARSDTLHPHP
FT                   SENRTSPSPPVSGGIVPPSGEMPK"
FT   sig_peptide     complement(102449..102499)
FT                   /locus_tag="Mext_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.796) with cleavage site probability 0.591 at
FT                   residue 17"
FT   gene            complement(102496..103332)
FT                   /locus_tag="Mext_0098"
FT   CDS_pept        complement(102496..103332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0098"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="SMART: extracellular solute-binding protein family
FT                   3; KEGG: smd:Smed_6352 extracellular solute-binding protein
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28526"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR022448"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX47"
FT                   /protein_id="ABY28526.1"
FT                   /translation="MTSSFLKVRRAFMVSATFFAWSGVEARELRVCADPNNLPFSNQAR
FT                   EGFENRIAEVIARDLGATLTFTWWAQRRGFLRNTILAGRCDLVTGIPVGLEMLRPTRPY
FT                   YRSAFVFIARADGPTITSLDDPELARRTVGVQLAGNNAAGTPPAQALARRGLTQNVRGY
FT                   VLTGDYEKPNPPARIVEAVATGEVDVALAWGPMAGYFAARSTPPLRISPVEPLLDGPKG
FT                   PMVFDIAMGVRREDEDLRREVGAALERNRTQVDAILAAYDVPRLDVLRDQSAAATP"
FT   sig_peptide     complement(103252..103332)
FT                   /locus_tag="Mext_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.708 at
FT                   residue 27"
FT   gene            complement(103313..105130)
FT                   /locus_tag="Mext_0099"
FT   CDS_pept        complement(103313..105130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0099"
FT                   /product="PQQ-dependent dehydrogenase, methanol/ethanol
FT                   family"
FT                   /note="TIGRFAM: PQQ-dependent dehydrogenase,
FT                   methanol/ethanol family; PFAM: Pyrrolo-quinoline quinone;
FT                   KEGG: smd:Smed_6351 pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28527"
FT                   /db_xref="GOA:A9VX48"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX48"
FT                   /protein_id="ABY28527.1"
FT                   /translation="MRSIVTAAVALFVFPLSPVVLAQGATVSGRSEHPKPPSSAAPRDD
FT                   GQWTMPAKNFASTRYSDLAEITPDSVKNLRVNFTFSVGVNRGQESSPLVIDGTMFVLSP
FT                   YPNILYALDLTKPGAPLKWQYNPKPEAAAQGVACCDVVNRGPTFADGHIFFNTLDGNVV
FT                   SVDAATGQEAWKTKVGNIHVGETMTMAPLVARGKVFVGNSGGEFGVRGWIQALDQQSGK
FT                   VAWKAFNTGPDKDVLIGPEFKPFYDMDKGQDLGVKTWPPQAWEQGGGTVWGWLSYDPDL
FT                   NLLYHGTGNPGPWNADQRPGDNKWTSGIFARDAETGQARWFYQWSPHDLYDWDGINEQI
FT                   LLDMTWKGQPRKVLVRPERNGYVYILDRTTGEVLSAKPFHAITTTTGVDLKTGRLQYIP
FT                   EKKPQMGKVMRDICPNASGAKDWSPSAYSPRTGLIYLPHTNLCMDEEHMQANYIAGTPY
FT                   LGSETRMKAGPGGHRGVYTAWDVARERAAWSIKEEFPVWSGTLVTAGDITFYGTMDGWF
FT                   KAVNARTGEVVWQFKTGSGIIGQPTTYRGPDGRQHVAILSGVGGWPGVVVSADLDPRDA
FT                   TGALGFLNAMRDLKKVTTKGGMLYDFVLP"
FT   sig_peptide     complement(105062..105130)
FT                   /locus_tag="Mext_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 23"
FT   gene            105565..105888
FT                   /locus_tag="Mext_0100"
FT   CDS_pept        105565..105888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28528"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX49"
FT                   /protein_id="ABY28528.1"
FT                   /translation="MGCHALKAASGDHLNRATEIGMADQKAFRPTSAEKAFPEPIEGDF
FT                   MLPFCVPGAEILMGKDLAAIVVPTQERQRVGIPMDLQTVSDLYALLGEALRMLQAPEDG
FT                   SVQ"
FT   gene            complement(105966..107288)
FT                   /locus_tag="Mext_0101"
FT   CDS_pept        complement(105966..107288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0101"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mag:amb3777
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28529"
FT                   /db_xref="GOA:A9VX50"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX50"
FT                   /protein_id="ABY28529.1"
FT                   /translation="MSTPANAPGERYQLFRRAGSTRWQVRFSIKGQGQFKRSLDTEDRR
FT                   EAERKAEAIWYEATYRAKQGLTAKTHTFDSVAEAYIAQILREVERGERRADQGKSEPAV
FT                   IRRYFVGYFGDKPIDAVTEADLERYAEWRRTYWTEGPGKLITHIEYERDGHRLRRPVRR
FT                   SAPSLSRQRGETVVLRGLLRWAARQGYMKTPPEISIKARRSPDNRRPSFEPHEFARLEA
FT                   VSLSRLVDPIMDGTGAEVRACDRRSWRIKRLDDHTRRDRTVLHAYVMIGAFSGLRPTEM
FT                   YNLTWGDVLGYRAGRKKSVDDRDIRLQVRGKGKSGKAIPQKAAIPWFDTLWMLFERSMG
FT                   GEPADADPVFASETGKRITSVANGFTELLKAAGLERDHRGIKRTPYSLRHFYISEQLAN
FT                   GAEVLDVARNCRTSLVMIDKHYGQVRLERVLDRLRPEWTRA"
FT   gene            complement(107628..108626)
FT                   /locus_tag="Mext_0102"
FT   CDS_pept        complement(107628..108626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0102"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rpe:RPE_3641
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28530"
FT                   /db_xref="GOA:A9VX51"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX51"
FT                   /protein_id="ABY28530.1"
FT                   /translation="MNDNRTHSIEPHTRRRSWLAPALVGAAAALGASALYAASKTREAE
FT                   QRYPPVGQFMTVDGVRLHYFEQGHGDPLVLIHGNGTMIQDFLVSGIVDELAKRHRVIII
FT                   DRPGYGYSERPRALWTPRAHATLYQTALERLGVSQAVVLGHSWGSLVAVALALQAPQLV
FT                   RSLVLASGYYYPTLRADVFLFSPPAIPVIGDVMRYTVSPVIGRLILPGLIKAMFAPADV
FT                   PERFDRLMPKELMLRPSQLRAAAEDAALMTPVTVELQQHYRELTLPVVIIVGADDQIAD
FT                   VGRQSERLHRELPGSEFIAIPGQGHMIHHLAPDQVIGAIERAFERAPANPA"
FT   sig_peptide     complement(108513..108626)
FT                   /locus_tag="Mext_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 38"
FT   gene            108935..109156
FT                   /locus_tag="Mext_0103"
FT   CDS_pept        108935..109156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dra:DR_1067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28531"
FT                   /db_xref="GOA:A9VX52"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX52"
FT                   /protein_id="ABY28531.1"
FT                   /translation="MRFVAATLLTLLVTAPALAQATNPTTNAPQTTSASKDNDNDFDMG
FT                   WLGLIGLAGLAGLMRGNKRHDTTTTRVH"
FT   sig_peptide     108935..108994
FT                   /locus_tag="Mext_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.852 at
FT                   residue 20"
FT   gene            109706..110512
FT                   /locus_tag="Mext_0104"
FT   CDS_pept        109706..110512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0104"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   xcb:XC_1017 lipase/esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28532"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX53"
FT                   /protein_id="ABY28532.1"
FT                   /translation="MLKTRRNIACCALTVAALFVSSLAEAASGFKQIVVLGDSLSDNGN
FT                   AGRFTNGPVWVEYLAERLGIVLRPSRKGGSNYAIGGARLDPHSGSDSLQAQADAYLRGS
FT                   RVSSGTLYIVYGGANDVLGAIGSPQADMMIDAAANSLRDILTKLAEDGPVDILVPNLPD
FT                   VSITPAVQGQRGAAVERATELTMRFNRQLEQALTQVQGARTYRLDVAHLAEQVRKDPSA
FT                   LGFINTTAPCDQKSACEGYLFWDGVHPTTRAHERLAGAAFQLISAP"
FT   sig_peptide     109706..109786
FT                   /locus_tag="Mext_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 27"
FT   gene            110845..111471
FT                   /locus_tag="Mext_0105"
FT   CDS_pept        110845..111471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0105"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   mms:mma_2302 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28533"
FT                   /db_xref="GOA:A9VX54"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX54"
FT                   /protein_id="ABY28533.1"
FT                   /translation="MFEWIVDVLAQAGYLGVALLMLAENLFPPIPSELIMPLAGFVAAR
FT                   GDMSLTGVIAAGTLGSVLGALPWYWAGRKFGPERLKRLAGRHGRWLTVSPSEVDRARDW
FT                   FNKRGRVGVLLGRLVPAVRTLISVPAGLAGMPMLPFLIYSTIGTLVWTTLLAVAGYWLQ
FT                   DRYEEVSAYVDPVSKCIVGLIVVTYLYRVVTWQPDIASADPDQAH"
FT   gene            complement(111509..113017)
FT                   /locus_tag="Mext_0106"
FT   CDS_pept        complement(111509..113017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0106"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   rha:RHA1_ro05030 possible phospholipase D alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28534"
FT                   /db_xref="GOA:A9VX55"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX55"
FT                   /protein_id="ABY28534.1"
FT                   /translation="MQDLSGTTSTLDLGRTCWRIARADRFALIVDAANYFATLRHAMIQ
FT                   ARESILLIGWDFDTRVALTIDEDGEWPTTLGPFIDALVDRRPGLDIHVLKWDLGILGTL
FT                   GRGTTPLFVLDWVTDERIHLQLDRVHPVGACHHQKIVVIDDAIAFCGGIDITVGRWDTR
FT                   QHLDEDARRKSPWGFAQPPWHDATTAVDGEAARTLGELARLRWKQATGECLKSPSRQSG
FT                   DRWPKDLQPTFTNVEVGIVRSQPTHGEEGEAREIEAYLLAAIGRAQRLIYIESQYFASD
FT                   IVSHAMLERLREPHGPEIVVINPCTSEGWLEEQVMGSARRLILERIYQADHAGRFKMYY
FT                   PVTAKETPIYVHAKILIVDDQILKVGSSNLNNRSMGLDTECDLVVEAAGDAAVAEMIEQ
FT                   SIREVRHDLLAEHLGTTRAEVAAVEKRQAGSQLSTIETLRLAPGRTLVPLTPEPITAAE
FT                   RALAAHHALDPARPEPISRHLGALASSAVDAVRVAVLGKDASRT"
FT   gene            113414..113629
FT                   /locus_tag="Mext_0107"
FT   CDS_pept        113414..113629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28535"
FT                   /db_xref="GOA:A9VWK2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWK2"
FT                   /protein_id="ABY28535.1"
FT                   /translation="MQGGGDLRAELRDERLRQEIFYSLREAQVVIGPWQNIYNRVRPHS
FT                   SLGYRPPAPVSFPDLAFRLPMATTMQ"
FT   gene            113859..115721
FT                   /locus_tag="Mext_0108"
FT   CDS_pept        113859..115721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0108"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: rpa:RPA2075 putative signal transduction
FT                   histidine kinase with GAF and PAS/PAC domains; TIGRFAM: PAS
FT                   sensor protein; PFAM: HWE histidine kinase; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28536"
FT                   /db_xref="GOA:A9VX57"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX57"
FT                   /protein_id="ABY28536.1"
FT                   /translation="MGSRNSLEWPPGSSEMAERIRAHDWSGSPLGSAGRWSPRLKLAVE
FT                   MMLTNPLAASLVCGPERLLIYNDAAATLIGGQHPAALGQPLPHTFPAGRAAAEPFFQRA
FT                   FAGEVIQVHGQALSMCCEGQANADVSDAILMPVRDEDGQVAYVHMICTENGGRARAETI
FT                   ARQSDEQLAAIFGSAAVGLSELAQDGRFLRANDELCRILGRTREEVLRLTVMDVTYHDD
FT                   VPPSLIAVAEALRTNHPASLDKRYLRPDGSFVWANSRVQPLHHEGEPSTLLAVTADLSE
FT                   RRHTEERLRESEERFRALANLVPVILWRSDASGLTFSENQSFLDYTGQTADEVQDFGWL
FT                   APMHPHDRRGVQEAFVHGIDTKQPIDAQFRLRSRDGQYRWFLARQVPIFGGEGQVTEWF
FT                   GAAMDIHELHELQQRQAVMVDELQHRTRNLLTVVRAIAQQTMAQTGPTVLFREQFNDRL
FT                   AALSRVQGLLSRSDQEPITIRALVEMELDALGATDMGERIAVEGPRVVLRKGSVQTLAL
FT                   ALHELATNARKYGALSCEQAELWVSWDTYIAEAGEQRLALTWLEEGICRSRQSNPVRRG
FT                   YGRELIEKALPYTLKAHTDYELGENELRCSIDLPLTELAGTRAQ"
FT   gene            115718..116080
FT                   /locus_tag="Mext_0109"
FT   CDS_pept        115718..116080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0109"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; KEGG: rpa:RPA2074
FT                   response regulator receiver (CheY-like protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28537"
FT                   /db_xref="GOA:A9VX58"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX58"
FT                   /protein_id="ABY28537.1"
FT                   /translation="MTSAANHWVGCRVLLVEDDYLIANAMDAEFEALGAEVIGPAASVK
FT                   TALELIAAHELDAAVLDINLHEVMSYPVAEALLTLGVPFVFATGYNKAALPERYAHVPH
FT                   CEKPVEPSQLARALFV"
FT   gene            complement(116695..117162)
FT                   /locus_tag="Mext_0110"
FT   CDS_pept        complement(116695..117162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0110"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_0358 signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28538"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX59"
FT                   /protein_id="ABY28538.1"
FT                   /translation="MFIDECDLSPPDRGWNYEPSRAELLQKISAPLYTTDAEGWLTYYN
FT                   DAAAELWGRHPVIGEERWCGSWRIYDTDGKLLAREQWPLAITFQQSRAVHGLQAVLEQP
FT                   DGTRVPVMPHPTLLRDRSGIVVAGSNILLKITQPSALHSQISDPSNTELWV"
FT   gene            complement(118719..119402)
FT                   /locus_tag="Mext_0111"
FT   CDS_pept        complement(118719..119402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0111"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   xcb:XC_2149 succinoglycan biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28539"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX60"
FT                   /protein_id="ABY28539.1"
FT                   /translation="MRSRSWLLVLLLATPAHAEPFVGRASIVDGDTLDVRGTRIRLHGI
FT                   DAPESAQLCKDAGGKDYRCGQAAALALADHIGKRLVTCDPRETDRYGRVVAVCRADAED
FT                   LNAWMVGQGHAIAYRRYTEDYVNTELTAKALRHGIWAGTFQDPSEWRRAKRAGGERSRP
FT                   ETVTPPNKASGCNIKGNISAGGERIYHLPGSRDYERTRINDRAGERLFCSEDEAKVAGW
FT                   RATRG"
FT   sig_peptide     complement(119346..119402)
FT                   /locus_tag="Mext_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            complement(119435..119584)
FT                   /locus_tag="Mext_0112"
FT   CDS_pept        complement(119435..119584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28540"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX61"
FT                   /protein_id="ABY28540.1"
FT                   /translation="MNVERYKALGGLRPNSSPCWYLGVTAWANIHEACTAFIERSSVEA
FT                   VRPG"
FT   gene            complement(121179..121661)
FT                   /locus_tag="Mext_0113"
FT   CDS_pept        complement(121179..121661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0113"
FT                   /product="PAS sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: PAS fold-4 domain
FT                   protein; PAS fold domain protein; KEGG: aeh:Mlg_1833
FT                   PAS/PAC sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28541"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9VX62"
FT                   /protein_id="ABY28541.1"
FT                   /translation="MTVTIVELVRMFAEPLDLAIVLTDIDLERPGPTILYANPAFARMS
FT                   GYAAQEVLGNSPRLLQGSGTSREATRMVARALRAEGRFRGVLQNYRKSGEAYLCEIDVR
FT                   AILDRAGRPEVFIAFEREVVRRRGRPSLDAAGRYRPLTQTSPACPAPLSAGTDLFT"
FT   gene            121875..122327
FT                   /locus_tag="Mext_0114"
FT   CDS_pept        121875..122327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0114"
FT                   /product="BLUF domain protein"
FT                   /note="PFAM: BLUF domain protein; KEGG: tel:tll0078
FT                   phototaxis regulatory protein PixD"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28542"
FT                   /db_xref="GOA:A9VWG7"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWG7"
FT                   /protein_id="ABY28542.1"
FT                   /translation="MIHQLVYYSRNTVQGDGRAMLTNMREILSASQRNNSRDGITGFLI
FT                   FDKTWFVQILEGERAQVTETYNRIAKDTRHSTATIMNVRDVQDRLFPNWTMGGAMRTPE
FT                   VQEVYLQHGFGGPLEPSRLKSDQIIRLALDLQAFEVDRRQGQRLAS"
FT   gene            122428..122658
FT                   /locus_tag="Mext_0115"
FT   CDS_pept        122428..122658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0115"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1778 hypothetical cytosolic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28543"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWG8"
FT                   /protein_id="ABY28543.1"
FT                   /translation="MAPSPSWESIGGIGLLEGMIKAARPVMPGKERVFPPWQGMQYMRD
FT                   MYSGDGKLAPLDNDRYPGIAWTGVRQVLATR"
FT   gene            complement(122986..123396)
FT                   /locus_tag="Mext_0116"
FT   CDS_pept        complement(122986..123396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0116"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   rpa:RPA1994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28544"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWG9"
FT                   /protein_id="ABY28544.1"
FT                   /translation="MLSRRMFTGCAICAAIGFAADDALAQAPNGIKRKIASRIDGPIEG
FT                   YETLEVFVDIEPNFIIDWHTHPGTEAAYTLEGDGELHIKGETTKMLKPGFSWLTPSETP
FT                   HTLKNGSQATKLFVTFTVQKGKPLSTPVPAPT"
FT   sig_peptide     complement(123337..123396)
FT                   /locus_tag="Mext_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.807 at
FT                   residue 20"
FT   gene            complement(123900..124142)
FT                   /locus_tag="Mext_0117"
FT   CDS_pept        complement(123900..124142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:pRL120640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28545"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWH0"
FT                   /protein_id="ABY28545.1"
FT                   /translation="MHFERDTRGDWVIDPEQLAFKLGINAAHLRHEMRLGLVTSRIEAG
FT                   QGTDEGYWRVTIRTRKAAWQGIIDDAGCLVSERCP"
FT   gene            complement(124232..124558)
FT                   /locus_tag="Mext_0118"
FT   CDS_pept        complement(124232..124558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28546"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWH1"
FT                   /protein_id="ABY28546.1"
FT                   /translation="MNIHIAYAVPALVLGLLSPAAIAQSLPAPAGPPPVMDPGGFEGRN
FT                   GLSNSLRERQHGVAPDNDLTTGSVVPPAKTQEEAPPNRWRGIERYRKGNDLPLNGDRTQ
FT                   SGDL"
FT   sig_peptide     complement(124487..124558)
FT                   /locus_tag="Mext_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            125064..125693
FT                   /locus_tag="Mext_0119"
FT   CDS_pept        125064..125693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0119"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: ccr:CC_1766
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28547"
FT                   /db_xref="GOA:A9VWH2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWH2"
FT                   /protein_id="ABY28547.1"
FT                   /translation="MPEVVTVPTSTRVPWNRGRIVGLKQPLKPKHIWALRTRLRLANRT
FT                   RDLALFNLAVDSKLRGCDLVRLRVSDIHLGDAVRLRATVCQRKTGRPVPFEITEPTREA
FT                   LKAWLTARRLKAGDWLFPSRSRLGEHLTTRHYSRLVDRWVALIGLDPSAFGTHSLRRTK
FT                   VALVYKRTGNIRACQLLLGHTKLESTVRYLGIEVDDALILSEQTEI"
FT   gene            complement(125636..126253)
FT                   /locus_tag="Mext_0120"
FT   CDS_pept        complement(125636..126253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28548"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWH3"
FT                   /protein_id="ABY28548.1"
FT                   /translation="MVKIGALLKAVGWFVNDERVERIWRRDGFKVPARQPKKGRLWDRD
FT                   GSCIRLKPERRDHVCSYEFVEARTHEGRKFRMLNVVDEFTRECLAIRVSRKLKAADVID
FT                   VLPDLFILRGVPGHVRSDTTQGEHGTIMDHDLLMSWPLLSSPLLHSERTSEPARLKVRN
FT                   GSFGTLEGDHPAGTPRPFPPRRPVQISVCSERISASSTSMPR"
FT   gene            complement(126855..128168)
FT                   /locus_tag="Mext_0121"
FT   CDS_pept        complement(126855..128168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0121"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   har:HEAR3278 putative oxalate/formate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28549"
FT                   /db_xref="GOA:A9VWH4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR026355"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWH4"
FT                   /protein_id="ABY28549.1"
FT                   /translation="MTAHVPVSHDTAIASSMLDKADRPPLGRWGQLFLGVLCMSMIANL
FT                   QYGWTLFVDPIQQKFGWDRTAIQLAFTIFVLTETWLVPIEGWFVDRYGPRIVTVFGGIL
FT                   CGIGWVMNSYADSLWLLYVAAAISGIGAGAVYGTCVGNALKWFPDRRGFAAGLTAAGFG
FT                   AGSALTVIPIAYMIKESGYQHTFLVFGIGQGVIVVLAALLLVAPRAGFKDRMLAGKPVV
FT                   NTTSRQQYSPREMVRTPVFWVLYFMFIMMAGGGLMAAASLAPIAKDFNVAGVPVSLLGL
FT                   TLPALTFALTIDRVLNGVTRPFFGWVSDHIGRENTMIIAFLIEGMGILALGMFAHIPIA
FT                   FVLLTGLVFFAWGEIYSLFPATCTDTFGDQNAAANAGLLYTAKGTSALLLPVLLSIQAY
FT                   AGNWQIVFYLASGMAFTSAFLAMFVLKPMRARFIARSM"
FT   gene            complement(128592..129257)
FT                   /locus_tag="Mext_0122"
FT   CDS_pept        complement(128592..129257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0122"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: nwi:Nwi_2917 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28550"
FT                   /db_xref="GOA:A9VWH5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWH5"
FT                   /protein_id="ABY28550.1"
FT                   /translation="MGQVLHGSATTTETVRRAIQARQESVRAAAKRYGINPTTLQKWRS
FT                   RQTSTDARMGPKEPRSSVLSLEDEAVIVAFRRHTLLPLDDCLCALQPSLPHLTRSSLHR
FT                   CLQRHDISRLPEVDGDKPKRSRFKAYPIGYFHIDIAQVSTEQGKLHLFVAIDRTSKFAF
FT                   VQLHGRATQRIAAAFLHDLVAAVPYTIHTVLTDNGIQFADNHPADEEAEAKAAAWPAP"
FT   gene            130415..132493
FT                   /locus_tag="Mext_0123"
FT   CDS_pept        130415..132493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0123"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: pst:PSPTO_1490 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28551"
FT                   /db_xref="GOA:A9VWH6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWH6"
FT                   /protein_id="ABY28551.1"
FT                   /translation="MADAMGREAAFLTGGEMGARMRAHDWSRSPIGPLEAWPAPLRMAA
FT                   SLMLNSAFPMFIAWGRELGFIYNDAYAEILGNKHPAALGCPFEVIWSEIWPDINPLIQR
FT                   AMAGEATFSADLPLRMMRRGQYEDTWFTFSYSPVREEDGRVAGMFCCCVETTAGVRSQA
FT                   ELAELNIDLERQVTERSRERDRLWRNTQDIQVIIDGAGVFHAVNPAFTAILGWTPEDVI
FT                   GRPVFDFVLPDDEALTSRALEHARVESLPVVENRYRHKNGGFRWISWVAAPEAKLIYAS
FT                   GRHITAEKEQAEALSRTEEALRQAQKMEAVGQLTGGLAHDFNNLLAGISGSLELMQTRM
FT                   QQGRLTDVDRYMTAAQGAAKRAAALTHRLLAFSRRQTLDPKPTDVSRLAMGMHELIQRT
FT                   VGPGILVEVVGATGAWPALVDPPQLENALLNLCINARDAMPDGGIITIETANKWMDERA
FT                   ARQHDMPEGQYLSLAVTDTGTGMPPEVVARAFDPFFTTKPIGEGTGLGLSMIYGFAQQS
FT                   GGQVRIYSEVGQGTTVCIYLPRFYGVVEDDTAGEQIAELPRSEAGETVLVVDDEPTVRM
FT                   LITDILEDLGYAAIEAGDSATGLKVLQSDVRIDLLVTDVGLPGGMNGRQMADAARNHRP
FT                   DLKVLFITGYAENAILGNGMLPPGMAVLTKPFAMDNMAARIRSMIEAGRETRLQRRS"
FT   gene            complement(133225..134925)
FT                   /locus_tag="Mext_0124"
FT   CDS_pept        complement(133225..134925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0124"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   azo:azo1033 long-chain-fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28552"
FT                   /db_xref="GOA:A9VWH7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWH7"
FT                   /protein_id="ABY28552.1"
FT                   /translation="MDFRPTDMSNVWLTAYDRGVPEHVEVAQFSSLVDMFERTVERFQE
FT                   RPAFSNMGRVITYGALDEASARLAHHLRNVLGLQPGERVAIMLPNLLQYPIAFFGVIRA
FT                   GLVVVNVNPLYTAPELEHQLRDSGACTIIVLENFCATLQVALRTVDVPNVIVTRVGDEL
FT                   ARPKAILTDLVVRHVRRLIPRWHIAGAMQWRRILSVRVKPNLPQVETGLNDIALLQYTG
FT                   GTTGGAKGAVLTHGNVLANALILGAWFAAVGTHKGEKYLVALPLYHALALICQVVNRFI
FT                   LGGCGVLITNPRDLNGLVAEMRRHRFRSLAGVPSLFQALAQHPDIGKVDFSETVACCSG
FT                   GAPLPLVVAEVWKSATGLTIVDGYGLTEAAGVAVMNPLGARPQRSGIGVPVCSTEIEIR
FT                   REDGSVAASDEPGEIYVRGPQVMRGYHNQPEETARAIDAGGFLATGDIAAMGRDGYLTL
FT                   IDRKKDMAIVGGFNVFPSEVDDVLLRHPGIREAAVVAVPDAHSGEAILACVVRQNPHLT
FT                   EAEVIAHARASLTGYKVPRRVVFLDVLPKTPVGKVLRRVLRDALVEPGQ"
FT   gene            135015..135866
FT                   /locus_tag="Mext_0125"
FT   CDS_pept        135015..135866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0125"
FT                   /product="porin"
FT                   /note="PFAM: porin; KEGG: xau:Xaut_2469 porin"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28553"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWH8"
FT                   /protein_id="ABY28553.1"
FT                   /translation="MLKTVLARSAAAFVSTAAVAADLPQREQTPVFAQIPAFTWSGFYA
FT                   GIAAGYAFSGRQTVRTTDFTPIGQAVLAASGFGAVRSEQEGATVAGGFGYNYQFTPGTG
FT                   FVAGIETDIQYTDLDSSRATSASVGGTTFFLSGRQSLNFLGTVRGRLGYAFNRVLVYGT
FT                   GGFAYGNVNYEINANVTSALGTIPFDAGRFNNVETGYVYGGGVEYAMPTESFLNFFSAN
FT                   AVIIKAEYLHYDLGSRSVFNSGVGPVFGPGGSLAVGLTSVSRFRTEGNIVRAGVNYKFG
FT                   TY"
FT   sig_peptide     135015..135077
FT                   /locus_tag="Mext_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 21"
FT   gene            complement(135978..136916)
FT                   /locus_tag="Mext_0126"
FT   CDS_pept        complement(135978..136916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0126"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: acr:Acry_0629 alpha/beta hydrolase fold-3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28554"
FT                   /db_xref="GOA:A9VWH9"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWH9"
FT                   /protein_id="ABY28554.1"
FT                   /translation="MTDQHWQAWPHLDTSLRARVLTWVVRQTIRPRLGAMSNIERVRKT
FT                   FNLSLFPQPRGVEYESGSVGGVPGEWVRPRAGAAGLKILYIHGGGFIACSPKTHRPVTG
FT                   AFARRGFTVFVPDYRLAPEHPFPAAIDDAVAVWRSFAAEGPAFVVGDSAGGNLALVLMV
FT                   RARDESLPAPLAAVLFSPWTDLLGTGTSHKANAKRDALFSPVALRQVAATYLGAADPSQ
FT                   PFASPLYADLTGLPPLLIHCSESELLRDDAIQLAAKAQSVGVRVSLNVFPVVGHVWQFA
FT                   HSVVPEARRSLDEAASFLRQAFKSSSAATEF"
FT   gene            137062..137319
FT                   /locus_tag="Mext_0127"
FT   CDS_pept        137062..137319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gox:GOX2659 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28555"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWI0"
FT                   /protein_id="ABY28555.1"
FT                   /translation="MMLSDALWAELELLVEACRPKVKTPPQDLRRTLPAILWHQNGAKW
FT                   RAIPEDLGPWWRAAQIFIPLGARRCAVSLPKISRVRKFDT"
FT   gene            complement(138067..138988)
FT                   /pseudo
FT                   /locus_tag="Mext_0128"
FT   gene            complement(138930..139136)
FT                   /locus_tag="Mext_0129"
FT   CDS_pept        complement(138930..139136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_2415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28556"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWI1"
FT                   /protein_id="ABY28556.1"
FT                   /translation="MNRDAAEALFFDTARDLRYAWLAWPAQVAIIMADELKIDARTLTT
FT                   VLTAHVHQHLAELGEPDVDLPRP"
FT   gene            complement(139133..139369)
FT                   /locus_tag="Mext_0130"
FT   CDS_pept        complement(139133..139369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28557"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWI2"
FT                   /protein_id="ABY28557.1"
FT                   /translation="MRAQDGNSATHAEAAPKPAPKPAPDPKPRPSPLETGEDQEEPFDR
FT                   DNPNLPTAIAVRRKGTGSACTGSRSSSETAASS"
FT   gene            140434..141507
FT                   /locus_tag="Mext_0131"
FT   CDS_pept        140434..141507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0131"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   pde:Pden_2124 hemolysin-type calcium-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28558"
FT                   /db_xref="GOA:A9VWI3"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWI3"
FT                   /protein_id="ABY28558.1"
FT                   /translation="MGITEDDKFYYIIGDDHNSTVDYTTSSKAIQVKAGGGDDTIYGST
FT                   ADDFIYGDGGNDTIFGGYGKDYLSGGDGDDLITNGGQQPLHTGNDYVSGGAGKDTLYFL
FT                   NSLDGVALYGDEGDDSIQGGMAADIIYGDSEVDGASDGNDYIRGGEGADLIYGGGGADT
FT                   IRGSYNDGSDKVYGGTGDDLIVYTNDLSAVTLYGDEGNDTINGGFGDDKIFGGADNDTL
FT                   SGGYGNDAIDGGTGADLLDGGSGADVLTGGSGADVFMFTTKFGNGNVDHIADFSTGDKI
FT                   YLAKGLISGSKAGPFLESAFKDLSLGSLDANDRVLYNQTSGELSYDADGSGSAAKAVVF
FT                   AVLDNHASLTFQDFLIG"
FT   gene            142801..143355
FT                   /locus_tag="Mext_0132"
FT   CDS_pept        142801..143355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0132"
FT                   /product="sigma-70 region 2 domain protein"
FT                   /note="PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   mes:Meso_3107 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28559"
FT                   /db_xref="GOA:A9VWI4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWI4"
FT                   /protein_id="ABY28559.1"
FT                   /translation="MDTLIAGGLGLATGQPVALSPSSLPAAVRDHLGHQLQAAYGALIA
FT                   VQPPQRLLDLIAQLYSALSTHDQESAASFRHGLIEAVPGLQAFAMSLVANEVRTGDLVQ
FT                   ETLLKVWAKQATFVPGTNLKAWLCTILRNHFYSEIRKYKREIEDADGAMALQLQAPASQ
FT                   EHGSDLQVVMVCVGGEILSLP"
FT   gene            144084..144590
FT                   /locus_tag="Mext_0133"
FT   CDS_pept        144084..144590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0133"
FT                   /product="regulatory protein MarR"
FT                   /note="PFAM: regulatory protein MarR; KEGG: mxa:MXAN_0654
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28560"
FT                   /db_xref="GOA:A9VWI5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWI5"
FT                   /protein_id="ABY28560.1"
FT                   /translation="MNQPARRLQPTTTANQADEATQGPDVLPLDRQLCFSVYAAAHAFT
FT                   AAYKPLLEPLGLTYPQYLVMLALWEEDGQSVKRIATRLRLDSGTVTPLLKRLERDGLLR
FT                   RGRDPADERHLRVELTEAGQALRRKAAAARERIVCALGGTEEPIQALKREIDRIIPLLE
FT                   CPDSD"
FT   gene            complement(144709..145473)
FT                   /locus_tag="Mext_0134"
FT   CDS_pept        complement(144709..145473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28561"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWI6"
FT                   /protein_id="ABY28561.1"
FT                   /translation="MLRGHAARHAVLALTASCLVLGSALHAQAAGEGDFGGLFQQLFSP
FT                   QPTPAAQPIAPFVDQTSSSGQVNSGPGLARRAKGRWDERQSARRRQLKEPQAQVKPKVR
FT                   YASLPKVAKVAAPSDKEQRPTAALDLRRYAGDPDAAFMHDSTLRKGDIVITTSGPKVFK
FT                   GKTGERHAATEFELAGRSSAVDRKTRKLLAAMVTPYGALPAYEADKLLAKQRRLSDPSS
FT                   ASAGQQVQTANLRVVYPSGLQGAAVRVSLQGN"
FT   sig_peptide     complement(145384..145473)
FT                   /locus_tag="Mext_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.569 at
FT                   residue 30"
FT   gene            complement(145592..145960)
FT                   /locus_tag="Mext_0135"
FT   CDS_pept        complement(145592..145960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0135"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: syn:slr0423 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28562"
FT                   /db_xref="GOA:A9VWI7"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWI7"
FT                   /protein_id="ABY28562.1"
FT                   /translation="MILGARIAILGLAIISSFTISGAEAAPKAAGQSGAASWYGPGFHG
FT                   RLTASGERFNTHAMTAAHRTLPFGARVRVTNKSNGRSVVVRINDRGPFVVDRVIDLSKA
FT                   SAGAIGVSGVAKVSLTRV"
FT   sig_peptide     complement(145883..145960)
FT                   /locus_tag="Mext_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.898 at
FT                   residue 26"
FT   gene            complement(146955..151241)
FT                   /locus_tag="Mext_0136"
FT   CDS_pept        complement(146955..151241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0136"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: ccr:CC_0655 sensory box/GGDEF family protein;
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein; GAF
FT                   domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28563"
FT                   /db_xref="GOA:A9VWI8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWI8"
FT                   /protein_id="ABY28563.1"
FT                   /translation="MYPLHPNEVERLQALHDLEVFSSPAEPQYDAICRTAQALFGASIA
FT                   LVSLVGETEQRFKGRCGLNVSGTSREVSFCTYTILSDQVLLVEDALQDERFSANPLVTG
FT                   EPHIRFYAGAPLVLGAGIHLGSLCLIDRVPRSFSAEQQEQLRDLAQIVVAQLRLSKAER
FT                   KARESADDYRLLADNSSDLIIRSDLDGTRRYVSPAVSRLLGYEARELLGTHPLASVHPD
FT                   EASSYAQLLKQLEAGQISEAVTQQRYRRRDSSFVWVEISFSLTREEETGGPNGYVAIIR
FT                   DISQRKAVESEMARIARHDPLTGLPNRLHFREQLEQEIARTKRTSSTFALLCLDLDRFK
FT                   LVNDTLGHQAGDRLLKVVAQRIKSVLRTEDTLARLGGDEFVIIQTNCARAEDASRLAER
FT                   VIAAMLPPVDLGGYPAGVGVSIGIALAPQDSLDHDHLYALADQALYRAKAAGRNTFRLF
FT                   AEEEVGSSGMSNQGGEWEVGQPLRQIAPDPLLVGDLLRDILESSSDCMKLLDQEGNLLF
FT                   LSAGGLKVMEIDDVGPFLGQSWVELWQGEHQVAAKDAVSQASRGQEARFRGFCHTAKGR
FT                   PRWWDVALSPVKTLSGARGLILAISRDVTVQVELERDLQTTANRYKALIEASATMVWRA
FT                   TPDGSLVESSGWGTYTGQPESAYIGYGWLDTVHPDDRQRVTTTWREIFASQAAGSFEFR
FT                   ALCRDGAYRWTLTRAVPLKDASGQVQEWVGTDGDIHESRQASEAIRLQEERYRLAMLAT
FT                   QDAIWDWDLGADTAEWSDGAYRLFGYDDAERADTGAWWKSKIHPDDRERVTTSIKHIIE
FT                   SQEHRWSDEYRFARADGSYAEVTDCGFVIRDTEGQALRMVGALRDISEQRRANAALRAS
FT                   EERLRLALQAGRMVAWERDLKTGLATRSDNALQLLGIGSGPISLLLDNVHPEDRAHVER
FT                   FTAYGGALSTVEFRYLHPAGPQIWLTMRAERVEAGRIVGITFDITERKLSEEQAWRAAN
FT                   HDALTGLPNRRLFHQRLEQALAAAERGGTSVTLLLVDLDTLRDVNDIHGHDAGDAVLRE
FT                   VSSRLVEGLRASDTVARLGGDEFALLLTEPLRLEHAAKHAEVLLERLRQPLVYRGHRLT
FT                   CTASIGLAAYPDHHRNPYDLLKDADIALYRAKAQGRNSAVVFAAEMRSQTERRVLIAAE
FT                   VRTAVAAGQIVPYYQPKICFTTGAIVGFEALARWQHPEKGLLTPGYFGSAFENPELATA
FT                   IGSSLIRQVAADLGQWCRCGLDPGRVAVNFSSAEFRRPDLAGDILSVLSEHDVPPARFE
FT                   VEVTETVFLGHGTEVVPATLRRLHDNGILITLDDFGTGFASLTHLKQFPVGHIKVDQSF
FT                   VRNVVQDQGDAAIITAVIGLGRSLGMQVTAEGVETVVQANRLSAMGCDYAQGYLYGKPM
FT                   AGSRVPWFLRNWSGEAVESSRVLRLA"
FT   gene            152043..153254
FT                   /locus_tag="Mext_0137"
FT   CDS_pept        152043..153254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll0948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28564"
FT                   /db_xref="InterPro:IPR018705"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWI9"
FT                   /protein_id="ABY28564.1"
FT                   /translation="MAPFLALVSAGGMALAVDTGSAYYTQLKLQNIATAAAAGAVLAVP
FT                   SEPHSVTAKALDLVALNTPSGFGTVAKSGDVRLGKWDKSTLTFTATTEDPNAVEVTTYR
FT                   STAYGNPLRVLFSDLLGRATLELQATSIAMVYGSPACTLVLDPSDSGALTVGGSSTVKA
FT                   NCTIHVNSTASSAAQTTGSGRVDAGRVCARGTITGGGWGATQLRQGTAQCSLQADPLAG
FT                   VPEPVNPGGCSTPQNNTTTLAPGCYTGAFKLSGNVSLAPGLYYFKGAQVSVNSGTNVNG
FT                   TGVRLYVDATSHFDLSGASDVTLTADTSSAQQAGILIFGSRSATTGGNVTLGGGGRLDL
FT                   NGSLYTPSSTLTLSGNSTLTQERKTGVIIAKRLSTSGSSTLVLNGFPSGANAASARLRS
FT                   SVVQ"
FT   sig_peptide     152043..152093
FT                   /locus_tag="Mext_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.943 at
FT                   residue 17"
FT   gene            153292..153699
FT                   /locus_tag="Mext_0138"
FT   CDS_pept        153292..153699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0138"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: bch:Bcen2424_6780
FT                   TadE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28565"
FT                   /db_xref="GOA:A9VWJ0"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWJ0"
FT                   /protein_id="ABY28565.1"
FT                   /translation="MRSFRKDQRGVISVEFALVVPLLITLVFAAVEFGGILYTQAAAES
FT                   ATNNVARQLATNRITQAQAKKAVTPLLPVWARVNVDVAVTASNATKPESNLYTVATTIP
FT                   MAQAAPTGFLKFIYVDRNISATVTQQQEPTS"
FT   gene            153975..154280
FT                   /locus_tag="Mext_0139"
FT   CDS_pept        153975..154280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28566"
FT                   /db_xref="InterPro:IPR041238"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWJ1"
FT                   /protein_id="ABY28566.1"
FT                   /translation="MVLCASQALAQSKLSDVKKASEFSAMCQPTASEAQKSYLAGFVTG
FT                   AADASVGKHICPKDAASSQQLVETFCSYLKAHPKNLNRPGGLLLGLAFSEAWPCKQ"
FT   gene            complement(155000..155305)
FT                   /locus_tag="Mext_0140"
FT   CDS_pept        complement(155000..155305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28567"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWJ2"
FT                   /protein_id="ABY28567.1"
FT                   /translation="MSSAEIHVLPTMGLSTPQVSRIVTELAEAHAAGVDLGSRVPHIQA
FT                   NSDALLVLHHNLERELAGLGSALEQLGGRGRHAGAVLQQLLEAVRQLADMARHHPH"
FT   gene            complement(155305..157002)
FT                   /locus_tag="Mext_0141"
FT   CDS_pept        complement(155305..157002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0141"
FT                   /product="chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bbt:BBta_2906 putative
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28568"
FT                   /db_xref="GOA:A9VWJ3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWJ3"
FT                   /protein_id="ABY28568.1"
FT                   /translation="MSWLINLRLLGKLAIPAAVMLIVSVGIILLARDRMATLAENTQRI
FT                   VDVNAARAVLSLQMNVALDEASISEKNTIIETEDAAMASQVENYKISKQQALTAIDRLI
FT                   ALSDTDARRTTNLGIKDDLNVFFAAAERSIALGLKNNNAEASKVSNTEVRPARRKVVES
FT                   VVKRVEANLRDLEAAKAQAAEIAGAASVTLTSLAVAGLLTAFGLLGAIAVWGAVRPMGR
FT                   LVDVLQRMAKGDIDAEIAEARRGDEIGAIGKAVEGIKAMVAQKAAEQAEVKRIADEAAA
FT                   VERKRTMLELADGFERSVGGIVGMVSSSATELQATASTMTATATQTASQSTTVAAAAEE
FT                   AASNVSTVAAAAEELGASVQEIGRQVSGSANLAQTAAGEADQTAHLVGELSQAATRIGD
FT                   VVSLISNIAGQTNLLALNATIEAARAGEAGRGFAVVASEVKELAAQTARATDEISGQIA
FT                   QIQGATGQAVTAIGTITSRIREINAVTATIAAAVEEQGAATQEIVRNVSQAATGTGEVT
FT                   SNIAGVAQASEETGAAASQVLSAASELSRQSEHLGAEVARFLSTVRVA"
FT   gene            complement(157274..157609)
FT                   /locus_tag="Mext_0142"
FT   CDS_pept        complement(157274..157609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0142"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: net:Neut_1746 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28569"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWJ4"
FT                   /protein_id="ABY28569.1"
FT                   /translation="MGPKEARSTVLSLEEEAMVVAFRRHTLLPLDDSLYALQPTLPHLT
FT                   RSSLHRCLQRHGISRLPDVDGDKPKRSLFKAYPIGYFHIDIAQVRTEEGKLHLFVAIDR
FT                   TSKFAFV"
FT   gene            complement(157640..157768)
FT                   /locus_tag="Mext_0143"
FT   CDS_pept        complement(157640..157768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMa1174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28570"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWJ5"
FT                   /protein_id="ABY28570.1"
FT                   /translation="MGQVLHGSATTTEAIRRAIQARQESVRAAAKRYGISPTTVRK"
FT   gene            159244..159600
FT                   /locus_tag="Mext_0144"
FT   CDS_pept        159244..159600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpd:RPD_3796 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28571"
FT                   /db_xref="GOA:A9VWJ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWJ6"
FT                   /protein_id="ABY28571.1"
FT                   /translation="MSSSIESVWEGRLCPSWRSTSWRIPARVVEAATADEAWAILESRG
FT                   DVAALFTDIEMSGSMNGFALADRVAKRWPHIRPVITSGRCRPAPCDLPDQGMFVPKPYM
FT                   ADQVLTAFERARPL"
FT   gene            159907..160248
FT                   /locus_tag="Mext_0145"
FT   CDS_pept        159907..160248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28572"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWJ7"
FT                   /protein_id="ABY28572.1"
FT                   /translation="MSTEVRLIDEETAMESIGRLAQGKLSLEVVGALAGEIARWVEDHP
FT                   DLPIVSVSVRSGACLQKLWVLFSAMEAQRADVRRSNDALMLFKSTWNTIERGIRWHVPS
FT                   DARTVLYTH"
FT   gene            complement(160542..160949)
FT                   /locus_tag="Mext_0146"
FT   CDS_pept        complement(160542..160949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28573"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWJ8"
FT                   /protein_id="ABY28573.1"
FT                   /translation="MPFAASGRALALVCTDKHLCSAAPGEPHSHSRRHQTPRGAPPVHS
FT                   SNEQCCGSSGATSRFVIPPAESHMSRETIKDRYQRTLGYIITEGSGRQKALDAAQRTLG
FT                   YYYPQQDVTKDAGQRTIAHGNVLASLIYDAG"
FT   gene            complement(160982..161443)
FT                   /locus_tag="Mext_0147"
FT   CDS_pept        complement(160982..161443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28574"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWJ9"
FT                   /protein_id="ABY28574.1"
FT                   /translation="MSVLKTLKLSAAAPDAFANDPLSRAREKLLGQLAEQKDMVSASLE
FT                   GRLYEPPKVAAVRKNAAGERVRVEVARRARKGWFQDQASTVHFIMRVGGKPLELQPGKA
FT                   AISIGSLDKLPGTIDALIAAVRAGELDPQIREAAAARGLMMAERRKKAA"
FT   gene            162144..162698
FT                   /locus_tag="Mext_0148"
FT   CDS_pept        162144..162698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28575"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWK0"
FT                   /protein_id="ABY28575.1"
FT                   /translation="MHPKIQNLLKAQTDLHAWLECQFARAGSYQIDRGTQFDLTFDDYV
FT                   DLWRLSRLKKVVQLMNAGRLRSRMRHPDRGWVLSWSNKAARKTGVMNKHTACIIQRLTS
FT                   KLRFYLQKGERHTDAARAKIGAAKRGKPLTAAHKEAIRAARTGLAQSEEHKRKRIEAIR
FT                   ATKQRRREERLALIAQAAKTA"
FT   gene            162886..163065
FT                   /pseudo
FT                   /locus_tag="Mext_0149"
FT   gene            complement(163251..166871)
FT                   /locus_tag="Mext_0150"
FT   CDS_pept        complement(163251..166871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0150"
FT                   /product="outer membrane adhesin like protein"
FT                   /note="TIGRFAM: outer membrane adhesin like protein; KEGG:
FT                   dar:Daro_3199 VCBS"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28576"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWK1"
FT                   /protein_id="ABY28576.1"
FT                   /translation="MATVSNGAATSVSNTPQAKDDYVTTAEDVGTKINVLANDSGGTAK
FT                   SLYSISQGDPLAVAKTATSSLGATIYITSDGQVYYDPASATRIQALAQGETAVDTFVYE
FT                   ERLGNGTISTATVYVTVKGTNDGPILAADTATHAMTEIAGATSGSGTETASTTLTFTDR
FT                   DLSDTHTVSYGAPSVTWTGGAHIPADTAAALASALTLTKMDSTGSGTGSVKVDFALADK
FT                   LADFLGVHETLTVTYQITVRDSQGASSVQPVTLTLTGTNDDALITAATAGSDRGTVTED
FT                   GNVAAEGVLSFTDADLNDAHTVSVMPSGAALGTLTVNKTADLNGVGSVSWSYTVDSTKV
FT                   QYLAEGETKVESFQILLSDGTSTVSKTVSITITGTNDAPVVTPASVGDSAGTATPLLET
FT                   DAGLATSGTLTVIDLDVVDQVSVAVSGVTHSGPTGSLTNAELLSYFHITPGTIVDGRHT
FT                   SGQFTWTFNSGAQAFDFLAQSEVLELQYRITPDDGHAPTGTGDGVVTIRIQGTNDAAVI
FT                   GGAAAGAVTEDAVTTTSGQLTITDVDTGEAHFQAITAGALTKTYGSFTFNETTGAWSYA
FT                   LDHAKADSLAKDQVVHDTLNVTSFDGTDTQLIDVTITGTNDAATIVASGGDHGNVTEDT
FT                   PGQGLTQGSLSVQDVDAGENRFQAVAAGALEGQYGSFTFDADTGAWKYTLDHAKADKLT
FT                   GTDVKHDTLTVTSFDGTDTHVIDATVYGTNDAAVIGGAAAGAVTEDAVTTTSGQLTITD
FT                   VDTGEAHFQAITAGALTKTYGSFTFNETTGAWSYALDHAKADSLAKDQVVHDTLNVTSF
FT                   DGTDTQLIDVTITGTNDAATIVASGGDHGNVTEDTPGQGLTQGSLSVQDVDAGENRFQA
FT                   VAAGALEGQYGSFTFDADTGAWKYTLDHAKADKLTGTDVKHDTLTVTSFDGTDTHVIDA
FT                   TVYGTNDAAVIGGAAAGAVTEDAVTTTSGQLTITDVDTGEAHFQAITAGALTKTYGSFT
FT                   FNETTGAWSYALDHAKADSLAKDQVVHDTLNVTSFDGTDTQLIDVTITGTNDGLTPNLV
FT                   LNFDNISSGPVPDGYGGLNWNSNGSFYSGTADILNTGYGYGNGDNDSFVFNGWAGKYSS
FT                   ITKTNGGTFSVSGLDIADSTYAHFSDTPNDANTVQFVGMKNGAQTYSKLVSLSNDHFDH
FT                   VDLDFSGIDQFQINVVGGQQSGLGVSNTGWWAIDNLGLII"
FT   gene            167643..167858
FT                   /locus_tag="Mext_0151"
FT   CDS_pept        167643..167858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28577"
FT                   /db_xref="GOA:A9VWK2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWK2"
FT                   /protein_id="ABY28577.1"
FT                   /translation="MQGGGDLRAELRDERLRQEIFYSLREAQVVIGPWQNIYNRVRPHS
FT                   SLGYRPPAPVSFPDLAFRLPMATTMQ"
FT   gene            167931..168068
FT                   /locus_tag="Mext_0152"
FT   CDS_pept        167931..168068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28578"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWK3"
FT                   /protein_id="ABY28578.1"
FT                   /translation="MAARMPGTATLQIVADDETGELEGATVLGQFGEVPDDFAGSLQAA
FT                   "
FT   gene            168080..168298
FT                   /locus_tag="Mext_0153"
FT   CDS_pept        168080..168298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28579"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWK4"
FT                   /protein_id="ABY28579.1"
FT                   /translation="MQTYSLKQDGGPGAFTVVVDREMVGRVIACDEHPGLWRIQDQNGR
FT                   FMGRAGMREQSAEFLAAWFVAEDQDWT"
FT   gene            168920..169324
FT                   /locus_tag="Mext_0154"
FT   CDS_pept        168920..169324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0154"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bhe:BH02210 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28580"
FT                   /db_xref="GOA:A9VWK5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWK5"
FT                   /protein_id="ABY28580.1"
FT                   /translation="MDTPNARPKRATDLDRLVGERIQVLRKSKGLTQTALGQAIGVTFQ
FT                   QVQKYENGMNRVGASRLSDIARVLEVRVSSFYDGDEGEGEDRAEVFGFLRTHGAIDLLR
FT                   AFSEIEDDQLRREVLAIVRTVARVEQVRNS"
FT   gene            169575..169982
FT                   /locus_tag="Mext_0155"
FT   CDS_pept        169575..169982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0155"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   oan:Oant_0753 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28581"
FT                   /db_xref="GOA:A9VWK6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWK6"
FT                   /protein_id="ABY28581.1"
FT                   /translation="MDDHSASPKQATKEDVIVGLRIQTLRKSRGISQTALGIAIGVSFQ
FT                   QIQKYEIGANRVGAGRLSDIARVLGAPVSVFFEEGDAAAAQEKTEVFDLLRAPGAVDLL
FT                   NAFITIEDDRLRREVLALVRSAARMEQDHGA"
FT   gene            complement(170460..170945)
FT                   /locus_tag="Mext_0156"
FT   CDS_pept        complement(170460..170945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmr:Mmar10_1499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28582"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWK7"
FT                   /protein_id="ABY28582.1"
FT                   /translation="MRKSQHHAKGDARVRFRSTKTYGHDIGLSCCFRQWRSPSHCRFLH
FT                   GYALAVHLEFEADDLDARSWVMDFGSLKPVRQWLEQTFDHKTLVAADDPLLSEMRAMDE
FT                   VGLIQLVVLPHVSCEAFAEHIYSWVRGWLAQQNLSPRIRLAEVHVREHGANAAKVLA"
FT   gene            complement(171034..172107)
FT                   /locus_tag="Mext_0157"
FT   CDS_pept        complement(171034..172107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aga:AgaP_18389 ENSANGP00000020878"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28583"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWK8"
FT                   /protein_id="ABY28583.1"
FT                   /translation="MKNVWLLHIESVETRYTGQLRHHLRQQIEHAAEDCVVNVRVIDID
FT                   GDVPDQIPTKGAFLDFAATNIFKSTQVAELARRFQRGEVKPNDVFVFTDAWHPGVHQLR
FT                   YMSALLPIPVRIVGLWHAGHYDPNDFLGRIGPQHVPWAKDMERALFKAYDVNAFATQAH
FT                   IDLFRKGPGAAEDGGRVVKVGWPMEYLPRLLEPYRGMPKRNLVLFPHRVPAPEKQVEIF
FT                   DDLANAFPDWQFDACQRTPLSKDTYHRRLAEARVVFSGSLQETLGIGCYEGVLSGAVPV
FT                   VPDRLSYTEMYPEEFRYPSEWTASWEDYLRHKPQLVDHLRGVLARAEAGVDLEPCRQQL
FT                   TPFFSGEALYNEVFEKL"
FT   gene            complement(172104..172496)
FT                   /locus_tag="Mext_0158"
FT   CDS_pept        complement(172104..172496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28584"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWK9"
FT                   /protein_id="ABY28584.1"
FT                   /translation="MTSAAMFAGVSPNRMIWVTFKVRGFHCYPGAPEAVAYLRERHRHQ
FT                   FGFRVWIEVFGDNREIEFHMTQAWLESLYAKDGVLEADGKSCEMLANELYARMVEEQRF
FT                   QNRDIWIEVDEDGECGALMRYERGAR"
FT   gene            complement(172493..173047)
FT                   /locus_tag="Mext_0159"
FT   CDS_pept        complement(172493..173047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN4266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28585"
FT                   /db_xref="GOA:A9VWL0"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWL0"
FT                   /protein_id="ABY28585.1"
FT                   /translation="MTWNRTSRQLKAALIALAYVAVALLVNFTISWWPPQKVLGIEIPP
FT                   GLLLVGAIFVMRDYAQRAVGNWVVPLTLLASVLTYFAVDHVVAFASGAAFFVSESIDFG
FT                   IFKITKRPIKDRIVISSAVAVPFDGLIFLGIMSWLDPWHFWDQQLFWVHYTVKMVASIL
FT                   MWLWLSRRAIRSHSLKPAEWR"
FT   sig_peptide     complement(172952..173047)
FT                   /locus_tag="Mext_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.400 at
FT                   residue 32"
FT   gene            complement(173056..174585)
FT                   /locus_tag="Mext_0160"
FT   CDS_pept        complement(173056..174585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mag:amb3683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28586"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWL1"
FT                   /protein_id="ABY28586.1"
FT                   /translation="MLDRLFPHQENVARYLPAISHGYARVANDPSWHCEGLPGTMLDYL
FT                   RAGGVFRYPAALASAGQVIRESGSLDSTRTIITDRDPTASFVVADSGGFQIQQGTLGPW
FT                   RGKATVLQSLRWQEQHSDYVMALDFPTGGIDTGKMAQHVHRLIHVEGEPIEAMSRTNGL
FT                   SVPFNACLRQTVINTDMMLTYRRPDRRFLVVLQGTSEPESREWYQAHKHFIAEAEGIAF
FT                   AGESKTSYRLMLHRLIDMRDDGNLARIKHIHVLGTGTFESGCILTTIQRCIRDSINREL
FT                   QITFDTATPFQEANERYQLMAWYTIDRVKLSWKYLRPSEATLSGNRYENEFTVPINHWC
FT                   HTRVQHERNRLAKNFSYRVNHGRPTPYAAVSMIGRTLAPSDVAVYRREKDDPDPLNHII
FT                   KPDSRTSLLMCAHNVDAITRAMETVIGKWISPVAELRNDFPQDLLVIRTIIEMLFNKNH
FT                   VVGLMDELTECKEVAWDAPRAELPAPKKGKSPYQAHAFIEENRRYLDALVD"
FT   gene            174686..176377
FT                   /locus_tag="Mext_0161"
FT   CDS_pept        174686..176377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28587"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWL2"
FT                   /protein_id="ABY28587.1"
FT                   /translation="MTSNSKTTNEQLKQELDDIDDRLRAAERYASRARKHEDAFWSRVY
FT                   QALLDIYTVWHPLLNSEHLIEAYCIRHQIPFNSTKKANRFYAPIQHCFRSARSDSSIVH
FT                   YADTLKEADRLGKTPNELVKWIEECDGPDGVYQAVAARRKAARAAQAAASHPPISAPQP
FT                   TAQHSQPQAGAPPSAASQPASMPAAAPSSQTAPAQPLNTIGLVVDAIRTIDQLVNGKDD
FT                   CAILIRNVANDGSRNLCVENTGTRQTFTTARITLPFVWSEIGNQEYVLSHREAERLSRS
FT                   LSHSHTWNVDACVDELRFQSSNGHRIVAPALSDMDEGHRHMAVPSGHGSHLKLAFSRAR
FT                   EYLMWIDDIVRNIRIQSKNQRREAHEQIEQNQDILSNLWRQQRSVRVGQRTTMHVPASN
FT                   RLLDHRSFDYVMPGKTKLPRALDLLPSKRWVLRKDIDPSAMGDEGEEMVALNVLEVNLF
FT                   ATYRLPFPTWADNMKCQPFDASNKVYIGEDVRLPTTEVSRLCRLLVTSGNDASVQFINT
FT                   DEAQAALLAEFAHGGEQVRYMIPTIKSASLLRRQACQPLVRSLQLV"
FT   gene            complement(176402..176767)
FT                   /locus_tag="Mext_0162"
FT   CDS_pept        complement(176402..176767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr6156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28588"
FT                   /db_xref="InterPro:IPR021341"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWL3"
FT                   /protein_id="ABY28588.1"
FT                   /translation="MPPLIDAATRELLLANGREPERDHHPVLKLFNPMGPATWLICAME
FT                   ADGDTLYGLCDLGFCEPELGYVSLDELKEVSAGLAIGLERDLSFRGTHPISVYAQAARG
FT                   AGRIVELGKGPDMNPRG"
FT   gene            176990..177559
FT                   /locus_tag="Mext_0163"
FT   CDS_pept        176990..177559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0163"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mag:amb3768
FT                   integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28589"
FT                   /db_xref="GOA:A9VWL4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWL4"
FT                   /protein_id="ABY28589.1"
FT                   /translation="MGQARVPTETEFRRLVAVASQGRHGPRNRAALMLSYLAGLRVGEI
FT                   ASLQWGNLVDVDGKVREQLRLSATVTKGGHARVVFMNARLRKEIEQFRTSLSATPAASQ
FT                   PLLITQKRTRFSANTLCQLMRGWYDLAGLDGGSSHSGRRWFITRLAHSGISPKAIMMLA
FT                   GHRHLSTTQRYIDVNDEIMRAAVEVL"
FT   gene            178135..178794
FT                   /locus_tag="Mext_0164"
FT   CDS_pept        178135..178794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0164"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   rpa:RPA3511 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28590"
FT                   /db_xref="GOA:A9VWL5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWL5"
FT                   /protein_id="ABY28590.1"
FT                   /translation="MPSPSSIAASSSPVDAPGAPLPTITAPGAASATPAPTQLRLLAAP
FT                   ARDMAKPAVAAPARVLITVDKATQRMRVTVDGKLRYSWAVSTGRAPYKTPAGTFRPFRL
FT                   EKEHYSREWDDAPMPYSIFFTAAGHAIHASNATRQLGRPASHGCVRLAPSHAAALFTLV
FT                   RAEGPGATKVTITNGASAGRTARSRSADVRARGRAHHAQRGPSDIWQAGSGDAWTE"
FT   gene            complement(178932..180023)
FT                   /locus_tag="Mext_0165"
FT   CDS_pept        complement(178932..180023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0165"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Sporulation domain protein; Lytic
FT                   transglycosylase catalytic; KEGG: xau:Xaut_3156 lytic
FT                   transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28591"
FT                   /db_xref="GOA:A9VWL6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWL6"
FT                   /protein_id="ABY28591.1"
FT                   /translation="MRYSRVLIMPNLLITLAAAAGAVVLTAPACAAPEAATETVEQALC
FT                   RLIESSAKARGLPVPFLTRLIWRESSFRLGALSPAGAQGVAQFMPGTAQERGLLDPFDP
FT                   EQAIPHAAHLLADLKRRFGNLGLAAAAYNGGAQRVTNWLAGSGGLPAETRAYVLGITGS
FT                   PVEDWRSSTSPDADPPEAKGADEQHKSGKPAEGAQRGKPAEAEAKAAGPTDAKRESKAA
FT                   EKPRVEQKVASPTCLQMTAALRIPSRAERFAERPPMRGDRDRRGWATSPVEKRVPPPWG
FT                   PWGIQLAANFSKALALQSFSQAQATYAKVIGRARPMIIGTRLRSRGTQAFYRIRLPAQS
FT                   REDADALCGKIRTVGGACIVLKT"
FT   sig_peptide     complement(179928..180023)
FT                   /locus_tag="Mext_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 32"
FT   gene            complement(180413..180688)
FT                   /locus_tag="Mext_0166"
FT   CDS_pept        complement(180413..180688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_4248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28592"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWL7"
FT                   /protein_id="ABY28592.1"
FT                   /translation="MSDTTDTVGVAGDRIRSIIERIERLDEEIKDLMETKKEIFGEAKG
FT                   EGLDVKVLKEILKLRKQDKDERDEQETLLDLYLRAMDAPAPMAEAA"
FT   gene            complement(180782..181945)
FT                   /locus_tag="Mext_0167"
FT   CDS_pept        complement(180782..181945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_1614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28593"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWL8"
FT                   /protein_id="ABY28593.1"
FT                   /translation="MSIYMGGHMVEGAVQAYTREGLLFGERPNGSLVHISEVPSGLACN
FT                   CRCPNCGTPLVARRGEQLGHHFGHHNTTGERACAGGPETGLHRFAKELLAAKLAFMLPP
FT                   LHKDGEGTARYAGGLYRFDTALFEHRLGAIVPDVIVRRADRDLLVEFHVTNACDATKIA
FT                   KIASLGTAAIEVDLSGLALNAPRAELEVAILERAPRRWLHNPKLGWVGDVHGPVTNRIT
FT                   PASSRSLTALEKAYASAYREALSTPSQSLARQRVEADGLAFAIGIEVAGIGCFTASPRD
FT                   WQAVILLNALEGALVGRSSIVSAKASLQQLRERGWLRTRFGRLPPAEAKALSAALPSYA
FT                   SPADAIAAWAMALSRQGILVPSSARGQWVIRRETLQRVREARQQKDF"
FT   gene            182013..182198
FT                   /locus_tag="Mext_0168"
FT   CDS_pept        182013..182198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28594"
FT                   /db_xref="GOA:A9VWL9"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWL9"
FT                   /protein_id="ABY28594.1"
FT                   /translation="MLNLSAPRALTFLVSLVLIGLAVASLYMRIPTIGPTVVKFRTWFF
FT                   VAAYAVLALGVVTKSL"
FT   sig_peptide     182013..182087
FT                   /locus_tag="Mext_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.976 at
FT                   residue 25"
FT   gene            182218..182670
FT                   /locus_tag="Mext_0169"
FT   CDS_pept        182218..182670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oan:Oant_1526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28595"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWM0"
FT                   /protein_id="ABY28595.1"
FT                   /translation="MDCDGVLADFDAGAERVFGMPPREFERRFGARRFWSKLASLDDFF
FT                   GELPLLPDAMELYEAVRHLKPIILTGLPRGNWAEPQKRRWAKRHFPDVEVITTSAALKR
FT                   EHCHPGDALVDDREKYRHLWEEAGGIFILHRDASSSISELRAHGFL"
FT   gene            183431..183991
FT                   /locus_tag="Mext_0170"
FT   CDS_pept        183431..183991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0170"
FT                   /product="ROSMUCR transcriptional regulator"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   ccr:CC_0933 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28596"
FT                   /db_xref="GOA:A9VWM1"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWM1"
FT                   /protein_id="ABY28596.1"
FT                   /translation="MAVDIVGQDRLVTLATEIVTAYVTRNQVQAAELPGLLRSVHSGLL
FT                   RLSSGSGEPTEEPRTLTATEIRRSIRPEGLISFEDGKAYKTLRRHLTKRGLTPEAYRAK
FT                   WGLPVDYPMTASAYSAQRSQLALDRGLGRPRSLASETSDDQSGGVPLSDTERAAELPEQ
FT                   ADAPDEIDESITRVPFEDDGAAH"
FT   gene            complement(183988..184692)
FT                   /locus_tag="Mext_0171"
FT   CDS_pept        complement(183988..184692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0171"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase;
FT                   phospholipase/Carboxylesterase; BAAT/Acyl-CoA thioester
FT                   hydrolase; KEGG: aba:Acid345_1173 dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28597"
FT                   /db_xref="GOA:A9VWM2"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWM2"
FT                   /protein_id="ABY28597.1"
FT                   /translation="MQSFTSGGRRIEVEWFAASGSFAEANGKGTSRPALLLLHGADGLS
FT                   FAEGYRLAARTIAASGYHVAFVHYLDRTGDRRVSYTRLRQDFPLWAETVREAVAWLADQ
FT                   PGTDAQRLGIVGISLGAALAFTTAATEPRVRAIVDYFGPLPEELARERPRLPPTLILHG
FT                   SADAIVPVSHARALERLLQEQGTAHEIKIYEGQGHGLTGPAQLDAAARVARFLGQHLQP
FT                   AVAVSGTSSARA"
FT   gene            185264..185494
FT                   /locus_tag="Mext_0172"
FT   CDS_pept        185264..185494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_2437 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28598"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWM3"
FT                   /protein_id="ABY28598.1"
FT                   /translation="MSEKPPQALTVRELADALAAWMHEVGLKRAAFVGNSLSCEVTVEL
FT                   ALHHPELVSRLVLQLAWDRRDSCGPAQQLAP"
FT   gene            complement(185773..187317)
FT                   /locus_tag="Mext_0173"
FT   CDS_pept        complement(185773..187317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syn:sll1717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28599"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWM4"
FT                   /protein_id="ABY28599.1"
FT                   /translation="MALQTVDSFGAVDADTDDLLLDCFQDHEAYKAAREHRKFLIVGRK
FT                   GSGKTAIFRKIVSESGIGQYCHGHSFSNYPWFHHDKQIKSGVPESECFRYSWEYVILIS
FT                   IAKIIVNDADTPWSEESLEAMTRLEMFLVDTYGSKSPELNGIFLPQTRIKLDPALTKQW
FT                   GTLPNSISVQQIDVENLPVIIYEVNRSLLNIVMRCLNPSQDYHICFDELDRDFSANDLN
FT                   YRLRLSGLLIAARDFNKAVRQAGKRMSVIVFLRDDILRYLKFEDKNKIVEDSSTLIEWD
FT                   KQTTSRSLKDVMSKRFSRVLGIPEHGAWEAVFNEDLQMTGRQSKYQYILDRTFKRPRDV
FT                   IKFSNEVLRCFKQDSESVEKFQNAHVASAREAHSKYMRKELVDEMQQHFPEEEAAFDLI
FT                   RTIGSMMFTLRKIDEVYDELRGRGLAVPSVSKTLRELYNFSAIAFLKVGGAGGGSEWVW
FT                   RYEDTDAEYDERATIFRVHSGLKEVLGLKQGRAFGREEIESSVSSDGLVEDSEENV"
FT   gene            complement(187499..188125)
FT                   /locus_tag="Mext_0174"
FT   CDS_pept        complement(187499..188125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0174"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rle:pRL110095 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28600"
FT                   /db_xref="GOA:A9VWM5"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWM5"
FT                   /protein_id="ABY28600.1"
FT                   /translation="MPIIRSITSWKALRGIGNSPFAKATMLMPLLGYFIIFNSYFVHYM
FT                   QEHHNLCPTSKCDVTWKFYFLYFGATSIGLASVVYAMFCPEILKKYAGPSEFFDAEKQY
FT                   YCYPSHLSDLVSYVEKQSGTLIADVFNLKGLIAKNAVIGLNEAHVISGMMGSKFELANE
FT                   SVSFARFIVFMLYTIGGVMIGIPALITFWRIFRLSFEALTVYWST"
FT   gene            complement(188402..189724)
FT                   /locus_tag="Mext_0175"
FT   CDS_pept        complement(188402..189724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0175"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mag:amb3777
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28601"
FT                   /db_xref="GOA:A9VWM6"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWM6"
FT                   /protein_id="ABY28601.1"
FT                   /translation="MSTPANAPGERYQLFRRAGSTRWQVRFSIKGQGQFKRSLDTDDER
FT                   EAERRAEAIWYEATYRAKQGLTAKTHTFESVAEAYIAQILREVERGERRADQGKSEPAV
FT                   IRRYFVGYFDDKPIDAVTEADLERYAEWRRTYWTEGPGKLIEHIEYERDGHRLRRPVRR
FT                   SAPSLSRQRGETVVLRGLLRWAARQGYMKTPPEITIKARRSPDNRRPSFEPHEFARLEA
FT                   VSLSRLVDPIMDGTGAEVRASDRRSWRIKRLDDHTRRDRTVLHAYVMIGAFSGLRPTEM
FT                   YNLTWGDVLGYRAGRKKSVDDRDIRLQVRGKGKSGKAIPQKAAIPWFDTLWMLFERSMG
FT                   REPADADPVFASEQGKRISSVANGFTELLKAAGLERDHRGIKRTPYSLRHFYISEQLAN
FT                   GAEVMDVARNCRTSLVMIDKHYGQVRLERVVDRLRPEWTRA"
FT   gene            complement(189929..190005)
FT                   /locus_tag="Mext_R0002"
FT                   /note="tRNA-Met8"
FT   tRNA            complement(189929..190005)
FT                   /locus_tag="Mext_R0002"
FT                   /product="tRNA-Met"
FT   gene            complement(190109..191401)
FT                   /locus_tag="Mext_0176"
FT   CDS_pept        complement(190109..191401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0176"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: bbt:BBta_0097 tryptophan synthase beta chain;
FT                   TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28602"
FT                   /db_xref="GOA:A9VWM7"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWM7"
FT                   /protein_id="ABY28602.1"
FT                   /translation="MGLAREATIRFSRRTVPVTLNPAPNSFRTGPDERGRFGIFGGRFV
FT                   AETLMPLILDLEKAYADAKADPSFKADMESYGTHYIGRPSPLYYAERLTEHLRAQAPAG
FT                   QGAKIFFKREELNHTGSHKVNNVLGQILLARRMGKPRIIAETGAGQHGVATATLCARFG
FT                   LKCVVYMGAVDVERQAPNVFRMKMLGAEVIPVQSGTRTLKDAMNEALRDWVTNVSDTFY
FT                   CIGTVAGPHPYPAMVRDFQSVIGIETKQQMLEMEGRLPDSLIACIGGGSNAMGLFHPFL
FT                   DDRDVEIFGVEAAGHGVQSGLHAASLTGGRPGVLHGNRTYLLMNEDGQIADAHSISAGL
FT                   DYPGIGPEHAWLHEMGRVTYLSATDAETLEAFKLCSMLEGIIPALEPAHALSKVMELAP
FT                   TKPAEHLMVLNLSGRGDKDIPQVAQIFGQTL"
FT   gene            complement(191473..192120)
FT                   /locus_tag="Mext_0177"
FT   CDS_pept        complement(191473..192120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0177"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: xau:Xaut_1692 phosphoribosylanthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28603"
FT                   /db_xref="GOA:A9VWM8"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWM8"
FT                   /protein_id="ABY28603.1"
FT                   /translation="MADICVKICGLSTEPTLDVALDAGADLVGFVHFPKSPRHVTLEQG
FT                   RGLAQRARGRAQRVVLLVDPDDALLAAAIESFDPDLIQLHGRETPQRVAEIRARTGRPV
FT                   MKAVGIAAVADLRTLPAYAVVADRLLLDAKPPSGADLPGGNGRRFDWDILNGAELPAGT
FT                   MLSGGLDSGNVGTALARTGLVAVDVSSGVEIRPGEKDPDRIAAFVAAARRRA"
FT   gene            complement(192137..192505)
FT                   /locus_tag="Mext_0178"
FT   CDS_pept        complement(192137..192505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_2218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28604"
FT                   /db_xref="GOA:A9VWM9"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWM9"
FT                   /protein_id="ABY28604.1"
FT                   /translation="MIRFLKALILLPIAVVVVLLAVANREAVTLSFDPFSPEPVFSLVL
FT                   PLYAVVFGSVALGILVGGIGSWLGQSRTRQRARYHRREADRLAKEAAELKTFGTPGVEP
FT                   GYAGAGTYTALPAPAAAR"
FT   sig_peptide     complement(192434..192505)
FT                   /locus_tag="Mext_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.378 at
FT                   residue 24"
FT   gene            complement(192731..193039)
FT                   /locus_tag="Mext_0179"
FT   CDS_pept        complement(192731..193039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0179"
FT                   /product="integration host factor, beta subunit"
FT                   /note="TIGRFAM: integration host factor, beta subunit;
FT                   PFAM: histone family protein DNA-binding protein; KEGG:
FT                   rpb:RPB_0638 integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28605"
FT                   /db_xref="GOA:A9VWN0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWN0"
FT                   /protein_id="ABY28605.1"
FT                   /translation="MIKSELVLKIAEQNPHLYQRDVETLVNAILDTIADALAQGDRVEL
FT                   RGFGAFSVKRREARRGRNPRTGESVAVSEKAIPVFKTGKEMRLRLNRAGIGDEQPGA"
FT   gene            complement(193081..194046)
FT                   /locus_tag="Mext_0180"
FT   CDS_pept        complement(193081..194046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0180"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49; KEGG: rpd:RPD_0193 signal peptide
FT                   peptidase SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28606"
FT                   /db_xref="GOA:A9VWN1"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWN1"
FT                   /protein_id="ABY28606.1"
FT                   /translation="MAADAEFLIDRRRLRRKLTLWRMLGIGAAIVAVGALGYRARVGEG
FT                   RLFPATENQIARISIGGFIAGSDSTRKLIERVGESNAVKGVVISISSPGGTTTGSEELY
FT                   RNLRALAAKKPMVAFVDGTAASGAYITAIAADHIVARETALVGSIGVLFQYPDVSGLLD
FT                   KVGVKVESVKSSPLKAEPSGFSPTSPEARAALSSIVLDTYGWFKGLVAERRGMDESQIA
FT                   AVADGRVFSGRQSLPLKLVDELGGERQAVAWLEKEKKVPEKLPVKDWKPKADGGFKLWS
FT                   TLGLGADLLGLDGLASRLRAVEDEAAGLSGGLLAVWRPAP"
FT   gene            complement(194307..195632)
FT                   /locus_tag="Mext_0181"
FT   CDS_pept        complement(194307..195632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_4010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28607"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030807"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWN2"
FT                   /protein_id="ABY28607.1"
FT                   /translation="MANRLSSLGASLRWLRGQRPGRRSDPLPSHFDPERYLDLNADVAM
FT                   AVEAGLVASAEEHYRVFGRREGRPIQVPSATAELGGGIAGKWTYRYPYRAWPELPAIAF
FT                   AAPRPGPEDDAIARRLIAAWQSGAGRAPVQADSEGMWAARSQGFPDFHRALQGGDAGAL
FT                   AGLLNNLFQSHLAHGIAMGRTMATLARHAPTPFAASWCDRLLRLSEAVGLAPIRSPEQG
FT                   DYAAALPGPLAHHVAPPRLEAELGFPLAFPEVGAPFGVRYGASILPEHALTHAYAAWRV
FT                   GQLGRFDRVVEIGGGFGGLAWFLHHPDRHYTILDLPFTNVLQGWFLLKAGLDVSLAGEP
FT                   DAAIRVRPWWEIERNERYDLAINQDSLPEMPPETAAMYIARIRAIAPLFFSINQEAAAP
FT                   NTDAFRQAVVADLVARDGGYRRLGRYLFWMRDGYVEEIYARR"
FT   gene            complement(195725..197437)
FT                   /locus_tag="Mext_0182"
FT   CDS_pept        complement(195725..197437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0182"
FT                   /product="ribosomal protein S1"
FT                   /note="TIGRFAM: ribosomal protein S1; PFAM: RNA binding S1
FT                   domain protein; KEGG: xau:Xaut_2229 ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28608"
FT                   /db_xref="GOA:A9VWN3"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWN3"
FT                   /protein_id="ABY28608.1"
FT                   /translation="MSAGLNVSSSAREDFAALLEESFLQHEITEGSVVKGTVVGIEKDV
FT                   AVIDIGAKTEGRVPLKEFTGPGREGELKVGDEVEVYVDRIENALGEAVISRDKARREES
FT                   WVKLEKAFEANERVTGTIFNQVKGGYTVDLDGAVAFLPRSQVDIRPVRDVTPLLGTPQP
FT                   FQILKMDRRRGNIVVSRRTVLEESRAEQRSELVANLEEGQVIDGVVKNITEYGAFVDLG
FT                   GIDGLLHVTDMAWRRVNHPSEVVTIGQTVKVKIIKINHETHRISLGIKQLLADPWEGIA
FT                   ARYPEEAKLKGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNVHPGKIVSTSQEVEV
FT                   QILEVDSVKRRISLGLKQTLQNPWDAFAEKHPVGSEVEGEVKNKTEFGLFIGLEGDVDG
FT                   MVHLSDLDWNRPGEQVIEEFKKGDMVRAQVLDVDVEKERISLGVKQLGGDPFAEAGEVK
FT                   KGQIVTCEVVEVKDSGLEVKLVDTDMQTFIRRAELARDRGDQRPERFAAGEKFDARVIQ
FT                   FDRKARRVQVSIKALEVAEEKEAMAQFGSADSGASLGDILGAAFNKKKGGDEE"
FT   gene            complement(197852..198658)
FT                   /locus_tag="Mext_0183"
FT   CDS_pept        complement(197852..198658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0183"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: rpa:RPA3364
FT                   putative rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28609"
FT                   /db_xref="GOA:A9VWN4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWN4"
FT                   /protein_id="ABY28609.1"
FT                   /translation="MTPPRDRPAKPYGFRPRPRTQPPGPAAREGRDHVVLYGWHPVSQA
FT                   LANAGRHFHRLLATENALARLKEAGIELPIEPEMVRPSAIDRLLGPDAVHQGLYAEAEP
FT                   LAAPAFDAMPDDALLLALDQITDPHNVGAIVRTAAAFGVTAIVTTARHSPNATGVLAKS
FT                   ASGGLEHVPLVIVRNLAEALITLGERGFTRIGLDSDAGTTLDAVGPRRPAVLVLGAEGK
FT                   GLRQRTTECCDLLVRIDATGAIRSLNVSNAAAITLYALTRSAGTAA"
FT   gene            198806..198880
FT                   /locus_tag="Mext_R0003"
FT                   /note="tRNA-Glu1"
FT   tRNA            198806..198880
FT                   /locus_tag="Mext_R0003"
FT                   /product="tRNA-Glu"
FT   gene            complement(199300..200085)
FT                   /locus_tag="Mext_0184"
FT   CDS_pept        complement(199300..200085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28610"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWN5"
FT                   /protein_id="ABY28610.1"
FT                   /translation="METEETYRFQKCRSRPFTPPFGRRVMRPPIRPDVPCLAASPYVIV
FT                   RVDCSHCPNRTGSYRLARLAARLGPETPLEEHASACSARPQRAFNLSMSAAPVLATHRL
FT                   GRMATSAGYLWGADGFRLMQADGVMPEHAAHHRPHEQEGAKAMADIRSHDPLGRSDGGP
FT                   ASGRGGSSSGGGAADQARQALRDATDKASDAWDSASEYGSRYYRQGSRAVGNVDSTTMT
FT                   GFLVAGAIGFGLGWLVFGQHSYSGDYVARRMSRSSERDY"
FT   gene            200217..201155
FT                   /locus_tag="Mext_0185"
FT   CDS_pept        200217..201155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0185"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: nha:Nham_0009
FT                   pirin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28611"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWN6"
FT                   /protein_id="ABY28611.1"
FT                   /translation="MSWHSADDPIPGDHFSCDAIQTLIVPRSRDLGSFAVRRALPSTQC
FT                   RMVGPFIFFDQMGPSEFLLGQGMDVRPHPHIGLSTVTYLFDGEIMHRDSLGTELPIRPG
FT                   ELNWMTAGRGITHSERTAPTLRQTGSRLFGIQSWVALSAREEESAPAFEHYDASALPVL
FT                   TGEGKTVRLIAGEAFGARSPVRTSSPMVYADVMLEAGAVLPLDPTYDERAIYTVAGAIE
FT                   IAGDGFGPGQLLVFRPGDRISVRATEAARFMVLGGEPMDGPRHLWWNFVSSRPERIAQA
FT                   KEDWRQGRFDTVPNDAEFIPLPEDPPPVRYP"
FT   gene            201258..203024
FT                   /locus_tag="Mext_0186"
FT   CDS_pept        201258..203024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0186"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   TrkA-N domain protein; sodium/hydrogen exchanger; KEGG:
FT                   atc:AGR_C_3111 glutathione-regulated potassium-efflux
FT                   system protein (K(+)/H(+) antiporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28612"
FT                   /db_xref="GOA:A9VWN7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWN7"
FT                   /protein_id="ABY28612.1"
FT                   /translation="MAIEASGAANELVQVVSLLAAGVVAVPLFKRLGLGSVLGYLVAGL
FT                   AIGPFGVGLFTDAHAILHVAELGVVMFLFIIGLEMEPSRLWGMRREIFGLGLAQVGACI
FT                   AALTLVGVAMGFPVVVAFVAGTGFVLTSTAIVMQLLEERGSLSTPKGQRIVAILLLEDL
FT                   AIVPLLAAVALLAPGGAETSGTERAIAVGIALVSIAALVAAGRWLLNPLFRLLAAAKAR
FT                   EVMTAAALLVVLGSALAMQLGGLSMAMGAFLAGVLLSESSFRHQLEADVEPFRGILLGL
FT                   FFLGVGMSLDLAVIAANWGLILMSVAAYMAVKSLVIYGVARALRTKHAEALERTALMAQ
FT                   GGEFAFVLYAAAASAGIIDGTTNAILTATVILSMAITPLTVIAFDRVGPKATASTDGVE
FT                   APEDLVGSALIIGFGRFGQIVSQPLISRGCSVSIIDTNADNIRLAEGFGFKVYYGDGAR
FT                   LDILRAAGAATARAILICIDDRAMAKRIAELARAEFPLVPVLARARDREHAVELIEAGV
FT                   AYQMRETLESAFALGEQALVTIGADPDAAGEIMAEVRRRDAERLDLQVVGGLYAGRELI
FT                   RGNASMPTHGHA"
FT   gene            203204..203923
FT                   /locus_tag="Mext_0187"
FT   CDS_pept        203204..203923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0187"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: bbt:BBta_3390 putative cytochrome c-type
FT                   biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28613"
FT                   /db_xref="GOA:A9VWN8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWN8"
FT                   /protein_id="ABY28613.1"
FT                   /translation="MASHLGLAFLAGLLSVLSPCVLPLLPLVLGAAVAEHRLGPVALAA
FT                   GLALSFVAIGLFIATIGFALGLDGDRFRAIGAVLLVVLGIILIVPAAQNRFALAAGPLS
FT                   NWAEQRFGGVATAGLAGQFAVGLLLGAVWSPCVGPTLGAASLLAAQGRDLGTVAATMLV
FT                   FGLGAALPLVALGMLSREVLIRWRARMMGIGKGLKLTLGVILVATGALILSGYDRALET
FT                   TLVDASPDWLTALTTRF"
FT   sig_peptide     203204..203299
FT                   /locus_tag="Mext_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.761 at
FT                   residue 32"
FT   gene            204031..204645
FT                   /locus_tag="Mext_0188"
FT   CDS_pept        204031..204645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0188"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD family protein; KEGG: mmr:Mmar10_1055
FT                   HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28614"
FT                   /db_xref="GOA:A9VWN9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWN9"
FT                   /protein_id="ABY28614.1"
FT                   /translation="MLDAEIYERMLGTAATVAEPLQAAIAAIGPIEIAPPAHASLAERL
FT                   FVEVVNQQLSTKAALSIWTRIEAAAAAQDGTPRDLFIPGTEVLLRSCGVSANKVRALHA
FT                   IREAEEAGLLGPELATLLHAERSAVLCRIRGVGPWTADMAGIFHFLDPDIWPVGDVAAV
FT                   GVLRRLAGIEDTVAVAAQFAPYRSILARYMWRSRDAAPVAA"
FT   gene            complement(204651..204908)
FT                   /locus_tag="Mext_0189"
FT   CDS_pept        complement(204651..204908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28615"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWP0"
FT                   /protein_id="ABY28615.1"
FT                   /translation="MSNDTIIWTQGGIAEVPLQRFTGRIGAIEVATVEYDGSNRLWTWW
FT                   SPLAEDIWGHAQEPDGAKQAAELWLRNWLENFRPFFEASR"
FT   gene            205236..205454
FT                   /locus_tag="Mext_0190"
FT   CDS_pept        205236..205454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28616"
FT                   /db_xref="GOA:A9VWP1"
FT                   /db_xref="UniProtKB/TrEMBL:A9VWP1"
FT                   /protein_id="ABY28616.1"
FT                   /translation="MTDSNVISRRARSRAAKSGGNGSVVLVVALMMALVFVPVLALHAA
FT                   ALSGAVAGDEVRPDEVAAAVTHKKVPG"
FT   sig_peptide     205236..205370
FT                   /locus_tag="Mext_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.860 at
FT                   residue 45"
FT   gene            complement(205569..207266)
FT                   /locus_tag="Mext_0191"
FT   CDS_pept        complement(205569..207266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0191"
FT                   /product="chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bra:BRADO2559 putative
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28617"
FT                   /db_xref="GOA:A9VZ61"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ61"
FT                   /protein_id="ABY28617.1"
FT                   /translation="MRWFTNLKLIGKLAIPVALVALVAAGIVGLARNTLGQLQRGTQEV
FT                   VDVRAARVITALQTALAIDEAVISEKNIILETDAAILSAQRERFEASRARALAGADHLI
FT                   AIADSDARRAMLTEVKATISGFFATVERSIALGLKNQKEQAFKVSADEVRPVRTKAIEA
FT                   IQKRIAANISDLEDAKREAAEIGSSAALTLTVIAVVGLLLAFGLLGVIVIVGVVRPIGR
FT                   LVRVLQRMAEGAIETEIAEARRGDEIGAVARAVEAIKALVARKAVEQAEMKRVADEAAA
FT                   IERRRTMIELADGFERAVGGVVGMVSSSATELQATAQQMTATATETASQSTTVAAAAEE
FT                   AASNVGTVAAAAEELGASVHEIGRQVGASADMAQRAVGEADHSAALIHELSQAAARIGD
FT                   VVNLIATIASQTNLLALNATIEAARAGEAGRGFAVVASEVKELAAQTSRATEEISGQIA
FT                   QIQGATGQAVTAIGGITGRIREINAVATTIAAAVEEQGAATQEIVRNVSQAAVGAGEVT
FT                   SNIAGVAQASEETGAAATQVLASASELSQQSEHLRAEVARFLATVRAA"
FT   sig_peptide     complement(207171..207266)
FT                   /locus_tag="Mext_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.363 at
FT                   residue 32"
FT   gene            207649..209271
FT                   /locus_tag="Mext_0192"
FT   CDS_pept        207649..209271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0192"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: xau:Xaut_2425 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28618"
FT                   /db_xref="GOA:A9VZ62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ62"
FT                   /protein_id="ABY28618.1"
FT                   /translation="MIRLDKIGKQNGRQIVFIEASAALQKGEKAGLVGPNGAGKTTLFR
FT                   MMTGQEQPDEGQVSSERGITIGYFSQDVGEMAGRTVVAEVMDGAGPVSVVAAELKELEA
FT                   GLADPDRADEMEALIERYGEVQARFEELDGYALEGRAYEVLAGLGFSQEMMDGDVGRLS
FT                   GGWKMRVALARILLMRPDVMLLDEPSNHLDLESLIWLEAFLKGYDGALLMTSHDREFMN
FT                   RIVSKVIEIDGGTLTTYSGDYGFYEQQRALNEQHQQAQFERQQAMLAKEIKFIERFKAR
FT                   ASHAAQVQSRVKKLDKIERVEPPRRRQTVAFEFQPAPRSGDDVAMLKGVHKRYGSRIIY
FT                   EGLDFAIHRKERWCVMGINGAGKSTLLKLITGTAQPDAGTVAVGGSVKLGYFAQHAMDL
FT                   LDGDLTVFEDLESTFPQAGQGSLRALAGCFGFSGDDVEKPCRVLSGGEKARLVMAKMLY
FT                   DPPNFLVLDEPTNHLDIATKEMLINALAGFEGTMLFVSHDRHFLAALSNRVLEVSGDGI
FT                   RQYGGGYSEYVASTGQEAPGLRS"
FT   gene            complement(209279..209635)
FT                   /locus_tag="Mext_0193"
FT   CDS_pept        complement(209279..209635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc00123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28619"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ63"
FT                   /protein_id="ABY28619.1"
FT                   /translation="MSCLPEDVRALALMLPETVEGAHQGHPDYRVGGRIFATLWTDEAR
FT                   VVVRLTPEAQALWLDAEPDAFEPVLGAWGARGWTSLELDLVEEETLRGALLTAWRIVAP
FT                   PGLVARYEGLALDP"
FT   gene            complement(209645..209884)
FT                   /locus_tag="Mext_0194"
FT   CDS_pept        complement(209645..209884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28620"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ64"
FT                   /protein_id="ABY28620.1"
FT                   /translation="MTKLFIARVRNAGGERPLVTVRAAAEGEARLFVEAAYPEDEIVEI
FT                   TEPGEWVSDSDTGTKNGDVREHPGTAWQAPTSRA"
FT   gene            complement(210102..210746)
FT                   /locus_tag="Mext_0195"
FT   CDS_pept        complement(210102..210746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM4196 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28621"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ65"
FT                   /protein_id="ABY28621.1"
FT                   /translation="MSTLITVLKSGGRYDAVWVERLAHGVRRHAPAFERILCLTDLPLA
FT                   VAGVERLPLRHDWPAWWAKMEAFRPGLTEGTTLLCDLDTVFNGPADTLAEPGLAAMEDY
FT                   FHKGRLSSALLRWPGDELAGLYERFAAEPERWMTAGSCGPVPNAVHGDQVVIDHLLREA
FT                   GLRPSFFQDIAPDLLDFYDPRRAAHGPVVIFIGESKPDTIRGPVHEAWAGA"
FT   gene            complement(210757..211392)
FT                   /locus_tag="Mext_0196"
FT   CDS_pept        complement(210757..211392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oan:Oant_0417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28622"
FT                   /db_xref="InterPro:IPR038578"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ66"
FT                   /protein_id="ABY28622.1"
FT                   /translation="MPADFDLPEAQRFALPPVVSLAIVGNAPEIGASAREIDEADCVVR
FT                   FNNAEGFGGRTGSRVTHLALVNRGGQMREWLADRAFLERPVVRAAQAFILPFPILPAEE
FT                   NGPEPICWTREVLALLRPTGRTIHILPEELHERARRLLAPHTAGRPNPSTGFLVTLALL
FT                   NDRPLEATPAQAYGFGFAGWPGHPWAAERAWFAEAQAAGRVRLHPLAD"
FT   gene            211493..212482
FT                   /locus_tag="Mext_0197"
FT   CDS_pept        211493..212482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_1135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28623"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ67"
FT                   /protein_id="ABY28623.1"
FT                   /translation="MTMRRCFVCAADMLAPSERHLIYPVGRRRLFPFACASCGVLLEGG
FT                   ADASRCRAHLAEALAAQVFVPDPDAPYGLDLYTLRTAATGLGRGIRPLDAEGRVALRHP
FT                   HDGHAARAALYALDGSDKCPVSLGLLCRPSEVDAVLASLPAQAGWTDDITILLDSDITP
FT                   PGAVSVAGFPAGAVRVTARPLEGDFAAQRNALQALARHAWMLQLDADETLDPASGRLLP
FT                   ALVALAEAGAVRSIGLARFNCVDGVLSDVYPDVQYRLNRNDVRYAGRVHERPQLADGWP
FT                   ESFISLHGGIEHRLSRAHVAARSRRYEALDPGRGRPEEEDALLRPYRD"
FT   gene            complement(212502..213686)
FT                   /locus_tag="Mext_0198"
FT   CDS_pept        complement(212502..213686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0198"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   fal:FRAAL1901 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28624"
FT                   /db_xref="GOA:A9VZ68"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ68"
FT                   /protein_id="ABY28624.1"
FT                   /translation="MRTALLAWDYPPAPSGLSTAAREIAESLAAAGAEVTVFTLDRTGR
FT                   EQVGGVTVEGLALPPGGGLARLRLWGSAGHGAAPLAFRRAVLAAHARAPFDVIEATNWY
FT                   APAVLLARRRDLPLVTRSSTPAAFTRGTGASLRDRLDGRTADALERAQARSSAGLIANT
FT                   AEHGAVIARAYRLSGRQPSAVIGLSLPPEICSSARAAPYPETDSPVRLLFVGRAEARKG
FT                   FDALLAAVATLAAEQAAGALPPFRLDLVGVPPNDLPPDLPDAARQRISARGRIDTAALA
FT                   QAYADAHAVLAPSRYESFGLVYQEAMAYGRPVVACAEDASARASVGASGAGPLAQAATG
FT                   PALADALRPLLLDPGLRRAYHMRALAAAGRFDRASLGRETLALYEAAIAAARHG"
FT   gene            complement(213686..214726)
FT                   /locus_tag="Mext_0199"
FT   CDS_pept        complement(213686..214726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0199"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   acr:Acry_1363 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28625"
FT                   /db_xref="GOA:A9VZ69"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ69"
FT                   /protein_id="ABY28625.1"
FT                   /translation="MIRVAQVAPNIFPVPPEHHGGTERIVHDLSVALRSLGIDVTLFAS
FT                   SDSATDLPRVGDHPSLAALQHRNRQVPPGVPAALDALQLEALRQRLDQFDIVHCHGEFA
FT                   HAALLGPRRRQSLTTVHWRVDELDRALFFAGFPDLPVAAISAAQEAGIPASNRAGVVHH
FT                   GIARDRYTFRPEPGAHVAFVGRMTDQKRPDTAIRVARAAGLSIRLGGTIDVGNPDYFER
FT                   SVRPLLGPDATYLGPVDDRAKGELLGGARALLFPIDWPEPFGLVMIEAMACGTPVIAWN
FT                   RGSVPEIVEDGVTGFVVASEAEAVAALARIGQLDRAVVRRRFEERFTAERMARDYIALY
FT                   RRLLAA"
FT   gene            214784..216838
FT                   /locus_tag="Mext_0200"
FT   CDS_pept        214784..216838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0200"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: glycosyl transferase group 1; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase type 3; KEGG: nmu:Nmul_A2267 sucrose-phosphate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28626"
FT                   /db_xref="GOA:A9VZ70"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ70"
FT                   /protein_id="ABY28626.1"
FT                   /translation="MFVLHIALQGCLRGRDVVYGLTSDTGGHIRYLLDLVAASAQDSRV
FT                   ARIVMATRRFEGPPGPDYAVPEERISDKVTLVRLASASPGYRSKEAMHGEVESYAENLI
FT                   AWIGRQPRAPDIIHAHYADAAAVAEIVEDRLGIPFVFTAHSLGRVKAAMVGDGAANDLE
FT                   LSRRIVTEEAALARASLVIASSRDEAEVQYAGYAAYDPGRARVLPPGSDLARFAQSRPH
FT                   PRIDAAIDRFLHDPGKPAVLALARPVARKNLAALVQAYGESPELQACANLVIVAGTRDD
FT                   IDRLDGDMAATMRDLLVLIDRYDLYGHVAYPKTHRPEDVPAIYAYARERGGVFVNPALN
FT                   EPFGLTLLEASAAGLPLVATDSGGPNDIVETCGNGLLVDPRAPAAIAAACLHILTDAPF
FT                   RARCVAGGARAAAAYDWDRHAARYLDLLGALLARNPPLRTPRQLLICDIDNTLVGCESA
FT                   LATFRRWRSRQTGLAFGVATGRSFHSAMAVLEQQASPRPQVMITSVGSEIYHLDANGVT
FT                   YTADAAWREAVSDAWDRGAVGAALGRLDGLVPQGPLEQRAHKLSFFGDEATAHRARDRL
FT                   LQAGLPANVIHSHGRYLDVLPATASKGTAVDHVRALYGLPEQAVFVAGDSGNDVEMLRA
FT                   RTQAIIVANYSDGLATNAALKHSYVARTSHARGIIEGVLHFRRALAYAS"
FT   gene            216860..217750
FT                   /locus_tag="Mext_0201"
FT   CDS_pept        216860..217750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0201"
FT                   /product="putative sugar transferase"
FT                   /note="KEGG: mgi:Mflv_3876 putative sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28627"
FT                   /db_xref="GOA:A9VZ71"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ71"
FT                   /protein_id="ABY28627.1"
FT                   /translation="MTGNAVPPPAPSVLTLVRGRADRLRNLMRGLARQTLPPRELVIAW
FT                   MQPEPAPDLPDPGCPVRHLHVPGEPMPLAAARNRAAAAATGDLLVFLDVDCIPGPTLVA
FT                   AYAEAASAERGLFLGEVLYLPPDAIAGGPAPEPAALDRLGRAHPARPPLPETGLRREPD
FT                   AGQLWGLSFALPAEAWRAVGGMDERYVGYGGEETDLAARLAGSGLPTFWVAGARAYHQH
FT                   HPVHVPPLQHFAPILANATRFHARHGRWCMTYWLEQFRAAGLIAWDAEAAAIRVLRQPS
FT                   APEIVAALRPQALFS"
FT   gene            217798..218946
FT                   /locus_tag="Mext_0202"
FT   CDS_pept        217798..218946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rba:RB4336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28628"
FT                   /db_xref="GOA:A9VZ72"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ72"
FT                   /protein_id="ABY28628.1"
FT                   /translation="MKKPIAFFVHHQGRGHANRTMAVAAEFARDRPVSVLTAGPHLFDG
FT                   FSRDIEIVTLPNMIGAAVPTPRLYAEPTPPVMHCVPLGLAEMRRTMRQILDHLDERAAG
FT                   LFVVDVSAEIAMLARIASVPAVQIRMHGDRNDIAHLGAYEACVGMLAPFDERLEQDDYP
FT                   AHLRDKTFYSGGLCTSVDRVPDRAEARARLGLDPQREIVVAVTGGGGSGTPYAPLTVAA
FT                   RAAPDALWLTLGPTHREGHETDFANLRELGWVPSVTDYLAAADIVVASAGDNTVHEVAR
FT                   VAGRLIVMPEWRYFGEQARKAEALVRFGAAVQAPHWPGDFHGWRDLLDRARSLDGTILR
FT                   SLYAPDAATRAAGWLEGLTDALWQGGSAVQEPDATPLRVVAG"
FT   gene            218997..219938
FT                   /locus_tag="Mext_0203"
FT   CDS_pept        218997..219938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0203"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rba:RB4337 similar to glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28629"
FT                   /db_xref="GOA:A9VZ73"
FT                   /db_xref="InterPro:IPR019290"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ73"
FT                   /protein_id="ABY28629.1"
FT                   /translation="MSTVSVVTLAKGRPAHLRNVLLGLERQTRLPAEFIIAVMQDAPYD
FT                   LPETAFPVRQILVSGTELPLAAARNRGVAAASGENIVFLDVDCIPAPELVADYARALSE
FT                   LDGLLMGEVLHLPEHATAGDWRYADLAAVAEKHSDRRGPPTAGIEICNDYRCFWSLNFA
FT                   IRRATFQAVGGFDERYTGYGGEDTDFGKILDQCGLPIAWMKGALAYHQYHPHHMPPIHH
FT                   LDSVVSNAELFEAKWGYRTMGHWLHAFKVMGLIDDTPEQPIRILRRPDAEDLALNGQQS
FT                   HQPYTNSASVIRHLEAGARERNVPPASVPVTA"
FT   gene            219935..220990
FT                   /locus_tag="Mext_0204"
FT   CDS_pept        219935..220990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0204"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: rba:RB4333
FT                   probable galactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28630"
FT                   /db_xref="GOA:A9VZ74"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ74"
FT                   /protein_id="ABY28630.1"
FT                   /translation="MRIALLAHLRHPIAPPFAGGLEAYTWHLAEGLTARGHEVVLFAAG
FT                   DSDPRFSIDPVIPVHHERSFPGLEHRGDPGLKAHVDAGYAAACDRIAAGGFDVLHNNSL
FT                   SRLPLERRRTAAVPTVTSLHVPPYDALRWCVHDSVTPGHRITVTSRAQAQAWWPDGAAP
FT                   EVSVLHNGIDPALWPYQAHGDGSAVWCGRIAPIKGTHLAVRAARQAGLPLTLFGPIEEP
FT                   DYWETQVAPLIGGPIRYGGHLGGPALAQEVGRASVFLFTPCWDEPFGLVAVEAMACGLP
FT                   VAGFARGAAAEVVGEAGCLVPPEDEAALAQAIGTALTIPRTVPLARVHRLFTRDLWLDR
FT                   CEALYAAARAG"
FT   gene            221035..221703
FT                   /locus_tag="Mext_0205"
FT   CDS_pept        221035..221703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ath:AT1G01180 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28631"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ75"
FT                   /protein_id="ABY28631.1"
FT                   /translation="MTRQDIIAALWHGRDPFADPPDTLRPVDLQGWRSVHPYLEEAVIE
FT                   HRPSVVVEIGTWKGASALYLARTMAEHGIDGTVIAVDTWLGAVDHWMDESLFTELATEH
FT                   GFPSLYRTFLANVLHERLAERVVPLPLDSVNAAELMRLRGVTADVIHLDAGHEETSVAA
FT                   DLRAWWPVLRPGGLFIADDYDRLGGSFPGVTRAVDTFCAEFGVKGPWSFQGKAKFIKLG
FT                   "
FT   gene            222390..223499
FT                   /locus_tag="Mext_0206"
FT   CDS_pept        222390..223499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0206"
FT                   /product="metal-dependent phosphohydrolase HD sub domain"
FT                   /note="PFAM: response regulator receiver; metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; KEGG: bja:bll2340 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28632"
FT                   /db_xref="GOA:A9VZ76"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ76"
FT                   /protein_id="ABY28632.1"
FT                   /translation="MDALLVDDSATMRLRLRGLLEAEPDVAVTDHADPAAGLLEATMRA
FT                   FDLVVVDYHMPAMDGIEFIQSLRKVPHYSLVPIVMVTSDVSDSVRLAALDAGATDFIDK
FT                   SMRGIELTVRLRNLIRLAQAVRKLAEQATWLDGEVEMALRHLREREEEIIFRLSLAVEY
FT                   RDNDTGDHTWRVARYSQIVAEALDLAPEVCRNLYLAAPLHDVGKVAIPDGVLLKPGRLD
FT                   PEEFSLVRTHAAIGKRILGDSSSELISLAAEIAESHHEKWDGSGYPQGLAGTDIPLSAR
FT                   IVAVADVFDALTTQRPYKGAMSFDDALDCIRAESGRHFDPACVEAFCSRWPDILIVGGQ
FT                   NDALGRLHNQQATEPWARVPMLLREIAKS"
FT   gene            223664..226360
FT                   /locus_tag="Mext_0207"
FT   CDS_pept        223664..226360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0207"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; KEGG: bxe:Bxe_A0918
FT                   excinuclease ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28633"
FT                   /db_xref="GOA:A9VZ77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ77"
FT                   /protein_id="ABY28633.1"
FT                   /translation="MDQVKPKERVRIARAGAGRPGYVTVKGAREHNLRDVDVEVPRDAL
FT                   VVFTGVSGSGKSSLAFGTLYAEAQRRYFESVAPYARRMIDQVGVPDVDSIEGLPPAVAL
FT                   QQQRGTPSARSSVGSVTTLSSLVRMMYSRAGTYPPGQPMLYAEDFSPNTPQGACPSCGG
FT                   LGRVYQATEASMVPDPSLTIRERAVAAWPQAWGGQNLRDILVSRGVDVDTPWKDLPRAL
FT                   RDWILFTDDQPQEPVYAGLSPEQTRLARRRRLEPSYMGTFTSARRHVLGTFTNSQSALM
FT                   RRRAASYLVSEDCPVCQGKRLKPEALSVTFAGLDIGELSRMPLADLAEAMRPAAEDRLP
FT                   DEADGSAPDTLDRDTGLRDRARRAASGASAHAGAPDVRATPNLSIEKRLAAQRLAADLI
FT                   DRIGTLTELGLGYLSLDRVTTTLSSGELQRLRLATQLRSQLFGVAYVLDEPTAGLHPAD
FT                   GDAMHDALAGLLASGNSLFVVEHDIGTMRRADWLVDVGPAAGEHGGTVLYSGPPEGLRD
FT                   VEASRTRLHLFGMAEPPQRPRREPSGWLRLEGIVRNNLRGVSAAFPLGCLTAVTGISGS
FT                   GKSSLVSQALLELVGDRLGRPVEIDDEPEDPLDDAPGPTEGRIVGGMDGIRRLVKVDQK
FT                   PIGRTPRSNLATYTGLFDAVRKLFAATPEARKRRYDAGRFSFNVAKGRCPACEGEGFVS
FT                   VELLFMPSVYAPCPTCHGTRYAPDTLEVTWNGLTIADVLGLTVERACDAFADEPSVLRP
FT                   LAVLRDLGLGYLRLGQPATELSGGEAQRIKLATELQRGQRGGTLYVLDEPTTGLHPTDV
FT                   DRLMLQLNGLVDAGNAVVMVEHDMRVVAGADHVIDVGPGAGNLGGTVVAAGHPEDVAEA
FT                   RGSRTAPYLRDELMAYAGQESSPRLAG"
FT   gene            complement(226402..227358)
FT                   /locus_tag="Mext_0208"
FT   CDS_pept        complement(226402..227358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0208"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bra:BRADO0452
FT                   putative bifunctional protein: class I glutamine
FT                   amidotransferase-like (N-terminal), transcriptional
FT                   regulator protein AraC/XylS family (C-terminal)"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28634"
FT                   /db_xref="GOA:A9VZ78"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ78"
FT                   /protein_id="ABY28634.1"
FT                   /translation="MRQVGFILEDGFQVMGLAALSAFEFANTDLGREAYGLRVMSERGG
FT                   TVRSSLRIGIETVPLAEAPDTLMVVGELQPRPLSPGLRAYIAEAGRTSRRVAGLCTGAF
FT                   ALAEAGLLDGRVATTHWAHARDMQERFPLIRVDDDRIFVADGNVWTSAGMSAAIDLTLA
FT                   LIEDDHGAELSRAIARKLVVYHRRPGGQSQFSALLELEPRSDRIRRALVYAKENLRRPL
FT                   TVEEMAEAARVSPRQFSRVFREETGQSPAKAVERLRLEAAKAMLEDGRHSLDVVARDTG
FT                   FTDRDRMRRAFLRAFGHPPQSLRRSLRLIEGGGEAAG"
FT   gene            227486..228274
FT                   /locus_tag="Mext_0209"
FT   CDS_pept        227486..228274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0209"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bbt:BBta_3264 putative oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28635"
FT                   /db_xref="GOA:A9VZ79"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ79"
FT                   /protein_id="ABY28635.1"
FT                   /translation="MSQGTVLITGASSGIGAVYADRFAGRGHDLILVARNKARLDAVAE
FT                   DLTRRHGVSVRTVEADLTDRAGLAAVEAILKDEADITHLVNNAGFGSAAPLAAASVDEM
FT                   ERMIAINVTAPMRLTYAAVPAFTSRGQGTIINIASIVAIGPEVLNGVYGGSKSFVLGFS
FT                   HALRKELAGTGVAVQVVLPGATGTEFWDVAGLPASNLPKEWVMSAEDLVDAALAGLDRG
FT                   EFATIPSLQDAAEWDAWEAARAIMLPHLSSAVPAARYRAA"
FT   sig_peptide     227486..227548
FT                   /locus_tag="Mext_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.817 at
FT                   residue 21"
FT   gene            228467..228913
FT                   /locus_tag="Mext_0210"
FT   CDS_pept        228467..228913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0210"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: sme:SMa1491 isoquinoline 1-oxidoreductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28636"
FT                   /db_xref="GOA:A9VZ80"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ80"
FT                   /protein_id="ABY28636.1"
FT                   /translation="MISLSINGHQHSIDVEPDTPLLFVLRDTIGLTGTKYGCGIGQCGA
FT                   CTVLIDGQAIRSCQMPVESVGAQTVTTIEAIEADPVGARVVAAWVGIEVPQCGYCQSGQ
FT                   VMAATGLLKETPKPSEDAIAAAMTNLCRCGTYNAIAAAVRQAAA"
FT   gene            228924..231182
FT                   /locus_tag="Mext_0211"
FT   CDS_pept        228924..231182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0211"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: bbt:BBta_3261 putative
FT                   isoquinoline 1-oxidoreductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28637"
FT                   /db_xref="GOA:A9VZ81"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ81"
FT                   /protein_id="ABY28637.1"
FT                   /translation="MNDLTPHHRLGIATRPASEPVRNLSRRGFLGVVSGALLLGIDLSK
FT                   DAAAQTRAEGPAAVAAKPGTRVAAFLEIRPDGGVRLLSPFVEGGQGINTGLAQTIGEEL
FT                   DLDPARFTVECAPPGPDYAVVNGLRMTGGSFSTRSSFEAMRRLGATAREMLLRAAAARL
FT                   AVPQDSLTTDDGRVIHAASGRTLGYGEVAQAALALLPRDDVGLKNPKDFRWIGRPVARL
FT                   DMRDKATGRATYAIDIRLDAMLHAAVQHAPHLGTEPRAVANEAEVRAMPGVHSVHRLPG
FT                   AVAVLADSWWRARKGAEALQVTWSEPAPEGIATVSATFSSAAMLAALKSTTEPGLPAEQ
FT                   EGDPGAAFANAAKVIEAEYDAPYLAHAQLEPPSAVARFTADGSLDLWVPNQMPELFQQI
FT                   AAKTAGLEPEQVRIHSPMLGGFFGRHFAYGPANPFPQAILLAKATGRPVRVLWSREEEF
FT                   GMDAVRPLSFARFKAALGPNGMPVALQTTAVGEGPISRWFGALFTSPVDSSVVEGLDKK
FT                   PYAIPNRRLDYVRVAHPVTIAFWRSVGHSMNDYFYESFLDEIAAAGGRDPFELRMALLA
FT                   NSPRHATLLRKVAELAGGWRRGPFAAEDGTRRARGVSMASPFGSETATIAEVSLEDGEA
FT                   RVHDLWIAIDPGSVVNPAIVKRQVESAAALGLSSTLLEQVVYENGQRQARNFDTYRILD
FT                   RTRMPRVHVAIVESGAPMGGIGEPGLPGVPPAVVNAVAVLTGQRVCSLPLAKTRLSGV"
FT   gene            231193..232200
FT                   /locus_tag="Mext_0212"
FT   CDS_pept        231193..232200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0212"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="PFAM: C4-dicarboxylate transporter/malic acid
FT                   transport protein; KEGG: cff:CFF8240_0914 C4-dicarboxylate
FT                   transporter/malic acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28638"
FT                   /db_xref="GOA:A9VZ82"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ82"
FT                   /protein_id="ABY28638.1"
FT                   /translation="MAAPLAPAATEAPAVPVPRFDYLPVALFGSVMGLTGLSVAWRLAA
FT                   ARYGLPPLVADAIGWSAVLTFLALALAYGAKAVTAWPAVTAEFRHPIAGNLFGTVLISL
FT                   LLLPFVLHDLSPPLAAAAWIVGAGGMALFAVLIVSRWMGSRQQLAHATPAWMVPVVGLL
FT                   DIPLAAPALGLPHTQTLAMAALSIGLFFAGPLFTLVFARLVFEEPLPPAQRPTLMILVA
FT                   PFAVGFSSYTATFGRIDAFAEALFLVGLFMFVVLLGRLRDLPRCCPFRVSWWAVSFPLA
FT                   AMAVAALRYAEHVRAVPADVLALALLALATAGIAALATRTLLGIARGELRRLAG"
FT   gene            232432..233682
FT                   /locus_tag="Mext_0213"
FT   CDS_pept        232432..233682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0213"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: amino acid-binding ACT domain protein;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: bra:BRADO1760 D-3-phosphoglycerate
FT                   dehydrogenase (PgdH)"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28639"
FT                   /db_xref="GOA:A9VZ83"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ83"
FT                   /protein_id="ABY28639.1"
FT                   /translation="MPGTDSFTLQDQVNIVLAENIAPSAVEVLARASLHHVRRLPRAIG
FT                   SADADVLAGAHVLGIRSRTQVTTGLLDAAPALVAVGCFSVGTNQVDLEAARARGIPVFN
FT                   APFSNTRSVAELTIGEIVMLLRRITPRSASAHEGGWDKSAENSYEVRGKTLGIVGYGNI
FT                   GAQLSNLAEAMGMRVIFFDLTDRLRHGNTEPADSLDALLAASDVVSLHVPETPLTHGLM
FT                   SAERIGRMKPGAYLINNSRGTVVDLDALADALKEGRLRGAAVDVFPVEPRSNDERFVSP
FT                   LQGIPNVILTPHIGGSTEEAQDRIGSEVARKLVDYVETGSTLGAVNFPQVQIPPRIGGV
FT                   RFLHVHRNVPGVLGHVNQAFARRGVNIASQYLQTEGELGYVVVEADAAPADRAGILAEL
FT                   DAIDGTVRTRLIQARIA"
FT   gene            233698..235095
FT                   /locus_tag="Mext_0214"
FT   CDS_pept        233698..235095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0214"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   xau:Xaut_1614 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28640"
FT                   /db_xref="GOA:A9VZ84"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ84"
FT                   /protein_id="ABY28640.1"
FT                   /translation="MSATGLPPDLLARLDGLLGPGGLLTDEADCAPFAIDWRRLFPGRP
FT                   AAVARPSSTAQVASVVGLCGEAGIALVPQGGHTGLAGGATPDASGRQLVLSLARMNAVR
FT                   ALDPVGLTMEVEAGCVVQAVQAAAEAAGRLFPVSYGAEGSAMVGGMIATNSGGINVLRY
FT                   GMTRNLVLGLEVVLADGSVVDGLRALRKDNAGYDWKQLFIGSEGTLGIVTAAVLRLVPR
FT                   PRHTETALLAVPDPDAALRVLAAAQDGLGDTIQAFELISRCSFDLLERYAGLPSPLPPS
FT                   PWCILLEAGSSLSGLRDAVEGTLGEVLERGDAVDGVLAESKAQAAGLWGLRERITECEA
FT                   HQGKSVKHDVSVPIPAIPAFLEAADRALAEGAPGTVPNVFGHMGDGNLHYNVLIGPEHD
FT                   STAINRLVHDVVDRFAGSISAEHGIGQYRVDELARRRRPEEMALALHLKRALDPDGLLN
FT                   PGKVLRV"
FT   gene            235867..236526
FT                   /locus_tag="Mext_0215"
FT   CDS_pept        235867..236526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0215"
FT                   /product="chaperone protein HtpG"
FT                   /note="KEGG: nha:Nham_4188 chaperone protein HtpG"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28641"
FT                   /db_xref="GOA:A9VZ85"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR039118"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ85"
FT                   /protein_id="ABY28641.1"
FT                   /translation="MVQVFHPGADTVARVVLASIGAAPVLAVGLAYALWRSPYATAQDV
FT                   TREQPVPFSHEHHVGGLGIDCRYCHTSVEKAAFAGIPPTETCMSCHSQEWTNAPMLAPV
FT                   RQSLAEERPLHWNRVHNLPAYVYFNHSVHVAKGVGCSTCHGEVQTMKLMRQAAPLTMGW
FT                   CLDCHRDPAPNLRPHEAVFEMNWKPPADQAAIGTRFMEERHIKSAERLSECSICHR"
FT   gene            236514..239324
FT                   /locus_tag="Mext_0216"
FT   CDS_pept        236514..239324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0216"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: nha:Nham_4187 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28642"
FT                   /db_xref="GOA:A9VZ86"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ86"
FT                   /protein_id="ABY28642.1"
FT                   /translation="MPPLTPPSRREALRLLGAGITLAAGGCSKPVEEIVPYVRAPEQLL
FT                   PGVPVRYATTLSLSGWARGVHAIAVDGRPIKIEGNPLHPSSLGATDVFAEAAILDLYDP
FT                   DRSRTVTERVNGIASWDMFERALSGPLSTVRGERGRGLHFVTGRVTSPTLARQIDALLQ
FT                   ALPEAVWHVHEAIDEANAERGAELAFGRPLRALPRLDRAETILCVGADPLGAGPDQIRL
FT                   ARAFAERRRDPARFGRLYVAESALTLTGVKADARRAVTPLEQAAILTSVANALGAGLAA
FT                   PDLPEAARRFAQAAVADLTAHQSRALVLAGPALPPEWHALTHWINARLRALVDVIAPPD
FT                   RIEGRSPATLADLAQALDRGSVTCLAILGGDPVATAPADLDLARRIARARFSVHAGLHG
FT                   DETAGATHWHLPLTHELESWSDLRATDGTVSLVQPLLRPLYDGRSLHEILPLLTGRSAT
FT                   SGYALVRETWRERGGADFEGWWRRCLHDGVVADSAAPIVDPGEPSLPNLPEIHLAEGLT
FT                   VELRPDPCLWDGRFANNAWLQECPKPISKQVWGNALALSRAEARRRGLEAGDVVRASAG
FT                   GRSIEVPVIIESGVAEGVGVLTLGYGRERAGAIGNGIGANAYGLVTQASPWLVTGVDLA
FT                   KSDRTETILRTQNYVEIEGETKKLFRQIDLAALASAEPKGIGADQPSLLDPWKGDADGH
FT                   AWAMVIDTDACIGCNACVVACQSENNVPVVGPEEIARGRMMHWLRVDIYDEGSPEATRA
FT                   GFQPVPCMHCEHAPCEPVCPVAASVHDGEGLNLQVYNRCVGTRFCEANCPYKVRRFNFF
FT                   GYADGQPYANLGAESVKAQRNPNVTVRARGVMEKCTYCIQRIATERQAAERDGREMNPV
FT                   VTACQSACPTRAIRFGDLAKPGNAISEMRKDSRHYALMEELNTRPRTTYLANLRSPNPD
FT                   LKEDRA"
FT   gene            239321..240691
FT                   /locus_tag="Mext_0217"
FT   CDS_pept        239321..240691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0217"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   nha:Nham_4186 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28643"
FT                   /db_xref="GOA:A9VZ87"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ87"
FT                   /protein_id="ABY28643.1"
FT                   /translation="MSGHAQPHRWIARERLGYGEICAAVADPIQRRGPGRAWVIAFLGV
FT                   LPLVLATVIAIGAVLTVGIGLSGVNTTVVWGFSIANYVWWIGIGNAGTLISSMLLLTRQ
FT                   HWRASINRFAEAMTLFAAAIAGIFPIIHLGRPLYSYWLAPYPNTMDLWPQWRSALVWDF
FT                   WAILSYLLFSLIFWFTGLLPDLATMRDRAQSRFGRRLYGALALGWRGSARHWAVYETFH
FT                   KTMAALAVPLVCSVHSIVGLDFAASLMPGWQESIFPPYFVVGAMYSGFAMVVVLAIIIR
FT                   WGLNLQAVITPAHFDAMAKVMLFASIVMTFSYATEWFMGWYGGDHADRAVIVYFFTGDY
FT                   RWLYYSLLFCNCLVPQALWFARVRLNLWALAIISIVINLGMWLERILIVWNTLSHGHAV
FT                   SLWRTYHVSFYDVVILIAPLGLFAFGFLVLARIFPIVSIHEVSQLAHDEGAARGGTA"
FT   gene            240688..241206
FT                   /locus_tag="Mext_0218"
FT   CDS_pept        240688..241206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_4185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28644"
FT                   /db_xref="GOA:A9VZ88"
FT                   /db_xref="InterPro:IPR021776"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ88"
FT                   /protein_id="ABY28644.1"
FT                   /translation="MSAPLLAEFNNPDALVRAMRLATADGHRALDAFTPFPVPDLTNAF
FT                   APPRNLVRPVMALTGFGAAAAMYALQWYSSVIDYPLNTGGRPLHSWPVFLLVPFEFGVL
FT                   IAAITGLIALFWTCGLPRLHHPLFAIPQFERASQDRFLLLVASKDTDATALRESLERAG
FT                   ALLVAEMHP"
FT   gene            241203..241730
FT                   /locus_tag="Mext_0219"
FT   CDS_pept        241203..241730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_4184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28645"
FT                   /db_xref="GOA:A9VZ89"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ89"
FT                   /protein_id="ABY28645.1"
FT                   /translation="MRRALPLLLPLLATLGACEDQSMRQQARYEVYGKAPLFPDHAEAR
FT                   RPPEGTVAIGALERETALREPPAVDAALLERGRQRYDAICTPCHGYTGHGDGMVVQRGF
FT                   PAPPSYHEDRLRAAPATYFVDVITRGYGVMYAYANRVEPRDRWAIAAYIRALQLSQGAR
FT                   VAEAPGLAEKLP"
FT   sig_peptide     241203..241262
FT                   /locus_tag="Mext_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.560 at
FT                   residue 20"
FT   gene            241727..242683
FT                   /locus_tag="Mext_0220"
FT   CDS_pept        241727..242683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_4183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28646"
FT                   /db_xref="GOA:A9VZ90"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ90"
FT                   /protein_id="ABY28646.1"
FT                   /translation="MSDALFRGWLLAWIVWSAVPFGALVLVMIHTVTGGRWGEVLAPVL
FT                   RPATALVPLAAVTFLGVAFGLHAAYPWAAGTGAKPDVLRLYLDPTLFLVRAAVSLLGWS
FT                   VLAALFLSGRAGTLAAALGLTFYGLTISLVSVDWILSVEPGFNASAFPADVALHQILAA
FT                   LAFAALVSPPSLDARGASDLAGLMLATLLGVIYLELMSYIVAWYGDLPPKAAWYLKRGA
FT                   SPWGGVLVASLILGGILPFLALLFSAVRNSPALMRGVGLLVLVGVAVHFAWLVLPAYGD
FT                   EAGSAAAAAVVALAVLVLLSRFASRLIIRRAGRLRHV"
FT   gene            242676..243197
FT                   /locus_tag="Mext_0221"
FT   CDS_pept        242676..243197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_4182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28647"
FT                   /db_xref="GOA:A9VZ91"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ91"
FT                   /protein_id="ABY28647.1"
FT                   /translation="MSDAARGQLHKRVHDDVVGHAPPGTEAPDIRLKPLLLTGLFIVVF
FT                   TAVTIGGLRYYYNRQGLGPLVQTARMFPAPRLQQSPAADLAAMLKDQRAKLDGYAWIDR
FT                   ANGIARMPIEEAMRRLAARGNAAYAAPLQPERTPALGSRGGASSRVLSPGAGPDAVSTP
FT                   VSTGPGIGAR"
FT   gene            243197..244285
FT                   /locus_tag="Mext_0222"
FT   CDS_pept        243197..244285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0222"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; KEGG: nha:Nham_4180
FT                   cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28648"
FT                   /db_xref="GOA:A9VZ92"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ92"
FT                   /protein_id="ABY28648.1"
FT                   /translation="MLDSLIPAFLRPESASVQAAKVDTIFVGLLLISSAIVLLVVGLIL
FT                   TFAIRFRRGSPAKRGEMPSVVSREFEIGWTAATLFIFVFIFWWAASVEIVAFSPPKDAI
FT                   EIHVVGKQWMWKTQGPSGTREINELHVPVGAPVRLLLTSQDVIHSFYVPAFRLKRDALP
FT                   YQQTETWFQATKTGTYHLLCTEYCGTDHSRMLGRVIVMEPQDYAQWLTRQPERDGLAEL
FT                   GERLFSARGCSGCHNAGSTVHAPSLAGSWGQSVPLEGGRMASVDEAYIRDSILQPQRDV
FT                   VAGYEPIMPSYEGKLSDGEIQALTAYIRHGTDRFDLIGSLNLATAQNICAPGQTPQDGA
FT                   ANQTLRSPAMVPGAPASEETPQ"
FT   gene            244317..246008
FT                   /locus_tag="Mext_0223"
FT   CDS_pept        244317..246008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0223"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: nha:Nham_4179 cytochrome c oxidase, subunit I;
FT                   TIGRFAM: cytochrome c oxidase, subunit I; PFAM: cytochrome
FT                   c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28649"
FT                   /db_xref="GOA:A9VZ93"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ93"
FT                   /protein_id="ABY28649.1"
FT                   /translation="MSGASSDASTLANPRELDLGLPVSYLGEGHSVASWLFTTDHKRIA
FT                   ILYALSITFFFFIGGAAATLVRLELFTPQGDVVGADTYNKLFSLHGIVMVWFFLIPSIP
FT                   TTMGNFLLPLMIGARDLAFPKLNLISWYLNMAGGLLTLAAVLAGGIDTGWTFYVPYSTV
FT                   FSNTFVTLAVLGVFVSGFSTIATGVNFIATVHYLRAPGMTWFRLPLFVWSMYTTSLIFV
FT                   LATPVLALTLVLVIAERTFNLPIFDPARGGDPILFQHLFWFYSHPAVYIMILPAMGVIS
FT                   EVITCYARRRIFGYSFMVYALVAIAVIGFFTWGHHMFTSGMSPFAALVFSFLSFIVAVP
FT                   SAIKVFNWTATLYRGQIGFESPMLYALGFLGLFTMGGLTGLFLASVPIDVHVQDTYFVV
FT                   AHFHYIMVGASVSAYFAGLHFWWPKVTGRMYPESWARFAALLMFFGFNLTFFPQFIAGY
FT                   LGMPRRYYAYPPEFQVWNVLSSSGAAVLAVAYLMPLGYLTWSVFYGSRALNDPWNASGL
FT                   EWRTTSPPPRQNFFGNPEVLGRPYDYHPESAAPAEGDRIAEQGALT"
FT   gene            246005..246694
FT                   /locus_tag="Mext_0224"
FT   CDS_pept        246005..246694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0224"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   nha:Nham_4178 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28650"
FT                   /db_xref="GOA:A9VZ94"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ94"
FT                   /protein_id="ABY28650.1"
FT                   /translation="MSSGGDITPATAGRHLREPWDGLRLPETGAFAYQRAGATFGMWVF
FT                   LASEVLFFGALFLLYTVLRLEHATDFATAARETNIVYGTLNTALLLTSGLTAAIAAQAS
FT                   EQDGLRRLTLICLGATVLLGLAFLVVKGLEYSEDIEKHLVPGADFALKAPATQLFFGFY
FT                   WLSTSVHAIHLSIGVGLIARLIWREWRAPGFLLASPQVEVATLYWGFVDMVWIFLYPML
FT                   YLDGRSA"
FT   gene            246691..246993
FT                   /locus_tag="Mext_0225"
FT   CDS_pept        246691..246993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0225"
FT                   /product="caa(3)-type oxidase, subunit IV"
FT                   /note="TIGRFAM: caa(3)-type oxidase, subunit IV; KEGG:
FT                   noc:Noc_1247 Caa(3)-type oxidase, subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28651"
FT                   /db_xref="GOA:A9VZ95"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR011743"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ95"
FT                   /protein_id="ABY28651.1"
FT                   /translation="MRARLRTKAGALWLRGLVVWLLLLGLLTASLLAAYHLQAPWAPAV
FT                   NFGLAATQAALVALLFMRLNRADHLVRLAAACGLFWLAILFALTLTDTLSRLANT"
FT   sig_peptide     246691..246792
FT                   /locus_tag="Mext_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.592 at
FT                   residue 34"
FT   gene            complement(247134..247484)
FT                   /locus_tag="Mext_0226"
FT   CDS_pept        complement(247134..247484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_p0210 putative insertion element
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28652"
FT                   /db_xref="GOA:A9VZ96"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ96"
FT                   /protein_id="ABY28652.1"
FT                   /translation="MRILIPIEEHSRACLRLKAARHINSVGVIKALADALCLHRIPEHI
FT                   RCDNDLQMISKAPRKWVAKAGAQIRYIAPGSRSTALVARRSAARAGRLPGSGVRHPIAA
FT                   TMQQSRNWLGPK"
FT   gene            complement(247508..247792)
FT                   /locus_tag="Mext_0227"
FT   CDS_pept        complement(247508..247792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28653"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ97"
FT                   /protein_id="ABY28653.1"
FT                   /translation="MNNIKHTALVLFTAVGALAAVTTGASAKAVAPAQACSGSCTSSIV
FT                   SAWTAGAMPRDEFFESDTDSANANNPALPPYARGQGQEAGGPARELIPN"
FT   sig_peptide     complement(247709..247792)
FT                   /locus_tag="Mext_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.698 at
FT                   residue 28"
FT   gene            248069..248590
FT                   /locus_tag="Mext_0228"
FT   CDS_pept        248069..248590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0228"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bja:bll6484 ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28654"
FT                   /db_xref="GOA:A9VZ98"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ98"
FT                   /protein_id="ABY28654.1"
FT                   /translation="MIRLIEPLIPALRRYARALLHNPTDADDLVQDCLERAIGRWHQRR
FT                   ADGDVRTWLYAILHNLAVSQMRQRARRGSSVAVEDAPEATLAVAPSQDDGLLQRDVTAA
FT                   LDALPEEQRGVLLLVSVEGLSYAEAAQVLAIPIGTVMSRLSRARDRMIQLIDGENASAP
FT                   VKRPLLRRVK"
FT   gene            248593..249360
FT                   /locus_tag="Mext_0229"
FT   CDS_pept        248593..249360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll6483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28655"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZ99"
FT                   /protein_id="ABY28655.1"
FT                   /translation="MRPITEDDLQAFVDERLEAARRAEVESYLTRHPDLGRRVERMRAL
FT                   SDDLRGAFGPVAAEPVPAQLNLAHLVEAQRRPRLPTWQAAAAAVLLALGGLGGWGLRGT
FT                   LSAPMTGVDALAQEASANYAVYAPDRLRPVELAASDSDELARWFSARLDRRVGVPDLTS
FT                   SGYRLMGGRLVATPHGPAGLLMYDDHHGTRLVMLMRPMAQPGDAPMREHRSGSAAGYAW
FT                   AQDGLGYSLVGASDPAVLHPLANEIRRTTAANT"
FT   gene            249407..250480
FT                   /locus_tag="Mext_0230"
FT   CDS_pept        249407..250480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0230"
FT                   /product="Catalase domain protein"
FT                   /note="PFAM: Catalase domain protein; KEGG: bxe:Bxe_B1668
FT                   putative catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28656"
FT                   /db_xref="GOA:A9VZA0"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZA0"
FT                   /protein_id="ABY28656.1"
FT                   /translation="MTTRALMLRLAGIGAVLAGTAGVFTYAGGWLSPDALTPARVVDRF
FT                   EQVNGPHPGFRRNHAKGLCVAGTFASNGAGARLSKASVFSAGRVTWVEGRVALAGGQPY
FT                   AADAAATVRSLALRFRLPEGEEWRTGMNNIPVFPVRTPEAFYEQLLAAKPDPATGKPDP
FT                   ERLKAFFAMHPESAKAAALIKARTITAGFADSTFRSLNAFRFVASDGRTTPVRWAFLPE
FT                   RRPEPGSGAQEAQADKNVLFDTLAAELRQEPLHWHLVVTLGQANDATDDATLPWPSDRE
FT                   SVDVGTLTLTGAAPEDADTCRVINFDPLVLPDGIAPSDDPLLSVRSAAYARSFTRRAGE
FT                   EKVPSAVAGTSPDGASL"
FT   sig_peptide     249407..249490
FT                   /locus_tag="Mext_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.390 at
FT                   residue 28"
FT   gene            250477..251043
FT                   /locus_tag="Mext_0231"
FT   CDS_pept        250477..251043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0231"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: xcb:XC_3994 cytochrome
FT                   b561"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28657"
FT                   /db_xref="GOA:A9VZA1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZA1"
FT                   /protein_id="ABY28657.1"
FT                   /translation="MTDSTRFNLPARLLHWSMAALILTTLLIGVAMVTSLADYHALVAL
FT                   HRPLGLLILLLAVLRLANRWRRPPPPLPQNLPVWQRRAAHASHIVLYGLMLAMPLVGWA
FT                   MLSAARYPVTLVGPFVLPPILPQSPMAYAWLRELHTVLAYGLFATILAHIGAALLHALI
FT                   RRDGVFASMAFRSGIRSPATPRAGT"
FT   sig_peptide     250477..250590
FT                   /locus_tag="Mext_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.586 at
FT                   residue 38"
FT   gene            251529..251618
FT                   /pseudo
FT                   /locus_tag="Mext_0232"
FT   gene            251640..253355
FT                   /locus_tag="Mext_0233"
FT   CDS_pept        251640..253355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0233"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="7.2.2.6"
FT                   /note="KEGG: rpe:RPE_4624 potassium-transporting ATPase, A
FT                   subunit; TIGRFAM: potassium-transporting ATPase, A subunit;
FT                   PFAM: K transporting ATPase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28658"
FT                   /db_xref="GOA:A9VZA2"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9VZA2"
FT                   /protein_id="ABY28658.1"
FT                   /translation="MTLNGWMQIALYGAVVLALVRPLGGYMTRVFDGERTLLSPALAPI
FT                   ERGLYRVSGIDARQEQTWLAYAGAMVLFNVAGFVLLYALLRLQALLPLNPADQAAVAPD
FT                   LAFNTATSFVTNTNWQSYGGETTLTYLSQMLGLTHQNFVSAASGMAVAVALIRGFARAS
FT                   TKTLGSCWVDMTRATLYVLLPLCTVLALFYVSQGMPQTLSPYVEATTLEGAKQTIAVGP
FT                   VASQVAIKMLGTNGGGFFNANAAHPFENPTALSNFLQMLSIFVIGAALTNVFGRMVGDE
FT                   RQGWAILTAMGLLFLAGVTVTYWAEANAQGVLSNLGLTGGNMEGKEVRFGIAASALFAV
FT                   ITTAASCGAVNAMHDSFTALGGLIPLLNMQLGEVIIGGVGAGLYGMLVFVVVAIFVAGL
FT                   MVGRTPEYLGKKIEAREVKMAMLGILCLPLMMLGFTAFATVVPDGLAGPANAGPHGFSE
FT                   ILYAYTSAAANNGSAFGGLTANTLFYNTTLAIGMLVGRFFVKIPVLAIAGSLAAKKRLP
FT                   ASAGTFPTHGGLFVGLLVGVVLIIGGLTFFPALALGPVVEHFAGAAGQTFATGG"
FT   gene            253602..255692
FT                   /locus_tag="Mext_0234"
FT   CDS_pept        253602..255692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0234"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   xau:Xaut_3238 K+-transporting ATPase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28659"
FT                   /db_xref="GOA:A9VZA3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZA3"
FT                   /protein_id="ABY28659.1"
FT                   /translation="MSRKTSSLFSAALVGPALLGSVRKLDPRAMIRNPVMFVVEVVAAL
FT                   TTVLFVRDLVTGGSDLFFSGQIILWLWFTLIFANFAEALAEGRGKAQADSLRRTRTEMT
FT                   AKRLTGRGRAYETVPGTSLKVGDVVLVEAGDLIPSDGEVIEGVASVNEAAITGESAPVI
FT                   RESGGDRSAVTGGTQVLSDEIKVRITAAAGSTFVDRMIALVEGAARQKTPNEIALNILL
FT                   AGLTIVFVFAVATIPSFASYAGGSIPVIVLVALFVTLIPTTIGALLSAIGIAGMDRLVR
FT                   FNVLAMSGRAVEAAGDIDTLLLDKTGTITLGNRQATAFRPVRGIAEQDLADAAQLASLA
FT                   DETPEGRSIVVLAKETYGIRARDMAGLNATFVPFTAQSRMSGVDLEGSSIRKGAVDAVI
FT                   ASVSEAPMATRGSSAALAYRPAAETEVMAEIRTIAEEIAKAGGTPLAVAKDGRLLGVVA
FT                   LKDIVKGGIRERFAELRRMGIRTVMITGDNPMTAAAIAAEAGVDDFLAQATPEDKLALI
FT                   RREQAEGKLVAMCGDGTNDAPALAQADVGVAMNTGTVAAREAGNMVDLDSDPTKLIEIV
FT                   GIGKQLLMTRGALTTFSIANDVAKYFAIIPAMFLTLYPQLQALNVMGLASPQSAILSAI
FT                   IFNAVVIVALIPLALRGVTYRPVGAASLLRRNLLIYGLGGILVPFVAIKAIDLAVTALH
FT                   LA"
FT   sig_peptide     253602..253661
FT                   /locus_tag="Mext_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.578 at
FT                   residue 20"
FT   gene            255716..256321
FT                   /locus_tag="Mext_0235"
FT   CDS_pept        255716..256321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0235"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="7.2.2.6"
FT                   /note="KEGG: bja:bll6777 potassium-transporting ATPase C
FT                   chain; TIGRFAM: potassium-transporting ATPase, C subunit;
FT                   PFAM: K transporting ATPase KdpC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28660"
FT                   /db_xref="GOA:A9VZA4"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9VZA4"
FT                   /protein_id="ABY28660.1"
FT                   /translation="MLNQLRPALVLLVALTAVTGLAYPLAVTGIAGALFPAKAAGSLIE
FT                   RDGRIIGSSLIGQSFTGEGYFHGRPSATNAADPADASKTVPAPYNAASSAGSNLGPTSA
FT                   ALAERVKGDLAALKAENPGRPVPVDLVTTSGSGLDPDISPEAALFQVPRIARARNLPEA
FT                   RLRDLVAGQVQGRTLGLLGEPRVNVLALNLVLDDLAKR"
FT   sig_peptide     255716..255784
FT                   /locus_tag="Mext_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.767 at
FT                   residue 23"
FT   gene            256332..259049
FT                   /locus_tag="Mext_0236"
FT   CDS_pept        256332..259049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0236"
FT                   /product="Osmosensitive K channel His kinase sensor"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Osmosensitive K channel
FT                   His kinase sensor; UspA domain protein; KEGG: bbt:BBta_6335
FT                   sensory histidine kinase in two-component regulatory system
FT                   wtih KdpE, regulation of potassium translocation"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28661"
FT                   /db_xref="GOA:A9VZA5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZA5"
FT                   /protein_id="ABY28661.1"
FT                   /translation="MPGTGRDPNRPSPDALLEAARREERTRGRLKVFLGAAPGVGKTYE
FT                   MLTIGRARLTAGADVVVGVVETHGRAETETLLDGFESIPRRAVPYRGTVLEEMDLDALL
FT                   ARRPALALVDELAHTNAPGSRHPKRYHDVEELLDAGIDVLTTLNIQHVESLNDVVASIT
FT                   RIRVRETVPDSILDRADDIEVVDLNPDDLIERLKAGKVYVPANAERALKHYFSRGNLTA
FT                   LRELALRRTADRVDDELLSHMRANAIPGPWAAGERVLVCVSEDPRSAGLVRYAKRLADR
FT                   LHAPWTALVVEGPRPASLSEAARDRVAEALRLADRLGGDAVTLPGGRRIADDILAYARA
FT                   ANVNHIVVGKATRSWIFELVNGSVVHDLVRRSGNISVHVVPGEVAPTETASRRAVATAA
FT                   PPATFDARSYALALLITGAGLGLALLLEPSTGVENADLMLLTAVVAVAVRWGLGPSLAA
FT                   VVAASLSYNFFFLPPVYTFTIADPTNVAAFLLFTLVAVLVSNLAARARLSAVVSQGRAK
FT                   ATERLFGFSRKLAACGTLDDVLWATSAQVAAMLRVRVVLLLPDAQTVAVRAGYPPEDML
FT                   DEADLAAAQWALDNERPAGRGADTLPGAKRLFLPMRTGRGTIGVIGLDADGTGPILTPE
FT                   GRRLLDALADMGALALERVRLVEDLDRAKRAAETDRLARALLTSISHDLRTPLASVLGA
FT                   ASTLRDLDGALPVEAKAELLTTIIEESERLNRFIVNLLDMTRLEAGAVAPNLGLQDVAE
FT                   TIDTALRRTQKILAGHRVAVEIAPDLPTLRLDPVLFEQVLVNLLDNAAKYAPEDSTVTL
FT                   RARRDGRTVRIEVLDEGFGLPEADVERVFDKFYRVRKSDRVRAGTGLGLAISRGFVEAM
FT                   GGTVTAGNRRDRLGAAFTVTLPVPARTTPRDIAA"
FT   gene            259046..259792
FT                   /locus_tag="Mext_0237"
FT   CDS_pept        259046..259792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0237"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rpd:RPD_0666 response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28662"
FT                   /db_xref="GOA:A9VZA6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZA6"
FT                   /protein_id="ABY28662.1"
FT                   /translation="MSPTILVIDDEPPIRKLLRMGLATQGYAILEAPNAATALEVLGRD
FT                   SPDLVILDLGLPDMRGHDLLRAIRASHPGLPVVVLSSRDDEGGKVEALDLGADDYVTKP
FT                   FGMAELLARLRAALRHQLAARGERPVFRVDGLSVDLVRRIVKVDDVEVKLTPREYAFLR
FT                   IMVLHAGKVLTHAQLMNEVSVSSDPQYLRVYMRQLRQKLEADPERPRILLTETGVGYRL
FT                   RAPDDEPNLKLRAANDPKPAVTEAGS"
FT   gene            complement(260040..260291)
FT                   /locus_tag="Mext_0238"
FT   CDS_pept        complement(260040..260291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28663"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZA7"
FT                   /protein_id="ABY28663.1"
FT                   /translation="MNPRHTMSPTLQVAAIHADASATDADRFIVGQDPAGHWVAIEIHG
FT                   RAGGLFRSRKDAVDYAEDETDHRPDAVLLSGACIELRI"
FT   gene            260483..261844
FT                   /locus_tag="Mext_0239"
FT   CDS_pept        260483..261844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0239"
FT                   /product="TRAP-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: rpc:RPC_2525 TRAP transporter solute receptor,
FT                   TAXI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28664"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZA8"
FT                   /protein_id="ABY28664.1"
FT                   /translation="MRRLGLSSVREVFLPLGLALLLVLGAVAAFHLTRPTTLTIAVAPN
FT                   GGTEPALLRAYADELARRNLGIRLKVVSFAGVRESAEALKAGKADLAVVRPDVAMPGNG
FT                   LTLAVLRTLAAFVAAPGASGTKDIPDLAGKRLGMLASRTADRTLLHDLVGHYGFELLTD
FT                   APAGAVNTTAVVLVPIEEADVATALRDGRIDAMALVTTPSSPAARRVVALVGEASDGGD
FT                   VALIGLPDTAAVLARRPRLQPVTVPAALYGGNPRLPAEDVATVGSSYRLMARADLSRSV
FT                   AAEVTQHLFEMRAALAETVPAAEDVSHPDYEDTADATSARLPIHPGALDYYEREQETLI
FT                   ERYESWIYLVAILGGGLGSTAAWLRQRIGRQRRERIEVATARLLELRSEARRETDRERL
FT                   EAMAGEVDDLAASIARHALNKPTEPRTLSAATVAIDAARSTLKRVLSGAGRPIG"
FT   sig_peptide     260483..260572
FT                   /locus_tag="Mext_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.591 at
FT                   residue 30"
FT   gene            complement(262145..263083)
FT                   /locus_tag="Mext_0240"
FT   CDS_pept        complement(262145..263083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_3881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28665"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZA9"
FT                   /protein_id="ABY28665.1"
FT                   /translation="MIEAVMLWNEPNNKSHWDPEIDPDWFLFSEMVKQASRAIRAEAPD
FT                   LPQVLGGISPIDPVFMQHMQARGVLDGLDAVAVHGFPLDWNLWPIHDWPQKIAEIRAVT
FT                   HLPVWVSEVGVSSFGAEEVQAWGCRRTAELLRGQAPRIHWYSLYDLPREWEATTRHREA
FT                   EGSSYYRHFHMGLLRQDGTPKLALEEFARCTPDFGLCQWFHYQDHRLDEAVAWMKRLGV
FT                   TYLRTGLSWADSFRPDALDWFDRQMTALQDFKVTVTFCFTPEHRGIAAHHTSPPLVREE
FT                   FAEFCAAMVRRYADRQPVQVEALPVPEMPFL"
FT   gene            complement(263080..263868)
FT                   /locus_tag="Mext_0241"
FT   CDS_pept        complement(263080..263868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0241"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: methyltransferase putative; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: bra:BRADO2072
FT                   putative 3-demethylubiquinone-9 3-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28666"
FT                   /db_xref="GOA:A9VZB0"
FT                   /db_xref="InterPro:IPR027554"
FT                   /db_xref="InterPro:IPR027555"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZB0"
FT                   /protein_id="ABY28666.1"
FT                   /translation="MTRLATDAANSEALRREADALGPWFHNIDLGGVWTAPDHFLGDYP
FT                   GLKWRRFASALPADLTGKSVLDIGCNGGFYSIEMKRRGASRVLGLDSDERYLAQARFAA
FT                   DHLGHDIEFRNLSVYDVGALAERFDVVLFMGVLYHLRHPLLALDLIHEHVAGDLLVFQS
FT                   MLRGSSQVEPVADDYDFWDMDQFERPGYPRLHFVEHSYAHDWTNWWIPNRAGMEAMLRA
FT                   SGFTIESRPEAEVYLCRRAPAPTGAEAVYPARGINGREGR"
FT   gene            complement(263865..264650)
FT                   /locus_tag="Mext_0242"
FT   CDS_pept        complement(263865..264650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0242"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: sme:SMb20250
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28667"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZB1"
FT                   /protein_id="ABY28667.1"
FT                   /translation="MRRVFLVRHASHDRLGKVLCGRMPDVSLSAQGRAEAEAMATALVR
FT                   RLAPDLHTSSAEQDRAPLLSLAGRWEEPEVAQDEAARYPLPAPNSQGGGERTRLAPVID
FT                   GERTPRSGIRVLSSPQTRTRATAAPLAQKLGAAIETADEIDEIEFGAWTGRAFAEFASD
FT                   PAWVAWNAERATARPPGGESMGEVQARALRLLDRLGREEAPPAILVSHADTIRAALLGV
FT                   LGLSLDAYDRLVVAPASWSELALWPGGGRVVSINERVSP"
FT   gene            complement(264647..265744)
FT                   /locus_tag="Mext_0243"
FT   CDS_pept        complement(264647..265744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0243"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /note="PFAM: Myo-inositol-1-phosphate synthase;
FT                   Myo-inositol-1-phosphate synthase GAPDH domain protein;
FT                   KEGG: sme:SMb20249 myo-inositol-1-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28668"
FT                   /db_xref="GOA:A9VZB2"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZB2"
FT                   /protein_id="ABY28668.1"
FT                   /translation="MASAPIRVGIIGVGNCASSFVQGLHFYREADADTAVPGLISPELG
FT                   GYRIGDIEVVSAFDVAADKVGRDVADAILAPPNNTHRFAAVPRTGVTVRRGPTLDGIGR
FT                   YLQGIIAESNEPVSDVVAELQRSRTQVLLSYLPVGSQAAGEFYAHCALEAGCALVNCIP
FT                   VFIASDAGWRKRFEERGLPIVGDDIKSQVGATIVHRMLANLLRERGVKLERTYQLNFGG
FT                   NADFLNMLERERLESKKLSKTRAVTSQLATPLADGDIHVGPSDHVPWLEDRKWAQIRLE
FT                   GTGFGGVPLNIELKLEVWDSPNSAGVVVDAVRCARIALDRGIGGALLGPSGWFMKSPPV
FT                   QFTDAEAHARTLRFAAGEAEEPAAR"
FT   gene            complement(265744..266784)
FT                   /locus_tag="Mext_0244"
FT   CDS_pept        complement(265744..266784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0244"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: mes:Meso_2774 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28669"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZB3"
FT                   /protein_id="ABY28669.1"
FT                   /translation="MDRQAEWVLVAGGAGFIGSHLVDALLARGARVIALDSLLTGRRDN
FT                   LAHLSREPRFEFVEADITEPLPRLPRFERVFNLACAASPPHYQADPIHTMLTSVVGTLR
FT                   LLERARNDGARFLQASTSEVYGDPLVHPQPEAYWGNVNPTGPRACYDEGKRAAETLAFD
FT                   FERGQGLEVRVARIFNTYGPRMRADDGRVVSNVICQALADAPVTVYGDGEQTRSFCYVT
FT                   DLVEGLMRLMACEAAPGGPVNLGNPREMTVAELVSLVSEMTGTRSPVVRRPLPVDDPQR
FT                   RRPDIARAQALLGWSPKVALEQGLEATIAWFAGEIRAPEQPVAKPRSIGGRHLRPVEAA
FT                   LARQAP"
FT   gene            complement(266811..267911)
FT                   /locus_tag="Mext_0245"
FT   CDS_pept        complement(266811..267911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_1058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28670"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZB4"
FT                   /protein_id="ABY28670.1"
FT                   /translation="MTSAPLRLVVLGLSLSSSWGNGHATTYRALLRAFAARGHDVLFLE
FT                   RDVPWYAAHRDLTDPDFCRLALYADLDDLEDHRAAIEQADAVVVGSYVPDGIAVGRRVL
FT                   AWAEGTRAFYDIDTPVTLANLAAGTCAYLEANQIEAYDLYLSFTGGPTLERLEERYGSP
FT                   AARALYCSVDPEAYPPSAGEKAYDLSYLGTYSPDRQPILEQLLIEPARRAPDLRFAVSG
FT                   PQYPDGIDWPANVTRSDHLPPEAHPAFYGQSRYTLNVTRADMTAAGYSPSVRLFEAAAC
FT                   AIPILSDRWDGLDTILAPGREILCPEGPDAVLAILRDRPEPERRRIGEAGRAAILARHS
FT                   AAHRAAEFETHLREAAARLAFLRTPP"
FT   sig_peptide     complement(267837..267911)
FT                   /locus_tag="Mext_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.818 at
FT                   residue 25"
FT   gene            complement(267908..269014)
FT                   /locus_tag="Mext_0246"
FT   CDS_pept        complement(267908..269014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_3891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28671"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZB5"
FT                   /protein_id="ABY28671.1"
FT                   /translation="MKIAFYGSSLLSSYWNGAATYYRGMLADLARRGHRITFYEPDAFD
FT                   RQSHRDIDPPDWAEVQVYPATIEAARAVIAQAAKADVVVKASGVGVFDDELLEGVVAAA
FT                   RPDAIRIFWDVDAPATLAEMRANPDHALHRAMPALDFVLTYGGGPPVIAAYEGFGARAC
FT                   IPVYNALDSETHHPVPPDPRFSADLAFLGNRLPDREARVERFFLAAAARLPERSFLLGG
FT                   SGWESRGLPLNVRHLGHVSTRDHNAFNVTPRAVLNIARDSMAAVGFSPATRVFEAAGAG
FT                   ACLITDTWEGLGLFLKEGEEVLVARDGRDVADHVAALTPERARAIGEAARLRIAAEHTY
FT                   ARRGAQVDAILRDERERRACGALRLSVA"
FT   gene            complement(269011..270138)
FT                   /locus_tag="Mext_0247"
FT   CDS_pept        complement(269011..270138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsh:Rsph17029_2169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28672"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZB6"
FT                   /protein_id="ABY28672.1"
FT                   /translation="MRIVYFTHSLASCWNHGNAHFLRGVLRELAGLGHAIEAYEPEGAW
FT                   SRENLLRDHGPAGLEASLAPYPELSPKTYATIEAAVEYVEGADLVVVHEWNEPALVAAL
FT                   GRSRKGGRIDTLLFHDTHHRAVSAPDAMRCFDLSGYDGILAFGETLAEVYRSWGWGARA
FT                   YVWHEAADTRLFRPPEETDVPRADLVWIGNWGDGERTQELETFLFRPAQAAGLSLDIHG
FT                   VRYPAEALATLERYGARYHGWAPNAVAPTLFAHALATVHVPRRFYVEALPGIPTIRVFE
FT                   ALACGLPLACAPWNDAEGLFTPGSDYLIARDGEQMEAHLLALREDASLRRSLTAHGLAT
FT                   IRARHTCRHRADELLAIHDSLTTSLNVPVRMEAAP"
FT   gene            complement(270135..271241)
FT                   /locus_tag="Mext_0248"
FT   CDS_pept        complement(270135..271241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0248"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rsh:Rsph17029_2170 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28673"
FT                   /db_xref="GOA:A9VZB7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZB7"
FT                   /protein_id="ABY28673.1"
FT                   /translation="MPLTAARPHILMSADALGGVWQYTLDLAAGLTRRGTTVSVALMGP
FT                   APAPERIARAQDISGARILTTNLPLDWTAESAAEVRDASDALARLADETSADLVHLHSP
FT                   ALALADFAAPVVAVCHSCVATWWATVGSGPLPADLVWRRDLNAQGCRKADRLIAPTHAF
FT                   ARTTQAAYGLAQAPLVVRNGRDVSVSSEAEPASHVFTAGRLWDLAKNAAALDRLAARLS
FT                   VPLRAAGPVAGPTGQHVALIALDCLGRLDDEEIARELSLRPVFVSLARYEPFGLAVLEA
FT                   AGAGCALVLSDIESFRELWDGAALFVPSDDDAAAARAVQDLFADPASRAALGRAARTRA
FT                   AAYGTEAMVAGVARIVRGLHPALDEAAA"
FT   gene            complement(271232..272527)
FT                   /locus_tag="Mext_0249"
FT   CDS_pept        complement(271232..272527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0249"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: bra:BRADO2067 putative Fe-S
FT                   oxidoreductase homolog to magnesium-protoporphyrin IX
FT                   monomethyl ester (oxidative) cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28674"
FT                   /db_xref="GOA:A9VZB8"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR027559"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZB8"
FT                   /protein_id="ABY28674.1"
FT                   /translation="MRVAFVNPPWDYRNSIYFGCREPHLPLELGYAAALLEAGGHETLL
FT                   VDCHLEGLSAAEGVERIAAFAPAMTVITTAPTYLFWRCAPPEMRVPRAFLDALQGRGGR
FT                   TVAVGPHGSATPRPTLEKLGCDVVVRGECEEIVARLAETDDLRSLPTLAYRDAEGRVVV
FT                   TGPPHAGRFTDLPALAWPDAWIARHHHHHHRFDTAPDGPGAEIEASRGCPYTCSFCAKI
FT                   DFRDAYRRRDLPIILDEIDGLISQGVTYLYFVDEIFLPQKPLLEALVGRRVKFGVQTRI
FT                   DLWKPDMLDLLGAAGCVSIEAGIESLTEEGRAALDKRCRASTDDLAERLIYARRTVPFV
FT                   QANLIAVAGDDPDLVAAWRDRLRGAGVWANDPVPLYPYPSSPDYRRLWGEPDDAAWERA
FT                   HAHYLSQFTRFSDIQEERPLPLPELEATCGCR"
FT   gene            complement(272524..273615)
FT                   /locus_tag="Mext_0250"
FT   CDS_pept        complement(272524..273615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0250"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: rsp:RSP_0519 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28675"
FT                   /db_xref="GOA:A9VZB9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZB9"
FT                   /protein_id="ABY28675.1"
FT                   /translation="MSGPATTATRPVLVTGGAGFVGANLADQLAAEGQTVLVYDALTRP
FT                   GVEANLTWLTERHGARIVPVIADIRDGAELALAVREAGAVFHFAAQVAVTTSMTAPWED
FT                   MEVNLGGTLTLLEALRARRSAVPLLFASTNKVYGGLPDVELAVEGDAYRPTDSNLRAHG
FT                   VGEDRRLDFHTPYGCSKGAADAYVLDYARSYGLPTVVMRMSCIYGPRQMGNEDQGWVAH
FT                   FLIRALTNRTVTLYGDGRQVRDILHVRDAVAAYRAALARIDRVAGRAFNLGGGPDNAVS
FT                   LRGLIAHLGTLLGREVGIETGAWRPGDQRYYVSDTRRAASMLGLEPPLPWREGVADLAA
FT                   GLTQWLDAEAATSRAARQPEAVL"
FT   gene            complement(273612..274724)
FT                   /locus_tag="Mext_0251"
FT   CDS_pept        complement(273612..274724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0251"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: ade:Adeh_1060 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28676"
FT                   /db_xref="GOA:A9VZC0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZC0"
FT                   /protein_id="ABY28676.1"
FT                   /translation="MKKLALITGGAGFIGRHLASALLARGYRVRVLDSLIEQVHGGTGQ
FT                   PLSLDPAVEFVEGDVRDAEAVARAIAGATHVVHLAAEVGVGQSMYAVERYVSVNDCGTA
FT                   TLFQALIEAPVQRVVVASSMSIYGEGLYRTEADATVEDAVRPPRRSGEPWDPPDQQGRP
FT                   MRPVPTPESKRPALASVYALTKYMQERLTLTLAPAYGMEGVALRLWNVYGPGQALSNPY
FT                   TGVLAIFAARLLHGQPPVIFEDGEQRRDFVHVEDVAQAFVLALEHPAAAGQVYNVGSGE
FT                   DRTVNEVARLLARAMGREEIAPQVTGQARAGDLRHCIADIGKITRELGYAPKRDFAEGL
FT                   AELAAWVAEQQAVDRVAEARRELEARGLVA"
FT   sig_peptide     complement(274659..274724)
FT                   /locus_tag="Mext_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.706 at
FT                   residue 22"
FT   gene            complement(275638..275997)
FT                   /pseudo
FT                   /locus_tag="Mext_0252"
FT   gene            277465..278703
FT                   /locus_tag="Mext_0253"
FT   CDS_pept        277465..278703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0253"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sil:SPO1927
FT                   site-specfic recombinase, phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28677"
FT                   /db_xref="GOA:A9VZC1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZC1"
FT                   /protein_id="ABY28677.1"
FT                   /translation="MGGASWADTAMGGKGRHPDKALTTVQVRALKVPGRYADGNGLYLV
FT                   VEPSGSKRWLLRTIVQGRRRDIGLGGAGLVTLAEAREKALAYRKLARDGGDPLAERRKA
FT                   RATVPTFAEAAEQVHEEHKASWKNPKHAAQWITTLRTYANPHLGARRVDQIETPDVLRA
FT                   LSPIWLTKGETARRVRQRIGTVLDWAKAAGHRTGDNPVESVAKGLPKQGERDEHHAALP
FT                   YAEVPAFVTRLQSSDHGEAARLAFEFLILTAARTSEVLRAEWREIDEAEALWTVPAARM
FT                   KAGREHRVPLSKRSLEIVRRAKLLAGDSAFIFPGRSTGKPMSNMVFLMALRRMKLTVTA
FT                   HGFRSSFRDWAAEATSLPREVAEMALAHTIENRVEAAYRRGDLLAKRREMMEQWSTFVA
FT                   SKPKGDKPHKSSA"
FT   gene            278713..279735
FT                   /locus_tag="Mext_0254"
FT   CDS_pept        278713..279735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28678"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZC2"
FT                   /protein_id="ABY28678.1"
FT                   /translation="MRAPRRRTHRRVPKRHSLAEQDRIIARFEEARSRDVRPDEAIAGL
FT                   GASLASVYRWQRARNPSKGMPTATFAQELSIDTAIARLCDERNDDRHTFLDALFKFIAW
FT                   LRWPTTPGDHPAAMMVCAVSYLSAGRSARTLDELPPDDLALALRHVSIDTLKRICSDDL
FT                   FAMPSFELWELDDQPYTKLDYLAQITHFLLAYRPPSADPRDAASLFKAYAAMNGGLFRY
FT                   KWSVSRRTFSTFWRESAASAPFHYVERVHPSLEFSLDPSKNDFAENIDEAYSRRGELRR
FT                   HLARCLAAIELLQSKLDRRSLEAIRFPRFPSSLSAEAIEPPELPEITDTIRAEFRKWRN
FT                   "
FT   gene            279856..280089
FT                   /locus_tag="Mext_0255"
FT   CDS_pept        279856..280089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0255"
FT                   /product="Prophage CP4-57 regulatory"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG: xcv:XCV2219
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28679"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZC3"
FT                   /protein_id="ABY28679.1"
FT                   /translation="MTDLPSISQNGLAADGLPLAGFVRLSRLLAPNGPLPISKSSWWEG
FT                   VRSQRYPQPVKLGPRITAWRTSDIRALIERGV"
FT   gene            280092..281069
FT                   /locus_tag="Mext_0256"
FT   CDS_pept        280092..281069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28680"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZC4"
FT                   /protein_id="ABY28680.1"
FT                   /translation="MKRDPLPFDYLPPVSLPHPEPTIAERLILGDELHFGDDHPQWWEG
FT                   RRKRPCQTAAEAAVERLRLVQRLRRYSARVDFNARAVADRLERCCPDFRCRSGACPECA
FT                   RAWQRWFTVATQDFLAHATPTGSQGMILSPVHETGIVEPGEGLPPAALRSVKSVVHDAL
FT                   TAAGLTTAVVGIDVSFNEHLTADFRPHWCLHPRVFVPGALTASAVRTLRTHFPPSELIP
FT                   RPLKVAAFDGNPAGIAYGMKPAFGRRQSYEQTKPTATGTRQCRNTRGRPLRGDEAVELA
FT                   IFLDAVGLRQRLILHEAALKRDQGGAVVIRLDHRLPKHAPLLSR"
FT   gene            281179..282921
FT                   /locus_tag="Mext_0257"
FT   CDS_pept        281179..282921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0257"
FT                   /product="Superfamily II helicase and inactivated
FT                   derivatives-like protein"
FT                   /note="KEGG: noc:Noc_2244 protein of unknown function
FT                   DUF927"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28681"
FT                   /db_xref="GOA:A9VZC5"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZC5"
FT                   /protein_id="ABY28681.1"
FT                   /translation="MLTAHHGDTVVATFNLSPRLRARIDKGAPEPKTSTGSAEKPAVAV
FT                   RALIHDLDLNSYLLELRFWRIDGAKGTLTIPRSLTASPQDVRRMLLDAGALLPRDAKAA
FT                   TALVQAHLAQDPPQTREITRRGGWHGDSFVTNGRTFGPQAASLSFVGSSIFEDPSIGMR
FT                   RGTFEGWRSGLTPACAASSFLTFGLSVGYAGPLLDLLGEDEGAIFNFYGHSSTGKTLIA
FT                   RCLHSQAGRAQSSDLPTYGISPRGAEELCFARNDWAVVFDEAGRTTGTPEQRREKVRSM
FT                   AFMVPSGRGAIRSARVGRHHDLPNLTWRLFGISSGERPLDEPGTTRFAGEQLRHIDITV
FT                   PRPVYAGVFDRIEGESEDLRAEAARLAGELEVAIAANYGLARDHYLDRLTAERATLDAD
FT                   VRRIVDDFVERVGASTQPWERRLARKFGIVLAGAVLAAEWEVAPFSPEHAHRCVLIIYR
FT                   NARRAIVSVEEQTGDVLHRLREARSQGLFPLLQKGEALPEDARDVAWGFRREVDGREIV
FT                   AVLPSTFEDLAPSKPSAIAVLDTLLEKGTALPGPDGKRHRQIAVQGFPRTGRGRWVCLL
FT                   SSKI"
FT   gene            283044..283619
FT                   /locus_tag="Mext_0258"
FT   CDS_pept        283044..283619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28682"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZC6"
FT                   /protein_id="ABY28682.1"
FT                   /translation="MIRTWLPSLSTPPEGDRRSRKALGAMPRFASETIMPPITTEDALY
FT                   KFLLALACSTGEEELLPVAYVTRVEQLVSAVGILAPASVPDSFRRPAEAMLYCITSVTL
FT                   DNERAAPGPRRAVHPNLEKLFRILVAGYMANVTIRAANDALLTLLALPQARLVETVKHQ
FT                   GWWLLRTSPLGQQELGVSIAVARNRPLD"
FT   gene            283764..284069
FT                   /locus_tag="Mext_0259"
FT   CDS_pept        283764..284069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28683"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZC7"
FT                   /protein_id="ABY28683.1"
FT                   /translation="MPIWTESECETFFADGKPSATEPCQVRIADGRIVVDARGANGGWM
FT                   YEGEEVGPDHFQLTSPARAGTATLHRFERDSLLDGGWREGAAYGMWRITLGQSEAD"
FT   gene            complement(284472..284981)
FT                   /locus_tag="Mext_0260"
FT   CDS_pept        complement(284472..284981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sru:SRU_0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28684"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZC8"
FT                   /protein_id="ABY28684.1"
FT                   /translation="MCEQQARKILGSRASSVFSAVGRAALRAGSRADADAISRAAGGLG
FT                   IGAQAWGLAEKLKEADAVMTPEHQRLVREVHPEVSFWAMNGRAPLPAGKKTLEGMLGRM
FT                   DALEAEGFPSTFVRQLPAGLRVGRDDFLDACAALWTARRIEAGQAERFPAAIDPDARGV
FT                   DQAIWY"
FT   gene            285505..286128
FT                   /locus_tag="Mext_0261"
FT   CDS_pept        285505..286128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_2240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28685"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZC9"
FT                   /protein_id="ABY28685.1"
FT                   /translation="MLPALLTLPAPAAALPPAIILFGRDERGQPHASRFAGDMAGEAEA
FT                   AAGLMCLHHAIANTDALRDLAARLPAGRLFPSGRGFVPFVKAELYERLLAATVTADTPL
FT                   PVRAVSKAADAPPPAGAGSGSKGSPDAPGGTPKAPGDWAGIKVGSTVLACQGPMEGWWE
FT                   AVVVATKADDRFVLRWRDFPDEPEISRARADLGLMPPGSREGLG"
FT   gene            286133..286546
FT                   /locus_tag="Mext_0262"
FT   CDS_pept        286133..286546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mag:amb3705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28686"
FT                   /db_xref="InterPro:IPR022243"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZD0"
FT                   /protein_id="ABY28686.1"
FT                   /translation="MAAPPVAKRPHPVRDLNDAFRRSFSGGRVVLTPGIAALPEVTRAA
FT                   MLAAVSGFDAFDADNDPHGEQDFGAVEVAGRRCFWKIDTYDRDLRFASSHPADPAVTAR
FT                   VLTVMQAEEYGGGRRSGHRRPADGGCTRLSNRC"
FT   gene            286773..287015
FT                   /locus_tag="Mext_0263"
FT   CDS_pept        286773..287015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28687"
FT                   /db_xref="GOA:A9VZD1"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZD1"
FT                   /protein_id="ABY28687.1"
FT                   /translation="MVLGVGRFYIGSWKWLLRIMVVVFGLIALGIWLNNVRSPEDQHGI
FT                   DCKRAYLYRQGMPDPSDWNSPIPGCDLSLRYYQPK"
FT   gene            complement(287514..289130)
FT                   /locus_tag="Mext_0264"
FT   CDS_pept        complement(287514..289130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0264"
FT                   /product="protein of unknown function DUF1254"
FT                   /note="PFAM: protein of unknown function DUF1214; protein
FT                   of unknown function DUF1254; KEGG: rle:RL1925 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28688"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZD2"
FT                   /protein_id="ABY28688.1"
FT                   /translation="MRKFKLTSLVVLCVTLGSIGLATAQTAPAPPPSITTQDKVNTRFG
FT                   TFEFKDGAPSKNTLNKAYDYIDFTHAYNAFVNTMQGVSLVAARKGFLDAGVKDNEILIF
FT                   SELMDAKSLFLTANADTVYFLGFIDVSKGPMVFEVPPKVLGALDDMWFRWVTDFGLPGP
FT                   DRGLGGKYLILPPGYDAPVPDGGYYVARSNTTRLLIMGRAFLENKSDPKPAVEAIKNFT
FT                   KIYPYEAGGIGTPIAAFLSGKAKLGKIIEPPATVFHEGSGKVMNTVPPNDFNFYEMLNE
FT                   IVQQEPATSLNPEQMGSVAAIGIIKDKSFSPDARMKQILTEAVSVANATSRSLFLNPRD
FT                   KNWYYYPGSAWMNFLFVTGYEFETPIPEITHAGVKPFPATGYRQLDARTAFFYYVTGIT
FT                   PAMAMRVTGIGSQYLLNMLDADKNYFDGSKTYRVTLPKEIPEENFWSFTVYDNQTRSML
FT                   DTPQRYPRAGSQSYPSPAAEAGSDSVTEIYFSPTQPAGVKRGNWIQTDPKKGWFTILRL
FT                   YSPLEPFFTKTWRPSEIELVP"
FT   sig_peptide     complement(289056..289130)
FT                   /locus_tag="Mext_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 25"
FT   gene            complement(289506..290237)
FT                   /locus_tag="Mext_0265"
FT   CDS_pept        complement(289506..290237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0265"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: atc:AGR_pAT_642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28689"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZD3"
FT                   /protein_id="ABY28689.1"
FT                   /translation="MARMMDKVALVIGGAKGIGLAVAERLAVEGASVVLTGRHADEVEA
FT                   AAARIGRGARGLVADAALREDLHRVVATVRKTHGRIDALVLNAGISEPATLRDGTPEHF
FT                   DRHFAVNVRGAVFGLQAALGAMERGGSVVLMGSIADAAGITPYGTYAATKAALRSYART
FT                   WTAELAPQGIRVNVVAPGPTDTAMMASVPEPGRAALIAPIPLGRMARPEEVAAATLFLL
FT                   SDEASFVAGAELCVDGGMRQV"
FT   gene            290320..290712
FT                   /locus_tag="Mext_0266"
FT   CDS_pept        290320..290712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0266"
FT                   /product="helix-turn-helix HxlR type"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   atc:AGR_pAT_641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28690"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZD4"
FT                   /protein_id="ABY28690.1"
FT                   /translation="MSDDTDLDAASEWALANMARVRPVLDKIADKWTILILTVLCPRPS
FT                   RFNAIKRRLDGITHKALADALKRLERNGLVTRTVLPTAPIGVEYAITPLGHSLRQPFEA
FT                   LCTWALDHGAAIEAANHEHDSIKTKP"
FT   gene            complement(290846..291325)
FT                   /locus_tag="Mext_0267"
FT   CDS_pept        complement(290846..291325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28691"
FT                   /db_xref="GOA:A9VZD5"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZD5"
FT                   /protein_id="ABY28691.1"
FT                   /translation="MDKWFEPIPLTARISLSALGGCLSGWLFFSFASINRRGLTLHLFY
FT                   DAFFGGLFFVPITLVLATPVLLVAVVVGAIFRRQIAQHTALWTIAASFVTWITAIAFMV
FT                   FTGSQNEWWMTHSIAERLAHTIASEDSKLILVGALGAAATFYLLGLVRLGPERAA"
FT   sig_peptide     complement(291227..291325)
FT                   /locus_tag="Mext_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.789 at
FT                   residue 33"
FT   gene            complement(291402..291947)
FT                   /locus_tag="Mext_0268"
FT   CDS_pept        complement(291402..291947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0268"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: mlo:mlr9024 resolvase / integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28692"
FT                   /db_xref="GOA:A9VZD6"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZD6"
FT                   /protein_id="ABY28692.1"
FT                   /translation="MARIGYARVSTLDQDLDVQLARLRAEGCGIVRSEKVSGGSREGRP
FT                   ELATVIEFLRPGDELVVTRLDRLGRDTRDVLNLIHEAEQWGAFVTVLDPHVSTRGEMGQ
FT                   IVLTVLGMVAQMERRFIKERQRDGIERAKAVGIYVGGKRRLDRERIRVLHAEGTGPAAI
FT                   ARTVGCSRMQVYRVLQEG"
FT   gene            complement(292075..292944)
FT                   /locus_tag="Mext_0269"
FT   CDS_pept        complement(292075..292944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0269"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: eba:ebA355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28693"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZD7"
FT                   /protein_id="ABY28693.1"
FT                   /translation="MATPFILVYKEHFEDCHDAEQHIHTLLERQGVRVAANREFFQGEV
FT                   SEIIKAIALAPGKSEPGTSVQFDDDDDLLSSAPDELDEFVLEGYKPKTPDQEVYEEAER
FT                   YYYGFGDTLQDYGEAFQLYKQAARLGSGDAYHMIGRMYMDGEGVRQDYGKALEYFKEAA
FT                   RREVFCAYGRMADIFRETSHPENENKAWKKYFEELGKNPNKKFESDHNPIIVQNFLFWR
FT                   TTRPSFMSAAKVKLSNEEEKYVGAMRPIKGQIVEFCQLGYERAVENFGETNDHSKMQKA
FT                   VMSWAASI"
FT   gene            294155..294985
FT                   /locus_tag="Mext_0270"
FT   CDS_pept        294155..294985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28694"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZD8"
FT                   /protein_id="ABY28694.1"
FT                   /translation="MMDTKGFPKAINDTQRDFLRLCELGGGARGGPPRGKVLEVLRASG
FT                   KSLNMLAHAEAQTHLAAYPDANPWHLCFAIGLSWGHLARLDVDFTGAVADVLANWNSGD
FT                   LAAAKSFHMERGPEPIEQSLRGAHNLFGRVILPKTLPSTLDRLDTAQQRWISPILTGSD
FT                   RPRYIGSWNATAMFMAALFAQPSLAALQTEPRPMLPPGGPIFKGLQMLHKAGLLKEPPS
FT                   GSELDDQAFEPGSLYENNKHLADLCAGLPGWSLIDVHSGVYMLGTRHPHSGKWV"
FT   gene            complement(294982..295788)
FT                   /locus_tag="Mext_0271"
FT   CDS_pept        complement(294982..295788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0271"
FT                   /product="putative restriction endonuclease"
FT                   /note="KEGG: pde:Pden_1523 putative restriction
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28695"
FT                   /db_xref="GOA:A9VZD9"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZD9"
FT                   /protein_id="ABY28695.1"
FT                   /translation="MSHATQSPLPMDDPPLTVWINLKQAAYRNGFGKGLDQAHVDQGWY
FT                   RLRSTTTPFQVHVAASGVNGPWLLAYTEPRIAADLLPGTAYLGPRPAQTGLMLNSLSDL
FT                   AAALLQIYHLVTEALKPSAYQEFLDQTQSLPDTTEAERVAIVRTAQGIFRRHLDTYWNQ
FT                   ACAITGMRDRELLRASHIKPWTASNDYERVDVYNGLLLSALWDAAFDQGLVSFSDDGHL
FT                   LVSMKLSDRAIAVLTDGRPVTVPISAGHAPYLNDHRLRHGFAALDS"
FT   gene            complement(295790..299758)
FT                   /locus_tag="Mext_0272"
FT   CDS_pept        complement(295790..299758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0272"
FT                   /product="putative type II DNA modification enzyme"
FT                   /note="KEGG: nar:Saro_0354 putative type II DNA
FT                   modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28696"
FT                   /db_xref="GOA:A9VZE0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZE0"
FT                   /protein_id="ABY28696.1"
FT                   /translation="MARQPRPAARTRRAKRTPAIAFDAITLEGGLIAPAMLTQIARIEA
FT                   DEQTPADYGVARGLILRDEIARAYRIAQAHYEDLTAHPEPSLAATQRFTEALLREVLEF
FT                   RDLVPVGRHDRDGDIYPVTFEGLGGRVPVVVVPPSDGIDRVSASLMAAGRRGSAASVVQ
FT                   DWLNAEDAALWGLACCGTRLRLLRDNPSLTRPAYIEADLDAIFTNEGRVDFAVLWLLLH
FT                   ATRFGKPADAVTDCTLERWRLAGLKEGEVARDRLRDGVEEALLALGTGFLGHPANAELR
FT                   KFVGSGVIPAQAYFEQCLHLVYRLIFLFVAEDRDLLHPKQTAAMKRQRYAQGYSVSALR
FT                   QASIRRSGYDAYSDRWEALKIVFEALAEGQDELGLPPLAGLFVSQHMDDLEQNALSNRD
FT                   LLKAIYRLAWLKTDDGVMPVNWRDMQTEELGSVYESLLELTPRISADGREMLFAEGLET
FT                   RGNARKTTGSYYTPDSLVQVLLDTTIDPVMDQAVAGAADPVRALLGLRVIDPACGSGHF
FT                   LLAAARRLAARVARARNDGVASAEQYRDAVRDVVRQCIHGVDRNPMAVDLTKVALWIES
FT                   IEPGKPLGFLDGNIVCGDALLGTFGYGEKLDAVLDAGIPEEAYKPLTGDDRDACRRFVL
FT                   AERDDRSGAMNLFDQKGWKPLEEHTAELISTFKAMAEDTPGQIKERQELWIKAMNDPGL
FT                   VAKKHAADLYLGAFLTKKGPDDDPFGGTLVPRTADIIHALHQGSVNTGMLSACQERTDA
FT                   ARVLHWGLTFGDVFDRGGFDVVIGNPPWERIKLQEQEFFASLDAEVAEARNAAVREALI
FT                   QKMKVAEDGSRKRAIYDAYETAKRASEATSAFMRLPDAKHGRFKLTGRGDVNTYALFAE
FT                   LFTQLAAKRGRAGIIVPTGIATDATTAPFFEWLVREKRLISLYDFENRERLFPAVDSRM
FT                   KFSLLTTGSNTIDARFAFFLTNVTQIADLGRSFSLSQADIIRINPNIRTAPVFRTEYDA
FT                   GLVSDIYSRVPVLIQDGLNTEGNPWNISVQTRLWHMAEDSHWFKSHNDLQSIDPDLRAG
FT                   FKPLYEAKMLNFFDHRFGSYDNRGDERGYRVLPPTTADLYADPNFEPSAYYLVPETEVE
FT                   ARLAFWNRDWLIAFKDVTAATNERTTIFSFLPRTAVGHSAPLLFTSHSPQLATALVANL
FT                   NSLIVDYCARTKIGGLHLTIGILKQLPILQPDDYEQADLEFISSRVLELSYTSHAMQPL
FT                   ARDLGYDGPPYRYDEDRRAKLRAELDAWFARAYGLNRDELLYILDPTNLTDAQCVSETF
FT                   RVLKNNEFRRFGEYRTQRLVLEAFDDLHGIAPARAAAE"
FT   gene            complement(299758..302517)
FT                   /locus_tag="Mext_0273"
FT   CDS_pept        complement(299758..302517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0273"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: pde:Pden_1526 helicase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28697"
FT                   /db_xref="GOA:A9VZE1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZE1"
FT                   /protein_id="ABY28697.1"
FT                   /translation="MTVQFSPGDLVRARGREWVTLPHDDPAALRLRPLSGTEADALTIL
FT                   PALERMPVEAAHFAPPEVDVRGTQESARLLAEALRLSLRRGAGPFRSSARVSFEPRAYQ
FT                   LVPLLMAMRLDVVRLLIADDVGIGKTVEAGLILRELLDRGEIERFCVLCPPHLVEQWVG
FT                   ELRAKFDIEAVAVTSASAPRLERKVVGTQSLFEVHPFTVVSLDYIKAEKRRESFAASCP
FT                   PCVVIDEAHACVGTHGSRQRRYRLLQRLAKDAARHMLLLTATPHSGDEEAFDRLLKLLD
FT                   ESFAMDGLDTNAGRIALARHFVQRRRKDILEQKWESDQIFPRHEKLDRPYSLGTEHGAF
FT                   HDAVLDYCLDRIEDAGDGTHRQRLTLWSTLALLRCVGSSPAAALNALRNRQDGDPERLS
FT                   MQVLDEEDEDTEAVDAEPSAYLGTDPALAKLIRQAEALVGKPDPKLAMMIKELKPLIAA
FT                   GANPVVFCRYIATAEYVAAALRKAFPSLAVESVTGLLVPDDRRDRVEGMAEEPQRLLVA
FT                   TDCLSEGINLQMLFDAVVHYDLSWNPTRHQQREGRVDRFGQPAPLVKSMLLFGSDSLID
FT                   SAVLSVILRKAERIRKDLGVIIALPEDRQVISGALLNAMLEHRGRPGAQRQFDLFAKEA
FT                   DALSASWRDAEEGEKRSRARYAQNALKPAEVMPEWESWRAIIGGPDRVERFVAHAMNHF
FT                   NTALEPTRGATFRADLAKLPPAITERLDASGVRGEVRISFEAKAPAGAVTVGRAHPIAA
FT                   TLAESLLETALDPKSETGFELARTGVWSTSAVEAMTTVVLVRLRHKLTVHGRSERMLLA
FT                   EEAVTLAFAGANATAIADGETAHQLIEAPANGDLAETARHRLIERARERVLSAWMPAID
FT                   AYATQRGEALEADHRRVRTAAQGTPRVTVEPILPADIVGLYVLTPGDL"
FT   gene            complement(302514..307778)
FT                   /locus_tag="Mext_0274"
FT   CDS_pept        complement(302514..307778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0274"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; Helicase superfamily 1 and 2
FT                   ATP-binding; SMART: DEAD-like helicases; KEGG: gox:GOX1503
FT                   probable ATP-dependent helicase Lhr"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28698"
FT                   /db_xref="GOA:A9VZE2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZE2"
FT                   /protein_id="ABY28698.1"
FT                   /translation="MDAFGLDQTLIRDYDAFARSFNKIAADDIRTEVDRLYDSKAFWPD
FT                   PLITINPHFARGETLDDLVKDDVLHPLTTHVFRERGRVLKPHLHQVEALTKAKAGKSFV
FT                   VTTGTGSGKSLCYFLPIIDEAIRERQKPDFKPRTRAIVVYPMNALANSQFEGLTEFLNQ
FT                   CGIPEAQRPRVRIYTGQESREKREEVRDNPPDILLTNFMMLELLLTRQSELDAQVIGNA
FT                   RGLRWIVLDELHTYRGRQGADVAVLVRRLRDQLCRGHSEPVCIGTSATMATPDQGNPIK
FT                   AVAKVASDLFGVSVETDCVIEETLQRATDEDLTVASVQGQLAACIQNPVPTNATDAELK
FT                   IHSLAVWIELRIGLEYKPQLKRRPPMTLVDAAKALSDETGCDAELCEQRLREMLGLLAR
FT                   PGAERGGTGSRAFLAFKLHRFISGAGLVYTTLRTAGPTGIRRVTLKGQTHHPDDKTALL
FT                   FSTHFCRDCGHEYHPVMRLDDEDGDRFVARSIDDPISERETDSGTAGYLVPEPATINEF
FT                   FQGALDEYPDEWVEHTPRGSRLKSTRRKQQVAAAVVLPNGRVDAAGRQAWFIPGRWRFC
FT                   LNCKLEAQPGTREQNKLAGLTAEGRSSATTLIVSSLLRFMHRPEAKIADDKRKVLGFSD
FT                   NRQDAALQAGHFNDFIFTTLLRAAVLSAVQAAGPDGLAEAEYGMAVQKALGFEDNNDDR
FT                   RRHWMRSPDAVGPSRARAITDLTRVLSHRVWSDQRRGWRYTNLNLENLQLIRAHYPGLE
FT                   SCADESLFKDAPLLRSLKPDARRRVFHALFEVMRGELAVESDFLKKATTESLGRSSRDN
FT                   LRTPWAISEQEAVSNAGLLIVPEGAGGKAQPNGRGPDSRLITAGPNSRVGKKLRHGHLW
FT                   GGRRLTVHEYNELLESVVRIAKVQNWVREVSEYGITGLRLLPSAIRLVADAPKADVNTY
FT                   FTRLYRETANILTSDDDSLLGFESREHTAQVDKDLRLWREARFRWGDAGKRNLDVLRAD
FT                   QTNSLEADTFLPVLFCSPTMELGVDISVLNAVYLRNAPPTPANYAQRSGRAGRSGQAAL
FT                   IVTYCAAQSPHDQYYFARREQLVAGSVRPPGIDLANRDLIEAHLNAIWLAKAGIDGRLR
FT                   QELPDAIPDILDLDTPKRTVRTEITDRLANPDRVVGVEDDFERILGNIRASIPPAVLND
FT                   PGSDWLKNSKPFVADVAKTAAQRFNNAFGRWRDLYNAAFAQMEEATNQIKKHGLTKQAR
FT                   DAAERALRIANSQIRLLEHGGKSDNSDFASHRYLATEGYLPGYNFPRLPLYAYVPEQGS
FT                   TGPRAAYLQRARFLAIAEFGPGSLIYHEGRAFKVVRAKIPPDVRDAQGMLAVSNLAVWR
FT                   VCRTCGAGHEGAGQNLCHACGAQIGGDGSKLIQKVLRIENVETVPSERITANEEARRGR
FT                   GFEIQTTFTWAKRNGQSDVLTAVAEDDDGTVLDLTYAPRAQISRLNLGLRKRKPEIGFG
FT                   YPIDPQNGQWVGADREQDDDDADPTEPDRPGAVRVVPIVQDHKNAALLKLFGPEAQETT
FT                   LATLQYAIARGLSLVFQVEEGEIATEAVPDRRKRKAILAYESSEGGAGVLRRLVSEKER
FT                   LAEVAHRALEVMHFTPDSIEDALITRDASKLQDLDDAFCVRGCYRCLLSYYNQMDHALI
FT                   DRTDEGARTTLVRLAAGVIRSTSVVCTAAPAAASTETWPQALGRWGLPPFDAKRLKFDT
FT                   DGILDVWRSHHVAIAYAPPPQDVVDELEDGGWTLVVLTGVPEQDPPSTLSSLFKVAA"
FT   gene            complement(308305..308394)
FT                   /locus_tag="Mext_R0004"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(308305..308394)
FT                   /locus_tag="Mext_R0004"
FT                   /product="tRNA-Ser"
FT   gene            308527..309840
FT                   /locus_tag="Mext_0275"
FT   CDS_pept        308527..309840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0275"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; KEGG: bra:BRADO4634 putative polynucleotide
FT                   enzyme with nucleotide triphosphate hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28699"
FT                   /db_xref="GOA:A9VZE3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZE3"
FT                   /protein_id="ABY28699.1"
FT                   /translation="MSDLFVSAGLETGAPRPLADRLRPRRLAEVVGQEHLTGPDGALTR
FT                   LLASRSLGSLVFWGPPGTGKTTVARLLAHETALHFEQISAIFSGIADLRKVFEAARKRR
FT                   ATGQGTLLFVDEIHRFNRAQLDAFLPVMEDGTVTLVGATTENPSFELNAALLSRARVLL
FT                   FRALDAPALARLLARAEEMDGQPLPLDEEARAALIRMADGDGRAALTLAEEVWRSARPG
FT                   EILDAETLQSLVQRRAPIYDKAQEGHYNLISALHKTVRGSDPDAALYYLCRMLDAGEDR
FT                   LFIARRLVRMAVEDIGLADPQALVVANAAKDAFDFLGSPEGELALAQVTVYLACAPKSN
FT                   AVYNAYKAATRVAKAAGSLAPPRTILNAPTGLMRRIGYGEGYRYDHDEPDAFSGQDYWP
FT                   EALGRQHFYEPTDRGMETRYRERLAYWERLRQERRGND"
FT   gene            309876..311369
FT                   /locus_tag="Mext_0276"
FT   CDS_pept        309876..311369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0276"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /note="PFAM: peptidase M32 carboxypeptidase Taq
FT                   metallopeptidase; KEGG: xau:Xaut_4189 carboxypeptidase Taq"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28700"
FT                   /db_xref="GOA:A9VZE4"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZE4"
FT                   /protein_id="ABY28700.1"
FT                   /translation="MQAYATLTATFARLGALEDASGILGWDTQTQMPDGASDTRGEQLA
FT                   VLSVLAHEILTDPRNAERFDAAEAEGHLGEWERANLREMRRAYAHAAAVPGDLVEAASK
FT                   AATRCEMVWREARRDSDFARLRPYLEEVLRLQRRVGEAKGAALGLAPYDALLDGYDPGM
FT                   RRARIDPIFAALRAVLPDLVVAARERQAADAPPLPLPGPFPVATQREIGLQLMRAVGFD
FT                   FARGRLDVSLHPFCGGATDDVRITTRYDEASATGALMGVLHETGHALYEQGRPAAWRHQ
FT                   PVGQARGMSLHESQSLLVEMQACRSAEFCAYLAPTLRAAFGGEGPAWEAENLHRLYTRV
FT                   EPGFIRVDADEVTYPAHILLRYRLETAMIAGDLTVADLPGAFNDGMKELLGFTVPDDRH
FT                   GCLQDIHWPGGSFGYFPTYTLGALAAAQLFKAACAAHPGIRPALAEGDFSQLRGWLREN
FT                   VHARASLMETDELLTAATGKPLGADDFLAHLRSRYLGTV"
FT   gene            311466..312779
FT                   /locus_tag="Mext_0277"
FT   CDS_pept        311466..312779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0277"
FT                   /product="molecular chaperone, HSP70 class"
FT                   /note="KEGG: rpe:RPE_0414 molecular chaperone, HSP70 class"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28701"
FT                   /db_xref="GOA:A9VZE5"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZE5"
FT                   /protein_id="ABY28701.1"
FT                   /translation="MHSAAGGRNGAALPSESKRSGHMTACGLDFGTSNTTLGIGMGARP
FT                   TLVPLEGTHRTLPSAIFFAPGQEAQIGRGAIEAYVEGTPGRLMRALKSVLGSPLIEETT
FT                   PVGRERIRFRDVIARYLTLVKARGEAEAGVELDTVVHGRPVHFVDNDPAADRKAEDTLR
FT                   QIAESIGFRHVRFQYEPIAAALDYERTVTSEEIALIADIGGGTSDFSIVRLSPERHRRD
FT                   ERAEDILANDGIRIGGTDFDRNLSLGAVMPLLGLGSPMKRADLAVPNAYFHDLATWSSI
FT                   NRLYNPKTLREIDEVVRDAARPELVTRLRTVVEAERGHSLAMAVEGAKIAASDAGAGTV
FT                   DLEWVESGLAADVDRARLAGHTDDLARRMAQRISRCLDQAGLTADRIDALFLTGGSTGL
FT                   PHVRAALTACVPGARVVDGDTFGSVGLGLTLEAARLAA"
FT   gene            313007..314413
FT                   /locus_tag="Mext_0278"
FT   CDS_pept        313007..314413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0278"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="KEGG: rpb:RPB_2335 pseudouridine synthase, RluD;
FT                   TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28702"
FT                   /db_xref="GOA:A9VZE6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZE6"
FT                   /protein_id="ABY28702.1"
FT                   /translation="MKGRPPHRGSGAKRGPSGFAPRAGTGPRTSAKDAAQRAARNRGED
FT                   AAERSPWDDGAASESAPRPNRVPEAAASKPDAPRARAKSPSDKPHAAKPSFAKPSFAKS
FT                   SLAKPDPAKAPPAEAPAGPTRREQRAAASATLASGVQTLTVDPDEAGMRIDRFLGARFP
FT                   QLPFTRVQSIVRKGELRVDGKRAKPNDRLEPGSSVRVPPLKLDQPTERPRSAAKIDGDA
FT                   EFLRSLILYEDADMMILNKPFGLAVQGGSGTVRHVDGLLEALTGPDGQRPRLVHRLDKD
FT                   TAGCLIVAKTRLAASTLAKSFRSRAARKIYWALVAGVPRTRQGRVSTYLVKDEPTDADA
FT                   RMRVAKHGDDGASHALTYYATVDQAAQKLAWLSLKPVTGRTHQLRAHAAHIGHPIVGDP
FT                   KYFDVENWELPGGIQNRLHLLARRIVIPHPRTGQPVDVSAPLPPHMAQSWNLLGFDAAR
FT                   YDPIVEAPEA"
FT   gene            314497..314919
FT                   /locus_tag="Mext_0279"
FT   CDS_pept        314497..314919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28703"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZE7"
FT                   /protein_id="ABY28703.1"
FT                   /translation="MDEDTARCFYRNRVQARKPVATVRIDGLRQRSSGLSKAFPCHEPV
FT                   QRGSGSHEARHPVVRRAGRPALGRCAGWCGAARRWGGGAAPRTIAGTVPKSAARTGPRP
FT                   APWCGPCPASGGTGGATAGSGHASLRAPTPHLLRRL"
FT   gene            315058..315759
FT                   /locus_tag="Mext_0280"
FT   CDS_pept        315058..315759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0280"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: xau:Xaut_4762 HAD-superfamily hydrolase, subfamily
FT                   IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28704"
FT                   /db_xref="GOA:A9VZE8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZE8"
FT                   /protein_id="ABY28704.1"
FT                   /translation="MLKLIVFDVDGTLIDSQHLIVEAQHRAFSEHGLAAPPRKEALSVV
FT                   GLSLPEAFRRLVGEAGPIESLAHSYRKAFQALRVDPDYEEPLFPGMAELVERLHRRDDI
FT                   QLGIATGKSRRGVNHLVDKYGWERWFATIQTADDAPSKPDPAMLLQAMAETGAEPSMTV
FT                   MIGDTTFDMMMARSASVAAIGVGWGYHTPGALFSAGAVTVVDSAATLSDLFSGPLDDSK
FT                   PGPVTERLATQ"
FT   gene            315820..316623
FT                   /locus_tag="Mext_0281"
FT   CDS_pept        315820..316623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0281"
FT                   /product="ATP12 ATPase"
FT                   /note="PFAM: ATP12 ATPase; KEGG: rpa:RPA3207 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28705"
FT                   /db_xref="GOA:A9VZE9"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZE9"
FT                   /protein_id="ABY28705.1"
FT                   /translation="MSTSGDDVTRDWLGEPGENGKPDRVQASRAGTGPTLPKRFYAQAG
FT                   LAEAEGGFRLVLDGRGANTPGRRPLVVPDRVLGEALAAEWEAQADVIDPRTMPLTRLVN
FT                   TTIDGVVERRAAVAEDLAAFAGTDLVAYRAGAPERLVAVQSEAWDPLVAWVAETLGARL
FT                   FLAEGVMHVEQPEGSVAALRAAIEAVDDPFRLAALHTLTTLTGSLVIALAVLHGRLSAD
FT                   DAWAAAHVDETYQASVWGRDAEAEARLAHRRTEFETAAMVAQRLS"
FT   gene            317218..318750
FT                   /locus_tag="Mext_0282"
FT   CDS_pept        317218..318750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0282"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: xau:Xaut_4725
FT                   carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28706"
FT                   /db_xref="GOA:A9VZF0"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZF0"
FT                   /protein_id="ABY28706.1"
FT                   /translation="MKDILEKLEERRAQARLGGGEKRLEAQHKRGKLTARERIELLLDH
FT                   GSFEEFDMFVQHRSTDFGMEKQKIPGDGVVTGWGTVNGRTVFLFSKDFTVFGGSLSEAH
FT                   AAKIVKVQDMALKMRAPIIGIFDAGGARIQEGVAALGGYGEVFRRNVAASGVIPQISVI
FT                   MGPCAGGDVYSPAMTDFIFMVRDTSYMFVTGPDVVKTVTNEVVTAEELGGAKVHTSKSS
FT                   IADGSFENDVEAILQIRRLLDFLPANNIEGVPEIESFDDVNRLDKSLDTLIPDNPNKPY
FT                   DMGELIRRVVDEGDFFEIQAAYARNIITGFGRVEGRTVGFVANQPLVLAGVLDSDASRK
FT                   AARFVRFCNAFSIPIVTFVDVPGFLPGTAQEYGGLIKHGAKLLFAYSQATVPLVTIITR
FT                   KAFGGAYDVMASKHVGADLNYAWPTAQIAVMGAKGAVEIIFRAEIGDADKIADRTKEYE
FT                   DRFLSPFVAAERGYIDEVIMPHSTRKRIARALGMLRTKEMEQPWKKHDNIPL"
FT   gene            complement(318812..319366)
FT                   /locus_tag="Mext_0283"
FT   CDS_pept        complement(318812..319366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28707"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZF1"
FT                   /protein_id="ABY28707.1"
FT                   /translation="MPILVIFTAVIVSVLIWLLRAHYTVKQLKEIDQDTKGLQRKAKSA
FT                   FENFVGTPLQRVNDVRLAAVILMIQIVRTGSPITASEKTRIFELMENPLEIQTISATFE
FT                   RAWRYTQERRPFSLVADPLLPLFREKLTGEERMQLVEMLTKVASAHSAPSELQREALAR
FT                   LKRRLIAGKPELATSRAGHFG"
FT   gene            complement(319505..319579)
FT                   /locus_tag="Mext_R0005"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(319505..319579)
FT                   /locus_tag="Mext_R0005"
FT                   /product="tRNA-Val"
FT   gene            319803..320450
FT                   /locus_tag="Mext_0284"
FT   CDS_pept        319803..320450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0284"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mlo:mll1406
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28708"
FT                   /db_xref="GOA:A9VZF2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZF2"
FT                   /protein_id="ABY28708.1"
FT                   /translation="MQPSPLISDELSAETPTPRQQAVLDAALALMVDGRDPLTMDAVAR
FT                   RASCSKETLYRWFGDRDGLLTATVRWQASRVHAGRYDVSGLDAVALRKNLLDFAESWLA
FT                   VIASPTSVALNRIAIADAGSRKSNLGGIVLANGRFAIGERVKPVLEAGRAAGLLAFEDS
FT                   EAAFRTFFGLVGRDIQIRLLLGDALDLDAAEIRSDAARAVEQFLALYGRAKP"
FT   gene            320484..321503
FT                   /locus_tag="Mext_0285"
FT   CDS_pept        320484..321503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0285"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: xau:Xaut_1490 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: acetohydroxy
FT                   acid isomeroreductase; CoA-binding domain protein;
FT                   Acetohydroxy acid isomeroreductase catalytic domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28709"
FT                   /db_xref="GOA:A9VZF3"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9VZF3"
FT                   /protein_id="ABY28709.1"
FT                   /translation="MRVYYDRDADLNLIKGKNVVIVGYGSQGHAHALNLRDSGVKDIVI
FT                   ALREGSATAKKAEHEGFKVMNVADAAKWGDVVMMLTPDELQGDIYKESLEPNMKQGAAL
FT                   LFAHGLNVHFNLIEPRKDLDVLMVAPKGPGHTVRGEYLKGGGVPTLIAIAQDASGNAHD
FT                   LGLSYASANGGGRAGIIETTFKEECETDLFGEQAVLCGGLVELIKAGFETLVEAGYAPE
FT                   MAYFECLHEVKLIVDLIYEGGIANMNYSISNTAEYGEYVTGPRIVTPETKAEMKRVLND
FT                   IQSGIFTRNWMLENKVGQTSFKATRAKLAAHPIEEVGAKLRGMMPWISEKALVDKTKN"
FT   gene            321671..322324
FT                   /locus_tag="Mext_0286"
FT   CDS_pept        321671..322324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0286"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: mpt:Mpe_A3061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28710"
FT                   /db_xref="GOA:A9VZF4"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZF4"
FT                   /protein_id="ABY28710.1"
FT                   /translation="MASLYSEAHRALQEEFGTTKLAVRLDEDWVHETIQPDEAAFIASR
FT                   DMFFLSTVDPDGMPTVSYKGGPTGFVKVVDGSTLVFPGFDGNGMFYSMGNIAGQAKIGL
FT                   LFIDFETPHRIRVQGHASLLRDDPLMAEYTEAKYLVRVDVTKIWINCPRYIHKYKKLEQ
FT                   NKYVPRPDRETPLAAWKRLDLAGDVISDEDKARVAREGRLEVPEYEALVARGEA"
FT   gene            322436..323260
FT                   /locus_tag="Mext_0287"
FT   CDS_pept        322436..323260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syw:SYNW2410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28711"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZF5"
FT                   /protein_id="ABY28711.1"
FT                   /translation="MTFLKRTLHNHPQIKRALKSVAKSAGLFRNSPANDFYRDLAEVKT
FT                   RGDDAFSKLFYGYDGDHLINKWNHFLPIYSRLFAPFRDGRPDGRPLRFLEIGVYEGGSL
FT                   DLWRRFFGPSAILYGIDVDPRCAVFDGRAAQVRIGSQADPPFLRSVVEEMGGVDVVLDD
FT                   GSHVASHQRVTFETLFPLLAPDGLYVAEDLHTAYWRDYEGGYRRKGTFLEMTKGFIDDM
FT                   HAWYHDRGAQEIGRSIGAIHVFDSIVAFEKGGGERPFHTTIGTPQRAIDRVR"
FT   gene            complement(323333..324631)
FT                   /locus_tag="Mext_0288"
FT   CDS_pept        complement(323333..324631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0288"
FT                   /product="crotonyl-CoA reductase"
FT                   /note="TIGRFAM: crotonyl-CoA reductase; PFAM: Alcohol
FT                   dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: xau:Xaut_1195
FT                   crotonyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28712"
FT                   /db_xref="GOA:A9VZF6"
FT                   /db_xref="InterPro:IPR010085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZF6"
FT                   /protein_id="ABY28712.1"
FT                   /translation="MAASAAPAWTGQTAEAKDLYELGEIPPLGHVPAKMYAWAIRRERH
FT                   GPPEQSHQLEVLPVWEIGDDEVLVYVMAAGVNYNGVWAGLGEPISPFDVHKGEYHIAGS
FT                   DASGIVWKVGAKVKRWKVGDEVIVHCNQDDGDDEECNGGDPMFSPTQRIWGYETGDGSF
FT                   AQFCRVQSRQLMARPKHLTWEEAACYTLTLATAYRMLFGHAPHTVRPGQNVLIWGASGG
FT                   LGVFGVQLCAASGANAIAVISDESKRDYVMSLGAKGVINRKAFDCWGQLPTVNSPEYNT
FT                   WLKEARKFGKAIWDITGKGNDVDIVFEHPGEATFPVSTLVAKRGGMIVFCAGTTGFNIT
FT                   FDARYVWMRQKRIQGSHFAHLKQASAANQFVMDRRVDPCMSEVFPWDKIPAAHTKMWKN
FT                   QHPPGNMAVLVNSTRAGLRTVEDVIEAGPLKAM"
FT   gene            complement(324812..326284)
FT                   /locus_tag="Mext_0289"
FT   CDS_pept        complement(324812..326284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0289"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; KEGG: rba:RB4376
FT                   catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28713"
FT                   /db_xref="GOA:A9VZF7"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZF7"
FT                   /protein_id="ABY28713.1"
FT                   /translation="MADQGPRLTTAFGNPVSDNQNSLTAGSRGPVLMQDYHLIEKMAHF
FT                   NRERIPERVVHAKGYGAYGTFRLTKSLAEYTRAKVLTEVGKDVPMVARFSTVGGESGSA
FT                   DTARDPRGFALKFYTEEGNWDLVGNNTPIFFVRDAIKFSDFIRTQKRDPRTHLKPHWRR
FT                   WDFWSLSPEAIHQVMFLYSDRGTPKSARFMNGYGSHTFSLWNDRGERHWVKFHFHTKQG
FT                   IQNFSADEADEVAGKDPDYSSADLSTAIEQGDFPKWKVSVQLMPELDADTYRINPFDLT
FT                   KVWPHGDYPLIEIGEMELNRNPENYFAEIEQSAFEPSNVVPGISFSPDKMLQNRVLSYA
FT                   DAHRYRLGVNYQQIPVNQAKNADVQTYHRDGAMRTDGNHGAQVDYEPNSFGGPKQDPSF
FT                   SEPPLRIQGDAGRYGWPGDDEDLYGQPKLFWTKVLDEGGRKRLVENIVTSMGDSPRHIQ
FT                   ERMIAHWFKVHEDFGRGVAEGLGIDAAQAAAE"
FT   gene            326651..328717
FT                   /locus_tag="Mext_0290"
FT   CDS_pept        326651..328717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0290"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: xau:Xaut_1197 methylmalonyl-CoA mutase, large
FT                   subunit; TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; cobalamin B12-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28714"
FT                   /db_xref="GOA:A9VZF8"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZF8"
FT                   /protein_id="ABY28714.1"
FT                   /translation="MSAQASVAEVKRDKPWIIRTYAGHSTAAESNKLYRGNLAKGQTGL
FT                   SVAFDLPTQTGYDPDHELARGEVGKVGVSIAHLGDMRALFDQIPLAQMNTSMTINATAP
FT                   WLLSLYLAVAEEQGAPLAALQGTTQNDIIKEYLSRGTYVFPPAPSLRLTKDVILFTTKN
FT                   VPKWNPMNVCSYHLQEAGATPVQELSYALAIAIAVLDTVRDDPDFDEASFSDVFSRISF
FT                   FVNAGMRFITEICKMRAFAELWDEIAQERYGITDAKKRIFRYGVQVNSLGLTEQQPENN
FT                   VHRILIEMLAVTLSKRARARAVQLPAWNEALGLPRPWDQQWSMRMQQILAFETDLLEYD
FT                   DIFDGSTVIEARVEALKEQTRAELTRIAEIGGAVTAVEAGELKRALVESNARRISAIEK
FT                   GEQIVVGVNKWQQGEPSPLTAGDGAIFTVSETVEMEAEARIREWRSKRDDRAVGQALAD
FT                   LEQAARSGANIMPPSIAAAKAGVTTGEWGQRLREVFGEYRAPTGVTLQTVTSGAAEDAR
FT                   LLIADLGERLGETPRLVVGKPGLDGHSNGAEQIALRARDVGFDVTYDGIRQTPTEIVAK
FT                   AKERGAHVIGLSVLSGSHVPLVREVKAKLREAGLDHVPVVVGGIISTEDELVLKNMGVT
FT                   AVYTPKDYELDKIMVGLAKVVERALDKRAADRADTEAGVPGAPKRNESGAQVF"
FT   gene            complement(328827..329513)
FT                   /locus_tag="Mext_0291"
FT   CDS_pept        complement(328827..329513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfa:Mfla_1093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28715"
FT                   /db_xref="InterPro:IPR019619"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZF9"
FT                   /protein_id="ABY28715.1"
FT                   /translation="MIRHTRLLLAALCLIATGAQASAEPVQDGQLWINTTLFGSVGDVA
FT                   YFAEVQPRIGNGISQLDQIILRPAVGWKVNDALVLYQGYAYVEDHGMRNNVRIEDRSFQ
FT                   EINWKIGEFSGVKVSSRTRFEQRWQSAGRDVGFRLRENLRFAVPLPKDWGGVSAVGWTE
FT                   LFVALNDTDWGTRAGFDRVRAFIGLELPIGGKSTVEIGYLNQTARTQASGIELDHILSL
FT                   NLFVRY"
FT   sig_peptide     complement(329448..329513)
FT                   /locus_tag="Mext_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.500 at
FT                   residue 22"
FT   gene            complement(329810..330598)
FT                   /locus_tag="Mext_0292"
FT   CDS_pept        complement(329810..330598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0292"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; Male
FT                   sterility domain; KR domain protein; KEGG: rle:RL1193
FT                   putative short-chain reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28716"
FT                   /db_xref="GOA:A9VZG0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZG0"
FT                   /protein_id="ABY28716.1"
FT                   /translation="MTVPAPAHVKGLAQMSKLEGKVAVVTGASKGIGAAIAKALAKDGA
FT                   AVVVNYASSKAGADAVVDAITAAGGKAVAVQADVSQAAQARGLVETAVQQFGRLDVLVN
FT                   NSGVYEFAAIEEVTEEHYRRIFDVNVLGVLLATQAASKHLGEGGSIINISSVVTDVLMP
FT                   TSAVYSGTKGALNAISGVLANELAPRKIRVNVVSPGYVVTEGTHTAGIAGSEMEAGLVA
FT                   QTPLGRSGQPDDIAGVVAFLASDDARWVTGEVINASGGVR"
FT   gene            330665..330994
FT                   /locus_tag="Mext_0293"
FT   CDS_pept        330665..330994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0293"
FT                   /product="regulatory protein ArsR"
FT                   /note="SMART: regulatory protein ArsR; KEGG:
FT                   ret:RHE_CH01046 probable transcriptional regulator protein,
FT                   ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28717"
FT                   /db_xref="GOA:A9VZG1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZG1"
FT                   /protein_id="ABY28717.1"
FT                   /translation="MRPLFHPAIEDVQPEAILHALSDPRRAAIFARITKAGCVEACSAL
FT                   SSVGDQVIPKSSLSSHFKVLREAGLIRCERHGVEMRNHSRCAEVETRFPGLLSAIMNAY
FT                   AARAS"
FT   gene            331146..332207
FT                   /locus_tag="Mext_0294"
FT   CDS_pept        331146..332207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0294"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: nha:Nham_0012 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28718"
FT                   /db_xref="GOA:A9VZG2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZG2"
FT                   /protein_id="ABY28718.1"
FT                   /translation="MAAFTELVFSGVQPTGNLHLGNYLGAIKRFVEMQARDAQCLYCVV
FT                   DLHAITMWQDPEALKGQIREVTAAFLAAGIDPKRSIVFNQSQVPQHAELAWIFNCVARL
FT                   GWLNRMTQFKDKAGKDRENASIGLYDYPVLMAADILAYRATHVPVGEDQKQHLELTRDI
FT                   AQKFNNDFAGSILAHGHGEQFFPITEPLIGGPAARVMSLRDGTKKMSKSDPSEYSRIAL
FT                   TDDADAIAQKVRKAKTDPEPLPSEVAGLAGRPEADNLVGIFAALRGITRDEVLADFGGA
FT                   QFSSFKPALVDLAVETLAPIGAEMKRLVADPAYIDSVLGDGASRAEAIAAPTLDAVKDI
FT                   VGFVRRGPALRAV"
FT   gene            complement(332221..332394)
FT                   /locus_tag="Mext_0295"
FT   CDS_pept        complement(332221..332394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28719"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZG3"
FT                   /protein_id="ABY28719.1"
FT                   /translation="MADTSDTFKKAPKRKPAKGKSVSVSPEMRQAYADLIKEREEKEQA
FT                   YGRHLRKDEPRR"
FT   gene            332554..333159
FT                   /locus_tag="Mext_0296"
FT   CDS_pept        332554..333159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0296"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: bbt:BBta_0351 3-isopropylmalate dehydratase
FT                   small subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   small subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28720"
FT                   /db_xref="GOA:A9VZG4"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9VZG4"
FT                   /protein_id="ABY28720.1"
FT                   /translation="MEKFTTLEGVAAPMRIINIDTDRIIPKQYLKTIKRTGLGQGLFSE
FT                   MRYNDDGSENPDFVLNQPAYRHAKTLVVGDNFGCGSSREHAPWALADFGIRCVISTSFA
FT                   DIFFNNCAKNGILAIVVSPEDLEKLFQDAERGANATLTIDLAAQTIKGPDGGTLHFDID
FT                   EGRKHNLLNGLDEIGLTLDQKAPAIDAYEAKLAQREWA"
FT   gene            complement(333167..333784)
FT                   /locus_tag="Mext_0297"
FT   CDS_pept        complement(333167..333784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0297"
FT                   /product="peptidase C15 pyroglutamyl peptidase I"
FT                   /note="PFAM: peptidase C15 pyroglutamyl peptidase I; KEGG:
FT                   rpc:RPC_1753 peptidase C15, pyroglutamyl peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28721"
FT                   /db_xref="GOA:A9VZG5"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZG5"
FT                   /protein_id="ABY28721.1"
FT                   /translation="MSRLLITGFGPFPTVPDNPSARLARRVAASPHLRRLLGHAPDCLV
FT                   LETRYGALDTQLAPALARRPRAVLMIGVAARRSRVCVETRAVNRVSRLFPDASGAVGRF
FT                   LAFEPDGPAQRRSRAAAQVRVALKRVGLDAAASRDAGRYLCNASYYRVLPTGCPAVFVH
FT                   IPMPPRTRRPKAGGGRRPALDRWTEALIEAARVLALRGRAQP"
FT   gene            complement(333781..334821)
FT                   /locus_tag="Mext_0298"
FT   CDS_pept        complement(333781..334821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0298"
FT                   /product="LAO/AO transport system ATPase"
FT                   /note="TIGRFAM: LAO/AO transport system ATPase; PFAM: ArgK
FT                   protein; KEGG: rpd:RPD_1922 LAO/AO transport system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28722"
FT                   /db_xref="GOA:A9VZG6"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZG6"
FT                   /protein_id="ABY28722.1"
FT                   /translation="MGFWALDARAAPRHEGAMSATLPDMDTLRERLLAGDRAALARAIT
FT                   LAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVA
FT                   VLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAA
FT                   GFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGILELADMIAVNKADD
FT                   GDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRAKLTA
FT                   TGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAI
FT                   ATLIGL"
FT   gene            334917..335951
FT                   /locus_tag="Mext_0299"
FT   CDS_pept        334917..335951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0299"
FT                   /product="protein of unknown function DUF900 hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF900 hydrolase
FT                   family protein; KEGG: bja:blr7980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28723"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZG7"
FT                   /protein_id="ABY28723.1"
FT                   /translation="MQPSDATRRSLLRLMGLAGVAGLSPALSGCVMDGLATGAVGETQS
FT                   ALDVSPVLLIATTRRPAAGNPPKAPFFGSERGRGLSFAEARMTAPDRSLIGKVSAVVGG
FT                   DWGVRSVGDVTTGSGAAAAFAQSAFGRDVLIYVHGYRESFESAAISAARLSDGIRFNGA
FT                   SALFTWPSAAATFDYGYDRESALWSRDAFEDLLKTVATTPSGGRIHIVAHSMGTLLTLE
FT                   TLRMLRAEAGEAAVARIGAVVLAAPDIDIDLFTNGVERLGPDAKRITVISATNDRALEL
FT                   SGAIAGGVVRAGAADRERLEALGVRVADASDYGGGLFNHDLFLSNREVQAVVKRAVSRG
FT                   SSGT"
FT   sig_peptide     334917..335006
FT                   /locus_tag="Mext_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.642 at
FT                   residue 30"
FT   gene            336137..336484
FT                   /locus_tag="Mext_0300"
FT   CDS_pept        336137..336484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:RL4008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28724"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZG8"
FT                   /protein_id="ABY28724.1"
FT                   /translation="MFTLEIDGKAIAVINGDEATARDLFTCDGFKEDIRTMTIDGQPIW
FT                   NGTSDLIVRKANEDEIEEFEDALASDDGEGDFEPDAQHEAEGDGSDDEDEADIVFLVDI
FT                   DDEDEDQTLDA"
FT   gene            complement(336562..338442)
FT                   /locus_tag="Mext_0301"
FT   CDS_pept        complement(336562..338442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0301"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S15; peptidase S9 prolyl
FT                   oligopeptidase active site domain protein; KEGG:
FT                   acr:Acry_0766 peptidase S9, prolyl oligopeptidase active
FT                   site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28725"
FT                   /db_xref="GOA:A9VZG9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZG9"
FT                   /protein_id="ABY28725.1"
FT                   /translation="MVDLIPRAHLFGNPTRYGHQISPDGRRLGWVAPHEGVLNIWSAPI
FT                   DDLDAAVPVTTDRRRGIDAYAFAYDGRHLLYVQDADGDENHHLYAVDLTTGERRDLTPI
FT                   PGIAAAIVGLSRIVRDRVLVAINDRDPRFHDLHSIDLATGERSLVIENPGFAGFLIDER
FT                   YAVRFAFRNLPDGSSQLIAPDGANWKPWLTFPPEDARVSGAENLDAAGTALFCRDSRGR
FT                   NTAALTRIDLATGETRVLAAHEEADIGAVLQDAETHEPVAYSVTHARKSWHVLDPRLTD
FT                   DFAFLETQGLGDWYPASRTEDDALWIVVARADTRVGEAAIYDRRAKTLRSLGSARPELE
FT                   GAPLAPMSPAIIRSRDGLDLVSYLSRPLDAQAPGPLVLLVHGGPWARDSFGFDGLHQWL
FT                   ANRGYAALSVNFRSSTGFGKAFLNAGDREWGRRMDDDLSDAVAWAVAQGVADPARVAIM
FT                   GGSYGGYATLMALTRNPGSYACGIDLVGPANLETLVRTIPPYWEAMRAQLHRAIGDPDT
FT                   EEGMALIRERSPVYFADRIKAPLLIVQGANDPRVKQAESDQMVAAMERGGIPVTYLLFP
FT                   DEGHGLVRPANRLAFFARAEEFLARHLGGRCEPIREDESAGTSMQVVREG"
FT   gene            complement(338511..339428)
FT                   /locus_tag="Mext_0302"
FT   CDS_pept        complement(338511..339428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0302"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mlo:mll7632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28726"
FT                   /db_xref="GOA:A9VZH0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZH0"
FT                   /protein_id="ABY28726.1"
FT                   /translation="MSVQNRRKLLLGAMTSLGLASLPARVLAQSFEGFDDDRLYQDSAG
FT                   QLYRRRGGQYVPYNGRVSNGRPVPDSQTDLDTEAYARRRAERYGEPPAAEAPNQTPRQQ
FT                   QAGYPVPPQEPDNGPIDYTRAYAAIANEPFPVQAIPYKKFDPVFLRQEVDFRTNEAPGT
FT                   IVVDPKAHFLYLVLPNGRARRYGVGVGKQGFSWSGSATVNSKQAWPDWYPPKEMIARRP
FT                   DLAREVDKLQSGLGVPGGSRNPLGARAMYLWQNNKDTLFRIHGTLEPHSIGKSVSSGCI
FT                   RMINQDAIDLFNRVEVGAKVVVLG"
FT   sig_peptide     complement(339342..339428)
FT                   /locus_tag="Mext_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 29"
FT   gene            339770..340024
FT                   /locus_tag="Mext_0303"
FT   CDS_pept        339770..340024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28727"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZH1"
FT                   /protein_id="ABY28727.1"
FT                   /translation="MRASLLRSSLGLLCLGLMLPGEALAARKAAPPRPARTAVAQAAPQ
FT                   PLGPQTAWTAAESPNCNRVRRKLWQADEGWIVKTVTVCH"
FT   sig_peptide     339770..339847
FT                   /locus_tag="Mext_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.946 at
FT                   residue 26"
FT   gene            340156..341403
FT                   /locus_tag="Mext_0304"
FT   CDS_pept        340156..341403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0304"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="TIGRFAM: nuclease SbcCD, D subunit; PFAM:
FT                   metallophosphoesterase; KEGG: bja:bll1921 exonuclease
FT                   subunit SbcD homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28728"
FT                   /db_xref="GOA:A9VZH2"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZH2"
FT                   /protein_id="ABY28728.1"
FT                   /translation="MIRVLHTGDWHIGQTLRGFSREREHDAVFGCLESIVVEREVDALV
FT                   VAGDVFDSQNPSGESQARFYTLMARLHAARPAMTIVITAGNHDAAGRLEAPRPLLEAIG
FT                   VHVVGNVRRRDGAIDLDRHLVPVRSANGEVAAQVLAVSYPTAACLPPLSSLGQQPRIGE
FT                   TSPIVRAVRDLYGQLFEAARPRLAGLPLLVTGHLHVAGGLESEGAERRILVGGEHAVPS
FT                   DVFPEEARYVALGHLHRAQVLGRGQVRYCGSLIPLSAAEQPYRHGVTLVTLGTGAAEIE
FT                   HIEIPRPVPFLRLPASGDMPLADLGDHLNALALDPDLPMEARPYIQVRLAREGLLPGYR
FT                   AEVDRIAESFPVRVVDVRVTVPPRTAIAIEESEAPPPRLSERDPEELFRLAYHAKWDED
FT                   PEPAHLDVFHRARAEA"
FT   gene            341415..345161
FT                   /locus_tag="Mext_0305"
FT   CDS_pept        341415..345161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0305"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: ade:Adeh_0433
FT                   exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28729"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZH3"
FT                   /protein_id="ABY28729.1"
FT                   /translation="MRILAIRGENLASLAAPFAVDLAAEPLGATGLFAITGETGAGKST
FT                   ILDALCLALYGRYPRVAVSRREDVPDPGGEALSASDGRAILRRGAGSGYAEVDFIGQDG
FT                   VAYRVGWEAFRARNRATGKLQAERRRLHRLDDGSAVAAGKTQVLDRVVALTDLTFDQFR
FT                   RTVLLAQGEFDAFLLAAEGERAELLEKITGTAIYSEISKRVHLGFEEHRRAVEALELRR
FT                   GEIGLLDAEGLSSRNAESEALRAGVEAWRGEQAAVGRILETARRIEAARTALAEAERRA
FT                   VSAGESLDAAGPDRARLAELDAVEPLRGRAEALGETARERGEAQARVEATSARVRDAHA
FT                   AAATAEAKRAEANAGDEAAEAVFKSFGPLWDRAAALDATIAIAEQEAAAAAQAALRSNE
FT                   AAAAADAALTAIDRRLDEARAARDAAARQLEADRSHAPLAERGDDVARRIRERARLQEQ
FT                   AEAAGKESAARRAEIAGCDGEAEAGTARLTAFRARRETLAGARAEREAALAALAEPAAQ
FT                   ARSAALEGLLDALREAYALAGRHGTALADRAAATEAEAEAGLVATEAAARYGAEDQALH
FT                   EAGIRRAEIAPLAELAEESVSREAARLRSLLVAGGPCPVCGSSDHPHAHESDGALGRLA
FT                   EEMRARRAELDVRIGEHQAARDRARGDFAAAEGRRDDAQERAAAAAEAAAATAARYRAT
FT                   LPGLLASLEAAGLAAVLPPGPDAPALAAAGTTARAERDATLHVLATARTLRSEIDGLIR
FT                   ERDAAEARAEAEARALDALTRRRTEAGLAAERSESTRAALMQRVAELADEIAPALSAAD
FT                   LSLADLDRAPEMCADRVSRLGQAYAALRTRLAGLEAQLGALAPERAAAASSREAETRAA
FT                   VKARAEAEERQTRLNQARAERAGLLGGLQTGTHRTRLNNERRAAREALQAAQTACAEAA
FT                   RALTGAVTDEAAAIAALERAAARHSSAEDAFAQACGERGREAVAALLAVPIETRDALRA
FT                   GLDRLAREAAETRTALATRRADVEALDTEAGIDVAAAEAETTRLADAMAQAQQRLGALD
FT                   AELRRDEAARAKAADLAGEIEAATAELTTWHRVEEAIGSAGGDRFRRFAQGVTLDHLVH
FT                   LANEQLRALSPRYRLARSVGADLALHVVDRDMGDERRATRSLSGGERFLVSLALALALS
FT                   GLEGRQSFVDTLFIDEGFGSLDAETLDLAVDALETLQGRGRKVGVITHVAGMMERIAVQ
FT                   IRVEKRGSGRSVVRVVDRGAAIV"
FT   gene            345364..346683
FT                   /locus_tag="Mext_0306"
FT   CDS_pept        345364..346683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0306"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_3273 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28730"
FT                   /db_xref="GOA:A9VZH4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZH4"
FT                   /protein_id="ABY28730.1"
FT                   /translation="MRDRARLKASGASSSPTSTPMASFKTVMKSGHPPTLFAAFLYFDF
FT                   CFAIWVLNGAMGPFITETYGLTPAQTGFMISLPILAGAIMRFPLGILAQYIGRKNAALT
FT                   EMGVIVLAMAYGFFFISSYNDVLAMGVLLGIAGASFGVALSLGSGWFPPEHKGLAMGIA
FT                   GAGNSGTVLAVLFAPPLAQAYGWQAVYGFAGLVMIIPFLVMIFLAKEPPDCHGQTFKEH
FT                   VSCLFTKDGWSFSLIYIITFGGFIGLSNFLPTFFYEQFAVTKVEAGRLTMLAALMGSGI
FT                   RILGGYFADRMGGILVLSLVLLAAIGSFLALTATPSLAVTTLLFMLCFAALGAGNGALF
FT                   QLVPLRWPTNTAVAGSMIGEVGALGGAILPNVMGFSKQYTGGFATGFVAYALFTGLVLG
FT                   CLFLWQRKWVGAWVGPRGKVLDQPAEAQVQAGGRMEPANA"
FT   gene            complement(346765..347532)
FT                   /locus_tag="Mext_0307"
FT   CDS_pept        complement(346765..347532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0307"
FT                   /product="competence protein F"
FT                   /note="KEGG: bme:BMEI0183 competence protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28731"
FT                   /db_xref="GOA:A9VZH5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZH5"
FT                   /protein_id="ABY28731.1"
FT                   /translation="MAAPGLPALSGGIRRFASTLIGLIYPPTCVSCGAATGQPHALCAA
FT                   CWSGLRLIERPYCERLGTPFALDLGVGRLLSPGAIAEPPAFCRARAVAVYEGTARDLVH
FT                   RLKYNDRLDLARTMARMMASAGRELLDEAELILPVPLHGLRLWRRRFNQSALLAREIAQ
FT                   VSGTPCDLRALARVKATRPQVGLTRHQRAMNLQGAFRVPDDARSRIAGRRLLLIDDVAT
FT                   TGATGNAAARVLLRGGAASVDLLTFATVTRDGL"
FT   gene            complement(347562..347789)
FT                   /locus_tag="Mext_0308"
FT   CDS_pept        complement(347562..347789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll8048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28732"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZH6"
FT                   /protein_id="ABY28732.1"
FT                   /translation="MTRILIRAALILAAVALASTAEAKGCLKGAAVGGVAGHMAGHGVM
FT                   GAAAGCAIGRHQANKRDKAAQQGGQGNSAR"
FT   sig_peptide     complement(347718..347789)
FT                   /locus_tag="Mext_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.830 at
FT                   residue 24"
FT   gene            347993..348886
FT                   /locus_tag="Mext_0309"
FT   CDS_pept        347993..348886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0309"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: xau:Xaut_3105
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28733"
FT                   /db_xref="GOA:A9VZH7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZH7"
FT                   /protein_id="ABY28733.1"
FT                   /translation="MNESAPLFDPALVRRRIARARRSGYAGFLLERVAEDLEDRLAAVT
FT                   RSFPLGLDLGTPLPLVSERLLQTGRVERMIRLAPVSEPGGSVVGDPEVLPFGGHAGFDL
FT                   AVSALALQHVNDLPGALLQVRRALKPDGLFLAGLLGGATLTELRQAFLQAESETEGGAS
FT                   PRVAPFAELRDLGGLLQRAGFALPVVDADTITVRYGDPFSLMRDLRAMGLTNALHDRRR
FT                   APLRRATLMRAAAIYAERFSDPDGRLRATFEILWLSGWAPHESQQKPLRPGSAKARLAD
FT                   ALGAAEHRIPIREELA"
FT   gene            348883..349239
FT                   /locus_tag="Mext_0310"
FT   CDS_pept        348883..349239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0310"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   bur:Bcep18194_B2068 protein of unknown function DUF427"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28734"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZH8"
FT                   /protein_id="ABY28734.1"
FT                   /translation="MKEPGPAHPITITPHPTPVRVRLSGRIVAETRRALKLSEAGYGPV
FT                   LYLPREDVAADALTPNPKRSFCPYKGEAFYFDLTVGGATREAAVWSYENPFPAVARIRG
FT                   HVAFYPDRIDAIEA"
FT   gene            complement(349248..350789)
FT                   /locus_tag="Mext_0311"
FT   CDS_pept        complement(349248..350789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pde:Pden_3092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28735"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZH9"
FT                   /protein_id="ABY28735.1"
FT                   /translation="MARRAKAAVETAAEAPTPAAATPRKSRSTTPTAENLAALSQERLI
FT                   ALILQEVGQSAPFKKRVSAAIAALQGPDRVAALIDRRLSALEKARGYIDWQKRRAFVAD
FT                   LDATLATIISDLKPLDAGMALDRLLRFLRGASATLERVDDSSGQVHGLYEAAAEAAAGL
FT                   AAGLSADAALSFATRALDGLDDDGFGLVGALLVDLLPKLPKAALEPLDAHLVEALAKLP
FT                   ASAGKKTGPAASERAGQEWERRYQRLSLTRLRQVIADARGDADAFIALELEMSPERPDL
FT                   TAVAERLLAAGRAEEALDWIRRKQKRGMAVVTREDLIVGGFDPEGPEREREAVEIRILD
FT                   ALGHKGEAQALRWSRFEKSLDPQALRDYLARLPDFEDEEALERAFAHAASRKDPHGGLY
FT                   FLIRWPNLDRAARLVLDRREAWSGRIWELLAPAAEALEPDHPLAASVLYRALIDDILER
FT                   GRSPAYGHGARHLTRLGELARELAPGDLKPSHAEYVAQLRKAHGRKSGFWSQVEG"
FT   gene            complement(350821..351237)
FT                   /locus_tag="Mext_0312"
FT   CDS_pept        complement(350821..351237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0312"
FT                   /product="mutator MutT protein"
FT                   /note="TIGRFAM: mutator MutT protein; PFAM: NUDIX
FT                   hydrolase; KEGG: xau:Xaut_2586 NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28736"
FT                   /db_xref="GOA:A9VZI0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZI0"
FT                   /protein_id="ABY28736.1"
FT                   /translation="MSTPLKLLLVVAAALVDADGRVLMAQRPEGKALAGLWEFPGGKVE
FT                   PGERPEETLIRELAEELGITVKEPCLAPLTFASHAYPDFHLLMPLYICRRWEGLPQSRE
FT                   AQALRWVRPGGLRDLPMPPADLPLIPFLIDLLGP"
FT   sig_peptide     complement(351181..351237)
FT                   /locus_tag="Mext_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.740) with cleavage site probability 0.655 at
FT                   residue 19"
FT   gene            complement(351234..351956)
FT                   /locus_tag="Mext_0313"
FT   CDS_pept        complement(351234..351956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0313"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   mes:Meso_2073 protein of unknown function DUF541"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28737"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZI1"
FT                   /protein_id="ABY28737.1"
FT                   /translation="MRFFSALAVPVLLLTVAAPAMADDETGRIRVIGRASQEVAPDFAS
FT                   VEIGVETGGATPAAALDAASQAAKGIVASAKEMGVAEADIGTSSISLQPRTKTVRQPDG
FT                   TMGERDDGYTAGNRVRVRLAEMGKLGELMRRTLESGANRIQGISFGLRDPAAAEAAVQV
FT                   AAVKDARAQAERIAEATGVKLGTVVSIESPPRAESPRPMPYGMAMKAAAPRGRTAVPVV
FT                   AGSIETSAEVDAVFAISR"
FT   sig_peptide     complement(351888..351956)
FT                   /locus_tag="Mext_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(351953..353197)
FT                   /locus_tag="Mext_0314"
FT   CDS_pept        complement(351953..353197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0314"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="KEGG: rpd:RPD_0111 arginine biosynthesis
FT                   bifunctional protein ArgJ; TIGRFAM: arginine biosynthesis
FT                   bifunctional protein ArgJ; PFAM: arginine biosynthesis
FT                   protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28738"
FT                   /db_xref="GOA:A9VZI2"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZI2"
FT                   /protein_id="ABY28738.1"
FT                   /translation="MSSTEISPLAPATSPSLPEIAGVRIATAQAGIRYKNRTDVLYVAL
FT                   AEGTQVAGVFTRSRCPSAPVDWCRDALKAGKGARALVVNSGNANAFTGLKGREAVTLTA
FT                   DIAAQVAACAPEAVMIASTGVIGEPLDARKFDGVLAECAGRAEGGAEAWAQAAQAIMTT
FT                   DTFPKLATRRVEIDGVPVTINGIAKGAGMIAPDMATMLSFAFTDAALPQDVLQDLLSAG
FT                   TKTSFNCVTVDGDTSTSDTLLLFATGAAGNAAVTRADDPRLAGFRAALDDLLIELAQLV
FT                   ARDGEGANKLVTVEVEGAESDPSAHRIAMSIANSPLVKTAVAGEDANWGRVVMAVGKAG
FT                   EPADRDRLAIWFGDVRVAVQGARDPDYSEEAASAVMRRPEITVRVDLGLGQGRARVWTC
FT                   DLTKAYVAINGDYRS"
FT   gene            353579..354049
FT                   /locus_tag="Mext_0315"
FT   CDS_pept        353579..354049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0315"
FT                   /product="sensor histidine kinase with PAS/PAC and response
FT                   regulator receiver domains"
FT                   /note="KEGG: rpa:RPA0494 sensor histidine kinase with
FT                   PAS/PAC and response regulator receiver domains"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28739"
FT                   /db_xref="GOA:A9VZI3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZI3"
FT                   /protein_id="ABY28739.1"
FT                   /translation="MMQRTQDREEVTIDLDPVRSDLQVGAVAAPRSCYGVQVLVAGRRK
FT                   QWRDEINGQIRRAGYSAISVDSAVDALTVLVLGLPVDVLVTDAELHGSLGLSELAAEAR
FT                   ALRPNLGIVVACDSAVNDCADLVPADALLISSLGEEEAVASSVREAMAARAG"
FT   gene            354142..354696
FT                   /locus_tag="Mext_0316"
FT   CDS_pept        354142..354696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0316"
FT                   /product="glutathione peroxidase"
FT                   /note="PFAM: glutathione peroxidase; KEGG: bra:BRADO3371
FT                   putative glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28740"
FT                   /db_xref="GOA:A9VZI4"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZI4"
FT                   /protein_id="ABY28740.1"
FT                   /translation="MTIRRRDCLAMLAVLAASRAHAAEAGPASAFAFDKPEGGGLPLSA
FT                   YAGKPILVVNTATACGYAPQFVGLQGLWTRFGGRGLTVIAVPSPDFGNQEPLDGAAIAD
FT                   AARKNHGVTFPVTDKTHVRGPAAHPFYRWAAEQKPGQSPQWNFHKYLVGRDGTLRAAFA
FT                   TQVDPSDPRIVSAIVAELGQA"
FT   sig_peptide     354142..354210
FT                   /locus_tag="Mext_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            354943..355266
FT                   /locus_tag="Mext_0317"
FT   CDS_pept        354943..355266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28741"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZI5"
FT                   /protein_id="ABY28741.1"
FT                   /translation="MRFSGRRGLAPAWGASPHASRSRHHCGRKDRAMEPHSFEQDGTEY
FT                   EVRFERTPEGWIAHIRPEGWTEAHVVAFPEGVGFDRDDVRGSLIAGCEAAVARLPRRPP
FT                   TRH"
FT   gene            355457..355699
FT                   /locus_tag="Mext_0318"
FT   CDS_pept        355457..355699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpc:RPC_2151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28742"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZI6"
FT                   /protein_id="ABY28742.1"
FT                   /translation="MTEVIYHIVEHDGGFAYKVGDVFSETFPSRAEALQAAQAAAAEQQ
FT                   VPGSTEGIRYQDGRGQWHDETAQGSDRPVARVVED"
FT   gene            complement(355706..358813)
FT                   /locus_tag="Mext_0319"
FT   CDS_pept        complement(355706..358813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0319"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Proline dehydrogenase; Aldehyde
FT                   Dehydrogenase_; KEGG: rpc:RPC_4274
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28743"
FT                   /db_xref="GOA:A9VZI7"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZI7"
FT                   /protein_id="ABY28743.1"
FT                   /translation="MTDGPMSAPRFQAAYAPDDAALAEALLREAPLPAATEAAVDRLAA
FT                   DLIGAIRADASHGAVEALLREYALTTREGLALMTLAEALLRVPDAATADRLIADKLREG
FT                   DFVHHAVRSESGLAHAASWALGLGARLVGPQDTPEATLGSMVRRLGRPAVRAAAHRAMR
FT                   VMGGQFVLAEEIGAALKRAGSGTARRSRFSFDMLGEGARTADDAESYRQAYARAIARIG
FT                   REAGNAPLPARPGISVKLSALHPRYTPTQGARVMAELVPVVRDLARDARAHDLNFTLDA
FT                   EEAERLELSLDVFEAVLADPALAGWDGFGLAIQAYSKRCLPVIDYIAELAERYDRRLMV
FT                   RLVKGAYWDTEVKLAQTQGTVDYPVFTRKAMTDLNYLAAARRLLALRPRLYPQFATHNA
FT                   QTVASVLGLAGLLDRPADEEAGFEFQRLHGMGEALYQRLTERAPGVGQRVYAPVGGHRE
FT                   LLAYLVRRLLENGANSSFVARAADPSVPAAELLARPQALVETPSQARHPKIPLPRDLFG
FT                   PERRNSPGLAFGDGAALRRWTDAVARAAGPAEAAPIIDGAVQTGRARPVNSPIDGAALG
FT                   SVIEADPATAALAMEAAARGFPTWAATPARERAACLERAADAFVREQGRLLHLLQAEAG
FT                   KTLDDAVAEWREAIDFLRYYAAQGRDLFGEPQDLPGPAGEANSLRLVGRGVFVAVSPWN
FT                   FPLAIFTGQVAAALMAGNAVVAKPAPQTPLVADLAVRLLHAAGVPGSALHLVPGGPETG
FT                   AALIEHPALAGVVFTGSTATAQRINRALAARDSAILPLIAETGGINAMIVDATALPEQV
FT                   ADDVVVSAFRSAGQRCSALRLLLVQEDVADRMIAAVAGAARELTVGDPRDLATDLGPVI
FT                   DAGAKQRLDAHIAAMTTSARLHYAGAAPGGLTVAPHIFEIGGVADLREEVFGPILHVAR
FT                   YPADGLGSVLAAIRAGGYGLTLGIHSRIEETAERIAEALPHGNVYVNRNMIGAVVGSQP
FT                   FGGSGLSGTGPKAGGPHYLARFAMERTLTVNTAAAGGSVGLITLEG"
FT   gene            complement(358901..362428)
FT                   /locus_tag="Mext_0320"
FT   CDS_pept        complement(358901..362428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_1984 AsmA"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28744"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZI8"
FT                   /protein_id="ABY28744.1"
FT                   /translation="MRDSLTALAGAVVLVLVAALAVPPFIDWSAHRALIDRTLSDSLGA
FT                   GARSEGAIDLRLLPSPHLRLARLRLGAEDGPALDAQAVDAEIALAPLLKGEVRFVQTSV
FT                   ERAGLTLPVSDEALLLPREPQTLRRDIVIDDLRIRRLTVATLRTGEAPQEQFAAENLRL
FT                   RAPALAGPWLAEGTAKGSPFHLATSVAGSDGSLSLKLTGGGDTMPRLELDARITLKPED
FT                   APGEDRVRRGLVPEAEGTARLTVGPPVQPAGAVLPLTLAAKFASRGPLVQAKTVELELD
FT                   PGGKAARLSGNGRLDLREARLGLTLRTRRLDLDGLLLSGGARGLLAQGLTSGALTPPLL
FT                   LDLDLSAESVALGLDDWADVGFRGTFDRTGGLVLRRFEGRAPGAATVAATGEAELSGSP
FT                   RFTGHIDVATRNSEALGRYLGRIGAEESVTAILDGRAFEIGTDLSAAGTDLSLRNLRLA
FT                   LGEARVTGNARYLRADANGRGRLDAQLSATGIDIAELPPLGELMSGLHRHDLGLTLKAR
FT                   DVRYGPAGAHSGNGTIAVSLQSDGASLVVDTLDIADLAGASAQLAGRIAPDGSGRIEGR
FT                   VTAGKAAPLLALLERGFLPEARFVPQSVRQSGLALDLTLERESGEADALRASAKGKAGE
FT                   GDLDLALLTRSGRIDRLDSTLTTQKTGRWFGRDDIAALRQPGRLRLTGARPAAEAGQQS
FT                   TPPLALGIEGDLAGLTVSTPHPILLDALDRPPAGGTLRLAAPDLAPFLILAGGAAPAAG
FT                   PLPASLTLALSRRNAALHADVTGQVAGTDLTAALDRAPDGALAGTATLARLSLPALFAA
FT                   TVLPTDTSGRFAPLPAQPQVSLGLTIGQLDLGRGLVADSASLTLVREGDALSLRDLSAG
FT                   LAGGRLGGSITLARPAGAAAVSGEGSVEGADLTGLIGAGPVTGRLSAALRFGATGVSLS
FT                   ALANELSGNGEIRLTDLVLPGADAGAVDRALGKALAEDDALREGRLQALLSEELSAGPL
FT                   RARGPVSAAFTLSAGTLRTAPFGIDLGPARWNGTLQVDLRNRTLDARGALTAAAGPKGW
FT                   TGAAPSIQLGFGGPLSAPERRLDAAPLTTGLAALVLQRELEKIELFDADQSERQRRRAR
FT                   IEMDRARLAAEEAARQARLKAQQAAEEAARQARQREAEEATRRARIEAEPVPAPATQPL
FT                   DISPPSARP"
FT   sig_peptide     complement(362363..362428)
FT                   /locus_tag="Mext_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.963 at
FT                   residue 22"
FT   gene            complement(362589..362840)
FT                   /locus_tag="Mext_0321"
FT   CDS_pept        complement(362589..362840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28745"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZI9"
FT                   /protein_id="ABY28745.1"
FT                   /translation="MRAPSLALLTLLTALSPVLTPAWAQSPGNRGATSRQNQSFEYQNQ
FT                   NRNFEQRQTLENSAIRNQIQRAPLNVPPPAGPSFGIRR"
FT   sig_peptide     complement(362766..362840)
FT                   /locus_tag="Mext_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            362956..365343
FT                   /locus_tag="Mext_0322"
FT   CDS_pept        362956..365343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0322"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rpb:RPB_2023 UvrD/REP
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28746"
FT                   /db_xref="GOA:A9VZJ0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZJ0"
FT                   /protein_id="ABY28746.1"
FT                   /translation="MMQEPNDAHGAFRPRPSDDEAPSAPTSIAARAMAALRPEGASYLS
FT                   GLNPEQRRAVEATEGPVLVLAGAGTGKTRVLTTRIAHLIATGKARPYDILSVTFTNKAA
FT                   REMKHRIGGLIGPAGEGMPWLGTFHAIGTKILRRHAELVGLKSDFTILGTDDQLRLMKQ
FT                   VISDQNIDEKRWPARSLAHTIDGWKNRGLSPEQVPPGEAQSFAFGKGGQLYAAYQARLA
FT                   TLNAVDFGDLLLLCLKLWRENPDILANYQDRFRYILVDEYQDTNVAQYLWLRLLAQARK
FT                   NVACVGDDDQSIYGWRGAEVDNILRFEHDFPGATVVRLERNYRSTGHILAAASGLIAKN
FT                   EGRLGKTLRTEDEAGEPVTVTGSWDSEEEARQVAESIESLQRRGHALSEIAVLVRISAQ
FT                   MREIEDRFVQVGLPYRVIGGPRFYERAEIRDALAYLRVTMNGADDLAFERIFNTPKRGL
FT                   GDATLQTLHAFARADRIPLLAAARKLIETDELKPRARSMLRGLVESFTRWVRLVETKPH
FT                   PEVAQTILEESGYTEMWQKDRSADAAGRLENLKEFVRSMEEFPDMAAFLEHVSLVMEAS
FT                   EAEGADRVSLMTLHAAKGLEFDTVFLPGWEDGLFPNQRAIDESGRAGLEEERRLAHVGL
FT                   TRARKRAKLSFAVNRRIHGLWSSTIPSRFIDELPPQAVDVVEAPAHFSAGASRFDRNPM
FT                   PFGSSYGTPGWQRAQANTSGGFGGGLNGGQGRGGRASGPREIEGELVAKSTGAPSTFEH
FT                   GQRVFHTKFGPGTVAGIDGNKLTVDFDKAGRKMVLDSFLQPG"
FT   gene            365740..366456
FT                   /locus_tag="Mext_0323"
FT   CDS_pept        365740..366456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0323"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: ent:Ent638_1548
FT                   PhoH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28747"
FT                   /db_xref="GOA:A9VZJ1"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZJ1"
FT                   /protein_id="ABY28747.1"
FT                   /translation="MKRRRARLELVEDRPIRMHRTRFDEERNPAPIQPLTDRQGQYLDA
FT                   LASSSQVIVLGPAGTGKTFIAGTRAADLLRQRRISKVVITRPNVPSGRSLGFFPGTLEE
FT                   KIAPWVAPLTETMKERMGAAAFDIAVKAGDIEVVPFEVMRGRTFKNCLVILDEAQNTTT
FT                   AEIKMFLTRIGDDCQVIINGDVSQTDLRETSGLRTVIHLVKSRMMTIPIVEFTLDDIVR
FT                   SGICAEWVRAFEEEKL"
FT   gene            complement(366527..367267)
FT                   /locus_tag="Mext_0324"
FT   CDS_pept        complement(366527..367267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0324"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein; KEGG: ppr:PBPRA1295 putative aquaporin
FT                   Z"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28748"
FT                   /db_xref="GOA:A9VZJ2"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZJ2"
FT                   /protein_id="ABY28748.1"
FT                   /translation="MDHDTMRRTTAEFFGTFWLTFGGCGAAVLSAAFPELGIGFLGVAF
FT                   AFGFTVLTMAYAVGHISGGHFNPAVTLGLWSAGRCASRHVLPYVIAQVIGATVAAFALY
FT                   TIASGKAGWVPNGFASNGYGELSPGKYGLAACLLTEVLTAFIFLFIIVGTTSKGAAAGF
FT                   AGIPIGFALVLIHLISIPVTNTSVNPARSTGPALFAGPEYIAQLWLFWLAPITGAIAAG
FT                   VVGRWLYEPADMVETRVLERGAEI"
FT   gene            complement(367638..368531)
FT                   /locus_tag="Mext_0325"
FT   CDS_pept        complement(367638..368531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0325"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: rpc:RPC_3293 exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28749"
FT                   /db_xref="GOA:A9VZJ3"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZJ3"
FT                   /protein_id="ABY28749.1"
FT                   /translation="MKVVAIDFETANERRDSACAVGLAWIEGGRVVRRESRLIRPPQLR
FT                   FSPGNIRVHGILPADVRDAPTFPEVIAEFLPDLSGGLMLAHNAGFDMGVLAASLAAWGE
FT                   PVPDMAGHCTLQIARRVFPDPAGHGLAKVAGRLGIRFEHHDAGEDAFACAEIALAALHE
FT                   TGAADIADLARGLGLTPIRALTTPRRDMTRSTSAKALRASGIVDLRPTNALRFAMRGST
FT                   GNRYSLEFEERTDGPYLRCSCPAGTHRRRCRHVDALVEGDITELTSNNFDDVERLRQLL
FT                   DGKSVGPLRIKGVAAA"
FT   gene            complement(368582..371545)
FT                   /locus_tag="Mext_0326"
FT   CDS_pept        complement(368582..371545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0326"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase;
FT                   KEGG: pla:Plav_0946 (glutamate--ammonia-ligase)
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28750"
FT                   /db_xref="GOA:A9VZJ4"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZJ4"
FT                   /protein_id="ABY28750.1"
FT                   /translation="MGRRHDGQIARDDGTAPLIARLGQAPPLSNPEAAQARLDEIADAL
FT                   PAALREGPARDLLAALADHSTFLWSLASRDPARLVRLFEEAPEAADARIIAAQRAAGRA
FT                   GEGAAPDLDAVGKTLRRNRAEHALLVALADIGGLWPLERVTAALSDFADASVSAAVDAM
FT                   LLQSAAAGRFLPKDASEPQSGSGLVVLGLGKLGGRELNYSSDIDVIVFFDPEAAPLKPG
FT                   LEPTPFFTKLAQGVSKLLQERTRDGYVHRVDYRLRPDPGSTPTAMSLASAYVYYETTGQ
FT                   NWERAAFIKARAIAGDIPAGERFLADLTPFVWRKYFDFAAIADVHAMKRQIHAVRGHEA
FT                   LAVAGHDIKLGRGGIREIEFFVQTQQLVFGGRRPMLRGRSTVPMLAKLHEDGWISAEAR
FT                   DELGAAYAFLRTVEHRLQMVRDEQTQRLPTDRTELEGFARFAGFPDLAGFEAALLAHAR
FT                   RVQAHYALLFEAGPDLSSEVGDLVFSGAADDPATLATLRSLGFRDPERVTDTVRGWHFG
FT                   RRAAVRSPRAREVLTELVPALLKALSGTPDPDAALANLDRAFGRMPAAVELLTILREHE
FT                   RLRLLFADLLGSAPRLAGTVAFSPHVLDAVIDPDFGDPSVDAGAIAAHYRALLGRPDSH
FT                   EVFLDRSRDAARQLRFLTGARLLSGILTPQAAGCAFSAIADAAVATALDAVSKTFFAEH
FT                   GPIPNGRIVVLGYGRLGSHQLTAESDLDLVVLYDFDPENRTSTGPKPLDAAVAYNRLTQ
FT                   RLVAALTAPTRRGLLYEVDLRLRPCGGQGAVAAQFRSFRAYQREEAELWEHMALTRARV
FT                   IAGDESLAEEAKATIRDALMQPRDADAVNRSVRNMRATVENEKGDHGPLDLKLSPGGLL
FT                   DLDFLAQALVLGHAHTHPDLIGLDAPEVFSRAAEGGVIAADEAEPLADAYRLLDDVHQW
FT                   QRLMVEGDPTQASDVALARLARAANLPDAKALSARLDEERRTVRTIFDRRLGQPSGG"
FT   gene            complement(371787..372551)
FT                   /locus_tag="Mext_0327"
FT   CDS_pept        complement(371787..372551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr0494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28751"
FT                   /db_xref="InterPro:IPR018679"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZJ5"
FT                   /protein_id="ABY28751.1"
FT                   /translation="MVSASRVSPDDSSAPPHPHGLPRLPVAAAMSASARPPETALYAPV
FT                   KGFLETLGFAVKGEIGGCDLLGVREGEPPVLVVCELKQSFNLELVLQAVDRAGACDEVW
FT                   LAARLSVRGKGREADARFRNLCRRLGFGLLGVGADDAVHVLLSPGAPMPRRDPKRRSRL
FT                   LNEHRRRQGDPVAGGGSRAPVMTAYRQQALLCARALAPGPLRPRDLTSAVPTAAAILRR
FT                   NVYGWFERTGHGVYALTPAGHEAIGRWPSTPP"
FT   gene            complement(373127..374557)
FT                   /locus_tag="Mext_0328"
FT   CDS_pept        complement(373127..374557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0328"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: rpb:RPB_3441 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28752"
FT                   /db_xref="GOA:A9VZJ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZJ6"
FT                   /protein_id="ABY28752.1"
FT                   /translation="MSPSAASPPPDGLLARLGKIFRTTAFKLSLAYLVLFAVLASLGLG
FT                   YVAWNARRVLDDQILSTIDAEINGLSEQYTAGGLRRLIAVVERRAKEPGASLYLVTTPA
FT                   GEHIVGNVSRLPADILARSGQYESYYGRGSDSVPSEHRAIMRVFNLAGGFRLVVGRDTE
FT                   ERDHLRAAIGNTFGSSLALVVLLGVLGGWFVASRVLKRVDDMTETTRTIMAGDLDGRLR
FT                   VGGAGDELDRLAQNLNLMLERIGELMRGMREVSDNIAHDLKTPLTRLRNRADEALRTAE
FT                   TPETLRTAMEGVIEDSDGLIRVFNALLTIARLEAGNAPESVSRFDAGAVAREVAELYEP
FT                   LAEDRGLSLTVEIEPDLILDGNRELVGQAIANLLDNAIKYGARSSVSGPQEITVSAGRA
FT                   DGVVQLRVADRGPGIPEAERERVLDRFVRLDAARTRPGFGLGLSLVAAVARLHGGRLDL
FT                   ADNAPGLAVTLSLPGGAA"
FT   gene            complement(374554..375252)
FT                   /locus_tag="Mext_0329"
FT   CDS_pept        complement(374554..375252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0329"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rpd:RPD_2012 response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28753"
FT                   /db_xref="GOA:A9VZJ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZJ7"
FT                   /protein_id="ABY28753.1"
FT                   /translation="MRLLIIEDDREAAAYLVKAFREAGHAVDHAGDGLDGYALACEGDY
FT                   DVLIVDRMLPKLDGLSLVRSLREQAIATPVLILSALGQVDDRVKGLRAGGDDYLPKPYA
FT                   FSELLARTEVLARRRTAATGQSEATAYRVGDLELDRLSHRVTRAGREIVLQPREFRLLE
FT                   YLMRHAGQVVTRTMLLEHVWDYHFDPQTNVIDVHVSRLRAKIDRGFEHPMIHTVRGAGY
FT                   VIRADEPQAS"
FT   gene            complement(375279..375788)
FT                   /locus_tag="Mext_0330"
FT   CDS_pept        complement(375279..375788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0330"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: mes:Meso_0693
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28754"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZJ8"
FT                   /protein_id="ABY28754.1"
FT                   /translation="MDADALRALQAPLKNKYRETPDSAVITLKAKGSLDDTSIACKVET
FT                   GRALAVAGLHPATGGSGAELCSGDMLLEALVACAGVTVKAVATALEIPLKAGTVSAEGD
FT                   LDFRGTLGVNKEAPVGFRSIRLKFDLDTDAPQEKLDQLLKLTERYCVVFQTLNHKPELS
FT                   VNASRS"
FT   gene            complement(375865..376644)
FT                   /locus_tag="Mext_0331"
FT   CDS_pept        complement(375865..376644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0331"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bra:BRADO0533 putative sulfonate ABC transporter, ATP
FT                   binding protein (SsuB/TauB/YcbE-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28755"
FT                   /db_xref="GOA:A9VZJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZJ9"
FT                   /protein_id="ABY28755.1"
FT                   /translation="MLSIQSLSKTYADGTRALEGINLDVPNAEIVALIGGSGCGKTTLL
FT                   RLIAGLDRPSAGHIALDGEPITGPHPGVGLVFQEPRLLPWLSVAENVGFGIDHLPKRER
FT                   RERVAHALERVGLAEQAGRWPRELSGGQQQRVSIARAFVANPRVLLLDEPFSALDAFTR
FT                   KDLHRHLLALWEEVRPTVLIVTHDVAEAVALADRAIVMRPRPGRLDDTVALPMRRPRDP
FT                   AAPTSEAATRNILAALDHSLRPRDASRAPELAGGSSF"
FT   gene            complement(376652..377491)
FT                   /locus_tag="Mext_0332"
FT   CDS_pept        complement(376652..377491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0332"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bbt:BBta_7646 putative
FT                   sulfonate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28756"
FT                   /db_xref="GOA:A9VZK0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZK0"
FT                   /protein_id="ABY28756.1"
FT                   /translation="MSVTTVLSDDTEPKAVPARRSALLGGGARLALGLLLPLVLALGWE
FT                   AAVAAGLASGRLLPPPSRVAAALWTLAASGELWTHVEATLIRVGLGFAFGAGVGILAGA
FT                   LTATLPTLRWLVDPSLQALRAVPSLAWVPLFILWFGILETPKVALIAVGVFFPVYIGVA
FT                   GAIASVDRKLVEVGRIFRLSKVALARRILLPAVLPATLTALRTGLGLGFLFVVAAELMG
FT                   ASEGLGYLLLDGQQFSKPDQILAAIISFAVVGKAADAALVALTSPLVRWQDTARETL"
FT   gene            complement(377552..378184)
FT                   /locus_tag="Mext_0333"
FT   CDS_pept        complement(377552..378184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0333"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pen:PSEEN2025 transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28757"
FT                   /db_xref="GOA:A9VZK1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZK1"
FT                   /protein_id="ABY28757.1"
FT                   /translation="MPDAAHLAAFALVCLGMVLTPGPNMAYLVSRTVVQGRAAGLVSLT
FT                   GVAAGFVVYLLCAAFGITALLVAVPFAYDALRLAGAAYLFFLAWQAVRPGGRSPFDTRP
FT                   LPPDGAGRLVTMGFLTSVLNPKIAVMYLSLLPQFIDPAAGGVLTQSLALGLLQIAVSLT
FT                   VNAVIVLSAGSVAAFLKGRPLWLLAQRWFMGTVLAGLALRAATDARR"
FT   sig_peptide     complement(378104..378184)
FT                   /locus_tag="Mext_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.765) with cleavage site probability 0.760 at
FT                   residue 27"
FT   gene            complement(378193..379167)
FT                   /locus_tag="Mext_0334"
FT   CDS_pept        complement(378193..379167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0334"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; PFAM:
FT                   NMT1/THI5 like domain protein; KEGG: bra:BRADO0531 putative
FT                   sulfonate ABC transporter, periplasmic binding protein
FT                   (SsuA/YcbO-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28758"
FT                   /db_xref="GOA:A9VZK2"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZK2"
FT                   /protein_id="ABY28758.1"
FT                   /translation="MIRRRTVLSAFAGLFGLLATGSNLRAADVSEIRLDWATYNPVSLV
FT                   LKEKGFLEEALKARGIKVRWVQSLGSNKALEFLNGGAIDFGSSAGAAALLARINGNPIK
FT                   VVYAYSRPEWTALVTRKETGIGKPADLKGKRIAVTRGTDPHIFLIRALQGAGLTEKDAK
FT                   LVLLQHADGRTALDRGDVDAWAGLDPMMAAAEIESGDVLFHRDAAANTWGVLDVREDFA
FT                   KAHPDLVKVVIAAYEQARAYALANPDALKSALVSATKLPEAVIAKQIERTDLSQPAVGS
FT                   AQAESIRAAGLALQQAGVIPASTDVAAAVEGLIDPQFNPAPTR"
FT   sig_peptide     complement(379087..379167)
FT                   /locus_tag="Mext_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 27"
FT   gene            379327..382113
FT                   /locus_tag="Mext_0335"
FT   CDS_pept        379327..382113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0335"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: xau:Xaut_0284 metal dependent
FT                   phosphohydrolase; TIGRFAM: protein-P-II
FT                   uridylyltransferase; PFAM: amino acid-binding ACT domain
FT                   protein; DNA polymerase beta domain protein region;
FT                   metal-dependent phosphohydrolase HD sub domain; GlnD
FT                   PII-uridylyltransferase; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28759"
FT                   /db_xref="GOA:A9VZK3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZK3"
FT                   /protein_id="ABY28759.1"
FT                   /translation="MFDPVPVLEKIVASLDRDAREPTKLRGLLVPELRKVIETGHAEAE
FT                   RLLLKERDGLACAQRLSRLTDAVVRAIYDAVVWRLYPNDNPSTGEHLAIVATGGYGRGT
FT                   MAPGSDIDLLFLLPYKQTAWSESVVEAMLYVLWDLKLKVGHATRSVEECLREGRADMTI
FT                   RTALLESRFLFGSRSLFEEMVTRFDTELVIGSASEFVDAKLRERDARVAKAGASRYLVE
FT                   PNVKDGKGGLRDLNTLFWIAKYTYRVRNQAELVHAGLFTPDEYRLFERCEEFLWRVRCH
FT                   IHFVTGRPEERLSFGLQPKIAERLGFGSRGGLSGVERFMKAYFLIAKDVGDLTAIVCAE
FT                   LEARHAKRTPVLDRWIGRFRDRFRATSIEAEDFWIDNGRVNIRGEDAFERDPVNLIRLF
FT                   WLADRHNLPIHPDAARLANRSLKLITHAVRIDPEANRLFLDILTSKNAPETILRSMNEA
FT                   GVLGRFIPEFGRIVAMMQFNMYHHYTVDEHLLRSLGVLAAIDSGRVRDEHPLATRLIDT
FT                   IHNRRALYVAILLHDIAKGRPEDHSIAGAAIARKLGPRFGLSQAETETVSWLVEHHLLM
FT                   SMTAQSRDLSDRRTIEKFASEVQSLERLKLLAILTVADIKAVGPGVWTAWKGTLLRTLY
FT                   DETEVVLSGGHSEIARTDRVRLIQMALREQLSDWNSELFDGYAARHNQAYWLKVDSTRH
FT                   FKNARFLRTVMEEGRTSATTYETDPVRGVTELTVYSPDHPRLLAIITGACATMGGNIVD
FT                   AQIFTTTDGFALDSIFISRAFERDEDELRRAGRIATAIERALKGEIKIAELVADKHPKQ
FT                   PPKTFLVPPDVSIDNALSSRETVVEITGLDRPGLLYELTTGLNRLSLNITSAHVATFGE
FT                   RAVDVFYVTDLTGTRVVQPDRLAMIRAAVMEVFASDVAALRAEGLDALVDSPPPREL"
FT   gene            382205..382813
FT                   /locus_tag="Mext_0336"
FT   CDS_pept        382205..382813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0336"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: GrpE protein; KEGG: mlo:mll3220 heat shock
FT                   protein (HSP-70 COFACTOR), grpE"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28760"
FT                   /db_xref="GOA:A9VZK4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZK4"
FT                   /protein_id="ABY28760.1"
FT                   /translation="MMADDMEKHERHDGAEAEVPPQSGASRAGADAEGLAAAIAERDEF
FT                   KDRLLRTLAEMENLRRRTEREVADARTYAVTNFARDMLNTADNIRRALDSVPEEARAGA
FT                   EGPFKGLIEGIDLTERDLTKTLERHGVKVVDPKGQRFDPNRHQAMFEVPNTEVPNGTVV
FT                   QVVQTGYVIGDRTLRPALVGVSKGGPKPEANKDKPADAA"
FT   gene            complement(382921..383238)
FT                   /locus_tag="Mext_0337"
FT   CDS_pept        complement(382921..383238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28761"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZK5"
FT                   /protein_id="ABY28761.1"
FT                   /translation="MPADKPDRTLTTNSEEAGIQAGIATDPDNPEWTEADFQSAVPFEQ
FT                   AFPVLAEKLRRTRGPQSAPTKQLVSLRLDQDVLLRFRATGPGWQSRMNEALRRAAADLP
FT                   D"
FT   gene            complement(383228..383503)
FT                   /locus_tag="Mext_0338"
FT   CDS_pept        complement(383228..383503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0338"
FT                   /product="protein of unknown function DUF497"
FT                   /note="PFAM: protein of unknown function DUF497; KEGG:
FT                   oan:Oant_1533 protein of unknown function DUF497"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28762"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="InterPro:IPR038573"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZK6"
FT                   /protein_id="ABY28762.1"
FT                   /translation="MLIVWDEPKRLTNLQKHGLDFADFEAGFDFETALVAVAQPSAAGS
FT                   ARMKIIGEFDGQTVVAAIIAPLGREAISLISLRRASRSERRLYDAR"
FT   gene            complement(383595..384452)
FT                   /locus_tag="Mext_0339"
FT   CDS_pept        complement(383595..384452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0339"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: nca:Noca_0170 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28763"
FT                   /db_xref="GOA:A9VZK7"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZK7"
FT                   /protein_id="ABY28763.1"
FT                   /translation="MTDRTIAYQGEPGANSHIICSQAYPGWTALPCATFEDAFAAVNEG
FT                   KANLAMIPIENSIAGRVADIHHLIPTSRLHIIAEHFLPIHFQLMALPGVGTEQLTSVHS
FT                   HIHALGQCRRIIRRLGLKAVVAGDTAGAAREVAEAHDPSRAALAPAMAAEVYGLDILER
FT                   DVEDEAHNTTRFVVFSPEPAECEPGNDSTVTSFIFRVRNIPAALYKALGGFATNGVNMS
FT                   KLESYMVEGQFTATQFYAEVDGHPEDDGLRRALEELRYFSKELRIIGTYPAHPFRETTR
FT                   QAAE"
FT   gene            complement(384469..385212)
FT                   /locus_tag="Mext_0340"
FT   CDS_pept        complement(384469..385212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0340"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="KEGG: rpe:RPE_3769 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; PFAM: acylneuraminate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28764"
FT                   /db_xref="GOA:A9VZK8"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9VZK8"
FT                   /protein_id="ABY28764.1"
FT                   /translation="MSDPLILIPARLAATRLPSKPLADIAGVPMIVHVWRRAVEAGIGP
FT                   VVVATDTDAVAEVIEAQGGLAVMTRPDHPSGSDRLAEALEIVDPDGNHDVVVNVQGDLP
FT                   TIDPAIIAASVMPLADPQVDIATLCAVIHRPEEMDDPNVVKIIGHTVGPNRLRALAFTR
FT                   ARAPWGDGPLFHHIGLYAYRRKALARFVALPQGELEQREKLEQLRALEAGMRIDAMIVE
FT                   DLPLGVDTPADLERARTLLAIRRLN"
FT   gene            385520..386437
FT                   /locus_tag="Mext_0341"
FT   CDS_pept        385520..386437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0341"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: mlo:mll5495
FT                   cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28765"
FT                   /db_xref="GOA:A9VZK9"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZK9"
FT                   /protein_id="ABY28765.1"
FT                   /translation="MDSFELNKVAGAVLGALLFAVGSGFVAELIYHPKPVGSAGYPLPD
FT                   PEPKSGGAAAEAPKAEPIAVRLASADAEKGKGGTKACQACHSFEKGGPNKVGPDLWEIV
FT                   EREKAHAAGFDYSAALKEKGGTWTYEDLDHFLESPKGYVKGTKMAFAGIGSPTDRANVI
FT                   AYLRTLADSPKPLPAAEKKAETAPAGDKKAETEKPAEGKPDAKKAVEDKKPAGTKPVES
FT                   ATGDKSKTPETNAPQGNTQSGDGKDTARPVPAPQVQPQRNEVAPTQAPEAKPSGDIPTK
FT                   ADPGSESTPATEPPAKPDPDAPKP"
FT   sig_peptide     385520..385600
FT                   /locus_tag="Mext_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.921 at
FT                   residue 27"
FT   gene            386610..388523
FT                   /locus_tag="Mext_0342"
FT   CDS_pept        386610..388523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0342"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: nha:Nham_0378 extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28766"
FT                   /db_xref="GOA:A9VZL0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZL0"
FT                   /protein_id="ABY28766.1"
FT                   /translation="MTENAVIARRSFLAGALVLLGLRGPVSAQEPAESASKVSAQEAPG
FT                   NWRHALTLLGEPKYGPDFQHFDYADPKAPLGGLVRLGSQGGFDNLNFIVNGLKGDLEGG
FT                   ITQIYDTLMEDSGDEPFSSYGLLAEAVRIAEDGQSVTYRLRPNARWHDGKPVTVEDVIW
FT                   SFDTLKANSPFYAAYYHTVAKAEPGAEREVVFRFSEAGNRELPQVLGQMQVLPKHWWTG
FT                   TDKNGKPRSPTETTLEIPLGSGPYRLTKVDAGRSAVYERVADYWGKDLPVNRGRNNFGT
FT                   VRFEYFRDGSVLLEALKGDLYDFRTENIARNWATAYDDFPAVKEGRLIKEEFPGRGTGI
FT                   MQAFVFNLRRDKFKDERVRRAFNLALNFEEMNRQLFYGLYSRIDSYFYGSDLASSGLPD
FT                   GMEKVILESVKDKLPGSVFTETYTNPVNDTPEAARANLRKAVGLLREAGYELKGGKMVA
FT                   KATGEPLTVEFLEFQNVFERVILPYAAQLKLIGIESSIRVIDQAQYQNRLRSFDFDITT
FT                   SNWPESLSPGNEQREFWGSAAADKPGSRNIAGIKDAGIDALIEKVIFAQDRETLVAATH
FT                   ALDRALLAHNFVVPQWSSAATRTLRWNRFGRPAVLPKYGSSGFPTTWWYDEALAAKTGA
FT                   PR"
FT   sig_peptide     386610..386696
FT                   /locus_tag="Mext_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            388520..390394
FT                   /locus_tag="Mext_0343"
FT   CDS_pept        388520..390394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0343"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rpe:RPE_3766 extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28767"
FT                   /db_xref="GOA:A9VZL1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZL1"
FT                   /protein_id="ABY28767.1"
FT                   /translation="MSAGATRRSVVLGTGVIALAGALPRSARAEDVHKAHGGIHGLSSF
FT                   GELKYAPDFPNFDYVNPMAPRGGRFSTTLVQTFGNQAFDTFDTLNPYVFRGNGAAGINL
FT                   TFDSLMVRALDEPDALYGLVARSVEISPDGLTYRFALRPQAHFHDGSPLTARDAAFSLT
FT                   ILKEKGHPTIAQVIRDVAEATAEGDETLVVRFAPGRSRDLPLIVAGLPIFSAKFFEGRD
FT                   FEAQTLKPLLGSGPYQVGRIDIGRFIELERVTDYWAADLPVMVGQNNFDQLRYEYFRDR
FT                   QVAFEAFKGGAYTYRQEFTSRIWATGYDFPAAREGRVKRETLPDTSPAAIQGWFFNTRR
FT                   EVFKDPRVREAIGLCFDFPWTNRTAMFGSYERTVSFFQKTDLMATGKPSAEELALLEPF
FT                   SGQVPAEVFGEAWTPPVPDGSGQDRALLARAVALLKEAGCTREGGALRLPSGKPIEFEF
FT                   LDSDSVWEPIVQPFIRNLGLIGIKARQRAVDAAQYQARVRDFDFDITARAASGDATPGP
FT                   ELREAYGSRAAAIPGSNNLAGITDPVIDALLDRIANADSRASLTVACRALDRVMRAGRY
FT                   WIPMWYSPEYRLALWDMYGRPAKLPTYGLGVPGLWWYDEAKARRIGRG"
FT   sig_peptide     388520..388609
FT                   /locus_tag="Mext_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.979 at
FT                   residue 30"
FT   gene            390404..391501
FT                   /locus_tag="Mext_0344"
FT   CDS_pept        390404..391501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0344"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oan:Oant_0013
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28768"
FT                   /db_xref="GOA:A9VZL2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZL2"
FT                   /protein_id="ABY28768.1"
FT                   /translation="MLAYILRRIALMIPTIFGIMLITFAIIQFAPGGPVERVLAQLQGQ
FT                   QEGSLSRITGGQGDLGGGAARGGGEASKYRGAQGLDPAFIKKLEAQFGFDKPAYERFGK
FT                   MLWDYLRFDFGRSYFRDVSVLDLIKEKLPVSISLGLWMTLISYAISIPLGIRKAVADGS
FT                   RFDVWTSAVVIVGYAIPSFLFGILLVILFAGGSFLQIFPLRGLTSENFESLSLWGKALD
FT                   YAWHLVLPLSALVLGAFATSTLLTKNSFLDEIRKQYVVTARMKGVSERRVLYGHVFRNA
FT                   MLIVIAGFPGAFITAFFTGSLLIETIFSLDGLGLLSFSSIVGRDYPVVFATLYIFSLLG
FT                   LAVNLLSDLTYTWIDPRIDFSARGA"
FT   gene            391522..392073
FT                   /locus_tag="Mext_0345"
FT   CDS_pept        391522..392073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0345"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rpa:RPA4388 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28769"
FT                   /db_xref="GOA:A9VZL3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZL3"
FT                   /protein_id="ABY28769.1"
FT                   /translation="MRSRLLSARIRRRTPPVTALPLVIRPEHPDDAAAIERLHARAFGP
FT                   GRFARTAYRLREGVAPLPDLCLTALVGTYLVGSVRIGPAEAQGGSLLVLGPLTVDPSFS
FT                   DRGIGTSLMQASLDAARAAGHGLVVLVGDAPYYRRFGFVPVPAGRLTLPGPVDPARFLW
FT                   LELRDGASAGLSGAIQPRRI"
FT   gene            392187..393719
FT                   /locus_tag="Mext_0346"
FT   CDS_pept        392187..393719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0346"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pla:Plav_3087 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28770"
FT                   /db_xref="GOA:A9VZL4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZL4"
FT                   /protein_id="ABY28770.1"
FT                   /translation="MPTTHDRQPPPRFNAARYCLAENARLRGDKTALVMVGDGGTVSRL
FT                   TYAQADRAVRGIAAGLLGLGLKAGDRVMIRMGNEADYVLVYFGALAAGLVALPSSPQLT
FT                   ADEASFLMENAGVAAVVTGQGFSNSSGAVGRLHLDSETIAAMKAGEPLADYADTAADDP
FT                   ATLVYTSGTTSRPKGVLHAHRAIWGRRPMHAHWLGLAESDVMLHAGTMNWTYTLGVGIT
FT                   DPWACGATTVLYNGPRDRGIWPRLIAEQGATIFAAVPSVYRQILKYADLAEHDLSRLRH
FT                   GVTAGEALSADLLDAWTKATGKPLFEALGMSEISTYVSSGPTIPVRPGSPGRPQPWRRV
FT                   AILPADGPPEPLPPGETGLLAIHRSDPGLMLGYWQRPEEEAAVMRGEWFAGGDLASFDA
FT                   DGYLWFHGRNDDLMNAMGYRVSPVEVEGVLAGHPDIAEVGVTELSVRVDLRVIAAFVVL
FT                   RPGAEPNAEGLMAWCGERLAAYKAPRAVRFVEALPRTANGKVQRKRLAEAAE"
FT   gene            393780..394562
FT                   /locus_tag="Mext_0347"
FT   CDS_pept        393780..394562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0347"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: rpr:RP218
FT                   putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28771"
FT                   /db_xref="GOA:A9VZL5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZL5"
FT                   /protein_id="ABY28771.1"
FT                   /translation="MAPLPISVFIIVKNEADRLGATLAAVRALADDIVVVDSGSTDGTQ
FT                   ALAASLGARVIHNDWPGYGRQKRFAEEQCRHDWVLNLDADEVVPPDLAEQIRAVFAQGE
FT                   PAHAAWSIAIAEVFPGETRPHPWAYVLTPVRLYRRDLSTYSTSPVHDRVVLGPGVTTGR
FT                   IKGRIHHFSVRSLGDQLAKLNRYSDQQADDLDARGVTIPAWRLYVELPGNFLKAYFGRR
FT                   HFVRGAYGFLTAMNYAISRHLRVAKHYERRVTTPRRPG"
FT   gene            394598..394690
FT                   /locus_tag="Mext_R0006"
FT                   /note="tRNA-Ser1"
FT   tRNA            394598..394690
FT                   /locus_tag="Mext_R0006"
FT                   /product="tRNA-Ser"
FT   gene            394798..396705
FT                   /locus_tag="Mext_0348"
FT   CDS_pept        394798..396705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0348"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: rpb:RPB_3046
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28772"
FT                   /db_xref="GOA:A9VZL6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZL6"
FT                   /protein_id="ABY28772.1"
FT                   /translation="MYVVRRGDRFWFRKAVPVDLVDVLGIAEVRRSLRTGSAREARRRA
FT                   LDVLVRVEEVYAVLRSERPMRPARDIALALLEKALQSNSGTPATFETNGQLLQEAAGVL
FT                   RRTGDGDQSVGRRNGIADLVDQAKFPEGEPISFVGTDDALRMMRAEGPKGEENRIAIAI
FT                   LEAVARMSVGRLKDTNQGARDLDTALSALSALREGAIAPEAAFPFEQLRALLTSHFLPT
FT                   APAVDAQAVREMVAAELRDGIARAEAEKWSGMLLSEAIAKFEAVEVCMRGGQKHQEDVP
FT                   RRLANFMSVVGDKPIRDVSRDDVRRYRDLLDQLPDRFVLRFNTSDMQEAIKANRERRHP
FT                   YGTIKKPTIDLKYIGPVNRLFAFLVKEKLLGANPLDGIRSTQKEESSAKAKRLPLKPHH
FT                   IDLLFAETAQQPLITATYWVPVIMLFSGARPGELAQLKVEDLRERFNGRPHLSVLCQEN
FT                   DDEEEPDVEMVRKPAVEDMRRVKTEAGRRLIPLHPMLVRMGLLDLFQRRRRDVGAKGQL
FT                   FRDVKPNAHGHYSAALTKRINRRLRALGITNKRFVLYSLRHNFIEACNASGMPLGTRNK
FT                   VVGHQTDGMGGIYGNPLPEPWESDWIEKVTFTGIDLDPYLATGMAGKVFIPGTRRKPIT
FT                   "
FT   gene            complement(397030..398124)
FT                   /locus_tag="Mext_0349"
FT   CDS_pept        complement(397030..398124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0349"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: smd:Smed_0268
FT                   flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28773"
FT                   /db_xref="GOA:A9VZL7"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZL7"
FT                   /protein_id="ABY28773.1"
FT                   /translation="MTCVFTNPAAVVALQTLRAVVRDRDATLRRLSTGLRIGSAADEAA
FT                   YWAIASTLRADNGSLATTRDAISHDRNTVEAMARRLDRVIDQLGAIGRTLVSASGAQAD
FT                   TTKLQVDLRIALDAIRLTADNAIMNGANWLSVNSEEPNFSVTRNLVTAFSCQGGSVAVG
FT                   TSAFDTSGIILFDARAREDGRGAFSRTPAVGCIPTLARGIARTASVASPDGYRLQTWDG
FT                   PSQRGGQTLYLTWNHGLLDTQFYVRDGNAEQQPFSIASMDLTSPYADAKMIQAYAKVVD
FT                   ATLQVLLDGAAKLGATSALLSLQQNFAGRLMDINASAIGALVDADIEEASARLKALRVQ
FT                   QQLGLQSLNIANGASQAILVLFRQ"
FT   gene            complement(398248..398775)
FT                   /pseudo
FT                   /locus_tag="Mext_0350"
FT   gene            398844..399985
FT                   /pseudo
FT                   /locus_tag="Mext_0351"
FT   gene            400171..401100
FT                   /locus_tag="Mext_0352"
FT   CDS_pept        400171..401100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0352"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: hne:HNE_3446
FT                   ISHne3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28774"
FT                   /db_xref="GOA:A9VZL8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZL8"
FT                   /protein_id="ABY28774.1"
FT                   /translation="MDAPVVGIDVARDRLDIHVHPSGANFAVDRTTEGVEQLCERLRPL
FT                   KPKLVVLEATGGLEAMVARALTTWRLPAVIVNPAQVRAFAHALGQRAKTDRIDATVIAR
FT                   FAAATNPPVRARADAETQALADLVTRRRQIVGLIASERQRASQAPPCIRDSVRRVIEAL
FT                   EQEQSVIDRSIDAEVDRSLEWRRKETLLTSVPGVGPTIARTLIAELPELGSLNRKQVAA
FT                   LVGLAPWTRQSGQWRGRSFIAGDRAPVRTALFMGAMVASRHNAALKTFRDRLIAAGKPK
FT                   LVALIATARKLITILNAILRDGTPWQPA"
FT   gene            401448..402047
FT                   /locus_tag="Mext_0353"
FT   CDS_pept        401448..402047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecw:EcE24377A_2232 conserved hypothetical
FT                   protein TIGR02594"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28775"
FT                   /db_xref="InterPro:IPR013423"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZL9"
FT                   /protein_id="ABY28775.1"
FT                   /translation="MTAFQRSAGLVADGIAGLKTQVALQKADISEWREASEQPGWLVLA
FT                   EGELGVRGGAGAANNPRVVKLFADAGFSCIKQDSVAWCAAAVGGMLKQAGHKPSGSLAA
FT                   RSYEGWSVGLKEPALGAVATKKRGNSSWLGHVGFIVGANSRQIFLLGGNQGDAWSVAAF
FT                   PRKELTAFRWPTDVPLPAPHTLPQTIAGARSGVSEA"
FT   gene            402106..402867
FT                   /locus_tag="Mext_0354"
FT   CDS_pept        402106..402867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28776"
FT                   /db_xref="GOA:A9VZM0"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZM0"
FT                   /protein_id="ABY28776.1"
FT                   /translation="MSDGDRGATTEISGTRLGRAQAARAAYPDQYPSRPGRPRIPTIKF
FT                   TTMNRMLPLAALALACVSSPAFAMAYPPEQGGAAVGVSRGLLFLAALARSVALALATRR
FT                   FGIIGAALAALVLSAEGAFAAEISAVGDTAVILPYGQWITVIAQTATEILIPITVAALG
FT                   IAARKLPWLVSMYLTEARIDRMVRLAADYALNPVEKAAADKILSVDVGYTVLKVRLERA
FT                   IGSPRAGSSMRPAVRRASPSACSAPSASTRA"
FT   gene            402938..403081
FT                   /locus_tag="Mext_0355"
FT   CDS_pept        402938..403081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28777"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZM1"
FT                   /protein_id="ABY28777.1"
FT                   /translation="MAMPSSTQSGRIGRGKRMLVYDPDPANNERIRRAVRYGQTRWAEI
FT                   WL"
FT   gene            403091..403501
FT                   /locus_tag="Mext_0356"
FT   CDS_pept        403091..403501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_3728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28778"
FT                   /db_xref="GOA:A9VZM2"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZM2"
FT                   /protein_id="ABY28778.1"
FT                   /translation="MAVGLVLVAPTNTFGNESFRVIASVITEWKAGALCLFFGSVHLIA
FT                   LWVNGRRGRETSLIRTFGCLGGFVFWLAITLGFLLTASPITTGVAVYTILALAELQASG
FT                   RAASDMAAEDAFGFRARRRQNGAGSSRSSSAA"
FT   gene            403467..403859
FT                   /locus_tag="Mext_0357"
FT   CDS_pept        403467..403859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28779"
FT                   /db_xref="GOA:A9VZM3"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZM3"
FT                   /protein_id="ABY28779.1"
FT                   /translation="MPAVPDPLPQLDTWPAIILAVSAAAAALLVPLTGFLKTFFDYRIE
FT                   AQKAEALKPEVARDVAQAAGTTLFDSMAVTDLTLAIKDLTMVIRADTASEEAQHASQFA
FT                   QVLQRLTDVLNHHDDTHGQPPRGGRR"
FT   gene            404320..405831
FT                   /locus_tag="Mext_0358"
FT   CDS_pept        404320..405831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0358"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   ana:alr7304 similar to hlyA"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28780"
FT                   /db_xref="GOA:A9VZM4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR021720"
FT                   /db_xref="InterPro:IPR039155"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZM4"
FT                   /protein_id="ABY28780.1"
FT                   /translation="MSISDPAQAAAIESENPVVTAINAGGDAITQDGIEFLADQFFTEG
FT                   FTFGDIEGGNGLQPIFTNTVYQTERYGNFSYAIPVASTSQAYTVELRFGELWWSNPGQR
FT                   VFDVTLEGQTILNDLDILAQTGSFNTPYTYVSGPITAGANGTLDLQFASSIDNAQLSGI
FT                   IVRQANTLTGGPGSDYLVGGVGVDVLSGGAGDDALIGHAGNDLLHGDDGNDTLDGGLNA
FT                   DHMSGGLGNDVYGVDDLGDVVIEASDAGFDTVYSSISYVLPADVEAMILTGLENLSGTG
FT                   NDGANTLAGNAGHNVLTGGGGNDLYGVDGNGDTVVEAIDGGYDEVYSSGDYTMAENIET
FT                   LFLTGSAVYATGNAANNAIIGNDLDNVIDAGAGDFEFINGAGGNDLLIGGAGHDEIMGG
FT                   AGNDVFRFTSLSDAGDFFFDFTPGEDKIQLNATAFGIGTAVNQFVTGVSFIEGPDVTSA
FT                   APTVLYNKDSGYLLYDADGTGAAGPSVLALLNGTPTLHASDFMFY"
FT   gene            complement(406060..406302)
FT                   /locus_tag="Mext_0359"
FT   CDS_pept        complement(406060..406302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28781"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZM5"
FT                   /protein_id="ABY28781.1"
FT                   /translation="MERVRRVGAYLQVQDGDGCRHLLRVSSVQAVSDTDLMHNETFITA
FT                   AGKTIRVPQALDEILPLISPGERFSAEDKPEPWPF"
FT   gene            complement(406305..406559)
FT                   /locus_tag="Mext_0360"
FT   CDS_pept        complement(406305..406559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:RL3520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28782"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZM6"
FT                   /protein_id="ABY28782.1"
FT                   /translation="MAMKTTFLMQTFVLKRKRLLPGERQVSPTSSGAMKRAEAMATRMP
FT                   GTAALQIMADDETGELERATILGQYGDVPDDFAESLQAA"
FT   gene            406700..407155
FT                   /locus_tag="Mext_0361"
FT   CDS_pept        406700..407155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0361"
FT                   /product="peptidase S24 and S26 domain protein"
FT                   /note="PFAM: peptidase S24 and S26 domain protein; KEGG:
FT                   pmc:P9515_10191 putative SOS mutagenesis protein UmuD"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28783"
FT                   /db_xref="GOA:A9VZM7"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZM7"
FT                   /protein_id="ABY28783.1"
FT                   /translation="MSLFRVDELTDQGFSTVRVPLMGPSRCAGFPSPADDFPENALELP
FT                   RWLVPNPPATFLWRIGGDSMRDAGIFDGDLACVDRSLKPGHGSVVVAAVDGEMSIKRMV
FT                   VEGNRAHLSFDNSDLPIYALEELAEVNVWGVVRFTIRWHVSRAGQGR"
FT   gene            407420..407803
FT                   /locus_tag="Mext_0362"
FT   CDS_pept        407420..407803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0362"
FT                   /product="DNA-directed DNA polymerase"
FT                   /note="KEGG: mpt:Mpe_B0052 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28784"
FT                   /db_xref="GOA:A9VZM8"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZM8"
FT                   /protein_id="ABY28784.1"
FT                   /translation="MRSISTVVTLPEATNDTLALIPAALHSVTRTWREQGCPPWRYSKA
FT                   GVVTVDLVPLAASQRALIGRFDRERSTRVMGAMDACNVRFVRGSVVPERARLAQQRRTW
FT                   TTKFEMRTQCYTTQVDELPVAQA"
FT   gene            408475..409311
FT                   /locus_tag="Mext_0363"
FT   CDS_pept        408475..409311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0363"
FT                   /product="PAS sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: regulatory
FT                   protein LuxR; PAS fold-4 domain protein; KEGG:
FT                   pap:PSPA7_0636 transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28785"
FT                   /db_xref="GOA:A9VZM9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZM9"
FT                   /protein_id="ABY28785.1"
FT                   /translation="MEACLNLPDGGSRFVIVAGQPIEMGEEPCMLFTFADLELRRKAET
FT                   ALRQSEERFATAFRLTPVPTLLARLDGFTVTSINDAFTRVFGYGEDSVVGRSPSETGLW
FT                   VADAARERFEEAVGRTGFVPGQEVCLRHQDGSELDCLASAERVEIGEETFALLVLQDIT
FT                   ERKRGERELFEAIEAVMADTSWFSRGLIEKLANLRQPGGHDGDGASPILTVRERQILNL
FT                   ICTGLDDDAIAKRLNLSRNTVRNHGAALYRKLGVHKRAEAVIWGRENGFPLHPSGT"
FT   gene            409588..409962
FT                   /locus_tag="Mext_0364"
FT   CDS_pept        409588..409962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0364"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: bja:blr1496
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28786"
FT                   /db_xref="GOA:A9VZN0"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZN0"
FT                   /protein_id="ABY28786.1"
FT                   /translation="MPALQEHEENDMVDTDRITGAAKEFGGKVQGAVGDLTGSKNDSVE
FT                   GRFREAQGTAENLYGQAKDAVRHAADEVSDYAEDAYDRSRRTLREGSRDVGGYVFEAPG
FT                   TSLLIAAAVGFGLGLLVSRL"
FT   gene            410006..410917
FT                   /locus_tag="Mext_0365"
FT   CDS_pept        410006..410917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0365"
FT                   /product="conserved hypothetical membrane spanning protein"
FT                   /note="KEGG: smd:Smed_5683 conserved hypothetical membrane
FT                   spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28787"
FT                   /db_xref="GOA:A9VZN1"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZN1"
FT                   /protein_id="ABY28787.1"
FT                   /translation="MTTTTSLSPVAAGDTRAVLLNEVSWGAIFAGAVTALVTQVVLNLV
FT                   GVGVGLASVGTNAADNPDASTFSLGAGLWFVVSGIVASLAGGVIAGRLSGKPLPGVAAL
FT                   HGLVAWAVTTLVVLYLITSAASGLVGGTLGTVSGALGGAGNLVGGTVQTAAQAAAPSLS
FT                   KIANPLDGIERTVREQAAGQDPQAARDAAVAAVRAVLSGDPAQKEQAKSRAADALAKAQ
FT                   GIAPDQAKAQIDGYEKQYEQAVATAKQKAEAAAVAAKSAATQGAFYAALALILGALAAF
FT                   FGGRLGAPKPATLVGTYDARRA"
FT   gene            411008..411211
FT                   /locus_tag="Mext_0366"
FT   CDS_pept        411008..411211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0366"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: pen:PSEEN4005
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28788"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZN2"
FT                   /protein_id="ABY28788.1"
FT                   /translation="MSSTTDKIKGLANEAAGNVKQGIGNVTGNDKLVAEGKAQELKGEA
FT                   QKTVGDVKDGAKTLADKVTGKH"
FT   gene            411286..411669
FT                   /locus_tag="Mext_0367"
FT   CDS_pept        411286..411669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0367"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: acr:Acry_2107 CsbD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28789"
FT                   /db_xref="GOA:A9VZN3"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZN3"
FT                   /protein_id="ABY28789.1"
FT                   /translation="MNRDQFRGASRHIKGRAQTALGGVTGDPVRQVRGAANQVAGGAQY
FT                   VYGSARDRIEDLARDGEHLAHSARERADDLLQDGRRYAGEARRRGRDYSRRAVRYADAN
FT                   RTSTLLGIAAAAFTLGWLARPSR"
FT   gene            complement(411890..412810)
FT                   /locus_tag="Mext_0368"
FT   CDS_pept        complement(411890..412810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0368"
FT                   /product="protein of unknown function UPF0187"
FT                   /note="PFAM: protein of unknown function UPF0187; KEGG:
FT                   pen:PSEEN4044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28790"
FT                   /db_xref="GOA:A9VZN4"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZN4"
FT                   /protein_id="ABY28790.1"
FT                   /translation="MIVRPRPGLLTILFAMRGSILPKVAPQVIVIAALSFLVVAIEQRH
FT                   AAWFPVTAGIGPFTLVGLALSIFLSFRNGACYDRWWEARRAWGSLIVELRGLARLLPAL
FT                   LPEPEHEALRRRCLRRGAGFAHALHARLRGLDETEALAPWLPSEELATLGQRPSGADAA
FT                   LTGLTRDLAGAAKAGALSDVLFVSLEHKIASLSAIQATCERIHGTPLPFAYTLLLYRTA
FT                   WLYCLLLPFGLAGSLGWSTPIIAALVAYAFFGLDALGDELEEPFGTDANDLPLDTLLHT
FT                   ADAAILDALGETGREAPKADRFMLR"
FT   gene            complement(412821..413996)
FT                   /locus_tag="Mext_0369"
FT   CDS_pept        complement(412821..413996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0369"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   pla:Plav_0407 acetylornithine deacetylase (ArgE)"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28791"
FT                   /db_xref="GOA:A9VZN5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZN5"
FT                   /protein_id="ABY28791.1"
FT                   /translation="MTAPAGGTRLSPLELLERLVAFDTESSKSNLALIDFVAEYLDSWG
FT                   VPHLRVPNAEGDKAALFATLGPMTDGGVVLSGHTDVVPVTGQAWTSDPFRLRVADGRAY
FT                   GRGAVDMKGFDALALAMVPAALEAGLTRPIHILLSYDEETTCLGVADTIARFGADLPRP
FT                   GAVIVGEPTEMQVADAHKSVVTYNTTVHGHAAHSAKPGLGANAVMAAADLIAELNRIAD
FT                   AMVARGDASGRFDPPNTTVHVGVIEGGTARNILPKLCTFLWEFRGLPDLDMAEIPALFD
FT                   ASCERVTRERLNRYGEFGHIATVEEVSVPGLAPDPGSEAERLALRLAGRNATITVPYAT
FT                   EAGRFQRAGIPTVVCGPGSIDQAHQPDEFITLDELARGEAFMRRLVAACAG"
FT   gene            complement(413993..414385)
FT                   /locus_tag="Mext_0370"
FT   CDS_pept        complement(413993..414385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0370"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: bra:BRADO6774 ApaG
FT                   protein; unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28792"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9VZN6"
FT                   /protein_id="ABY28792.1"
FT                   /translation="MYKAETRGIMVTVEPRFVEEESSPGESRYFFAYTVEIVNNGSEQV
FT                   QLRSRHWRIIDGRGACQEVRGAGVVGKQPVLEPGESFSYTSGCPLTTPDGLMAGSYTMS
FT                   TIGGESFEAEIPAFSLDSPHLRRVVH"
FT   gene            414553..415002
FT                   /locus_tag="Mext_0371"
FT   CDS_pept        414553..415002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28793"
FT                   /db_xref="GOA:A9VZN7"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZN7"
FT                   /protein_id="ABY28793.1"
FT                   /translation="MATRPDRPPLAAGPALGSVLTLALALAFAWWDPAQNRWPALALAM
FT                   ALGLDTAARIAARAVRQRTGVETEIRGLPSPMLALGKAMGIGALVVAGVSYLRPDLFPL
FT                   LASALAGLVAMGACARLALARMVVAIEAAERAAAEAKRKGEGTGR"
FT   sig_peptide     414553..414642
FT                   /locus_tag="Mext_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.865 at
FT                   residue 30"
FT   gene            414999..416117
FT                   /locus_tag="Mext_0372"
FT   CDS_pept        414999..416117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0372"
FT                   /product="2-deoxycytidine 5-triphosphate deaminase"
FT                   /note="PFAM: 2-deoxycytidine 5-triphosphate deaminase;
FT                   KEGG: bja:blr1106 2'-deoxycytidine 5'-triphosphate
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28794"
FT                   /db_xref="GOA:A9VZN8"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZN8"
FT                   /protein_id="ABY28794.1"
FT                   /translation="MSGDVPAASGILPAQAITALTQAGAIRPATAYAADQIQPASLDLR
FT                   LGRRAYRVRTSFLPGSGRSVATCVEAFALHEIDLTQGAVLETGCVYIAELQETLALPPD
FT                   LSASANPKSSTGRIDVFTRVITDRASAFDQIEAGYAGQLYAEISPRTFPVRVRTGSRLS
FT                   QIRFRQGDPRLRETELAALHASDPLIDAATPSLQGGVPVSVDLAGFEGLIGYRAKRHTG
FT                   LIDVDRPRGHRTRDFWEPLPADGSRTLILDPGQFYILASKEAVRVPADYAAEMVPFDPL
FT                   VGEFRVHYAGFFDPGFGLSEAGGAGARAVLEVRSRDVPFLLEDGQIVGRLVYERMLERP
FT                   ATLYGAGAGSNYQAQGLKLSKHFASEPEPPAA"
FT   gene            complement(416164..417051)
FT                   /locus_tag="Mext_0373"
FT   CDS_pept        complement(416164..417051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0373"
FT                   /product="putative transport protein, YfdC-like protein"
FT                   /note="KEGG: bra:BRADO1703 putative transport protein,
FT                   YfdC-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28795"
FT                   /db_xref="GOA:A9VZN9"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZN9"
FT                   /protein_id="ABY28795.1"
FT                   /translation="MSQESRTHGDPDDQGEAKTHGAHTREKDNAQVEKAHRPDALILHE
FT                   IIRREGEEEMRRTWLALSLSGFAAGLTMGFSLIVPGVLKGHLPHAPWAELVTSAGYSIG
FT                   FLIVVLGRQQLFTENTVTPILPLLTERTFGALLRVVRLWGIVLVANILATIAIASVLAH
FT                   TDAFKPEVREAFAEISRHTIEDPFWTTVIKAVFAGWLIALMVWILPASGSAAPFIIILM
FT                   TWLVSMCGLAHIVAGSVDAYYLVAIGEIDFSTYLTGFFVPTLLGNIVGGVTLVSVLNFG
FT                   QVAPEIEDHNRVGA"
FT   gene            complement(417163..417900)
FT                   /locus_tag="Mext_0374"
FT   CDS_pept        complement(417163..417900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0374"
FT                   /product="molybdopterin binding domain"
FT                   /note="PFAM: molybdopterin binding domain; KEGG:
FT                   xau:Xaut_3541 molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28796"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZP0"
FT                   /protein_id="ABY28796.1"
FT                   /translation="MPQSSDVTAAILVIGDEILSGRTKDKNIGTIAEVLTEIGVDLREV
FT                   RIVPDVKDEIVAAVNALRARYTYVFTSGGIGPTHDDITADSVAEAFGVGIDVDPRARAM
FT                   LLERHRPEDLNAARLRMARIPDGADLIANPVSKAPGFRLGNVFVMAGVPQIMAAMLDEI
FT                   RPTLTGNAPVISETIEAGAIPEGNFAGGLSDIAAAHGDVSIGSYPSMTPEGFRNRIVVR
FT                   GRDANAVAAARAAVESLLAGLRP"
FT   gene            417984..418730
FT                   /locus_tag="Mext_0375"
FT   CDS_pept        417984..418730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0375"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="PFAM: sugar fermentation stimulation protein; KEGG:
FT                   xau:Xaut_3100 sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28797"
FT                   /db_xref="GOA:A9VZP1"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9VZP1"
FT                   /protein_id="ABY28797.1"
FT                   /translation="MRFPTPLIEGRLVRRYKRFLADVTLADGTMVTAHCANPGAMLGLN
FT                   AEGFRVLLSPSTNPSRKLGYSWELVEAELPGGLQWVGINTARPNALVAEAFRENKLTPL
FT                   IGYETLRPEVAYGKASRVDFLTSGGGLAPCHVEVKNCHLMRQAGLAEFPDCKAARSARH
FT                   MEELAGVVTAGGRAMLIVVIQMRAGAFDVARDIDPVFDRALRMALEVGVEAYAYTCAVG
FT                   PEGVAIDTPVPILTPGATLQPARTSG"
FT   gene            complement(418687..419667)
FT                   /locus_tag="Mext_0376"
FT   CDS_pept        complement(418687..419667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0376"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   bbt:BBta_0234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28798"
FT                   /db_xref="GOA:A9VZP2"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZP2"
FT                   /protein_id="ABY28798.1"
FT                   /translation="MSSCAGAPLSKAAMVLRATTDGVWRVALDGARLAAAAPGWHHPGT
FT                   MTDTSPYGTYAPTGLVARIAERTQKLPEHSWRARRMAMFLRRLAISMMRGRPLDVERYG
FT                   ARMRLHPYNNNCEKKVLFTPQFFDPQERAFLKERLRDDAVFLDIGANIGAYALFVAGFT
FT                   GRRARILAVEPQPDVFDRLTFNIGQNPFGTVKAIACAVADKSGELTLFIDPRNRGESSV
FT                   KIVGTHKNATVRVPAVTLVELCRSEGIERIDAIKLDVEGAEDLILEPFLRDAPASLLPS
FT                   VLVIENGADQWQIDLPNLLNKYGYRQIARTRLNLMFERVEASRPA"
FT   gene            419672..420448
FT                   /locus_tag="Mext_0377"
FT   CDS_pept        419672..420448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0377"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: xau:Xaut_3209
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28799"
FT                   /db_xref="GOA:A9VZP3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZP3"
FT                   /protein_id="ABY28799.1"
FT                   /translation="MQSFDSDGVQIAYIDVPAKEGASGGSGDPVLLIHGFASNHAVNWV
FT                   NTLWVRTLTEAGYRVIAPDNRGHGQSEKLYDPSSYTSDQMAGDAVRLLRHLGIERADVM
FT                   GYSMGARIAAHMALDYPAEVRSLLIGGLGFNLVDGRGLPQGIAEALEAPAGAPAPNPTA
FT                   ASFRTFAEQTKSDLRALAACIRASRQTLSRAELSAIETPTLVSVGTLDTVAGSGPELAK
FT                   LLPNARALDLPNRDHSTAVGDRLHRKGVLEFLEQRP"
FT   gene            420587..421051
FT                   /locus_tag="Mext_0378"
FT   CDS_pept        420587..421051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28800"
FT                   /db_xref="GOA:A9VZP4"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZP4"
FT                   /protein_id="ABY28800.1"
FT                   /translation="MPGRTSQTATDGVLRSVAANALASALIVFAILLLVFGGTALARPK
FT                   LTYAAGKVVGLSNLSTDEGCLPANLAGRLVKRAFGRDGLYLESVIVEERSGQRTFINVE
FT                   DGYRNLDAATNGTVKHSLETLLNVGKSVSLRVLGCGAAARTLTLDAVRPL"
FT   sig_peptide     420587..420715
FT                   /locus_tag="Mext_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.954 at
FT                   residue 43"
FT   gene            complement(421076..421855)
FT                   /locus_tag="Mext_0379"
FT   CDS_pept        complement(421076..421855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0379"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mpt:Mpe_A0977
FT                   ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28801"
FT                   /db_xref="GOA:A9VZP5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZP5"
FT                   /protein_id="ABY28801.1"
FT                   /translation="MMGVSMLNVPAVLAIYRFEMARFWRTALQSIVAPVISTSLYFVVF
FT                   GAAIGSRMQTVDGVPYGAFIVPGLIMLSLLTQSVSNAAFGIYFPRFAGTIYELLSAPIS
FT                   PFEVVLGYVGAAATKSIIIGLIILATASLFVPLHIEHPFWMVFFLLLTALTFSLFGFVI
FT                   GLWADGFEKLQLVPLLIVTPLTFLGGSFYSIDMLPPFWRAVTLFNPVVYLVSGFRWAFF
FT                   GKGDVAVGVSIAATLAFLALCLGLVTYIFRTGYRLKS"
FT   gene            complement(421852..422778)
FT                   /locus_tag="Mext_0380"
FT   CDS_pept        complement(421852..422778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0380"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:blr6579 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28802"
FT                   /db_xref="GOA:A9VZP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZP6"
FT                   /protein_id="ABY28802.1"
FT                   /translation="MPPIVSIANLSKVYASGLHALRDVNLDIAKGEIFALLGPNGAGKS
FT                   TLINIVCGIVTPSMGEIRVGGHDILSEYRAARRMIGLVPQELTTDAFEKVWDTVSFSRG
FT                   LFGLPKNPAHIERVLKDLSLYDKRESRIMQLSGGMKRRVLIAKALAHEPQVLFLDEPTA
FT                   GVDVELRQDMWRLVRRLREQGVTVILTTHYIEEAEEMADRVGVIRKGEIILVEDKVELM
FT                   RKLGKKQLILHLRAPVTTLPENLARHDLHLGEDGRSLVYTYDTRRERTGITGLLRELAD
FT                   AGIAFTDLDTSQSSLEDIFVDLVRERA"
FT   gene            complement(422995..425034)
FT                   /locus_tag="Mext_0381"
FT   CDS_pept        complement(422995..425034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0381"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mes:Meso_2441 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28803"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZP7"
FT                   /protein_id="ABY28803.1"
FT                   /translation="MSDRLVFACSCEKTMPLDVAALEKGCGTRVRTADQLCGRELDRYR
FT                   EALASGLPVTVSCTLQAPLFEEIALEMEAEERVTFAKIRETAGWSSQAERAGPKMAALL
FT                   AAAAEAVPVAGTVPLESRGVTLIYGRDEIAIEAGRRLAEHLDVTVLLSRPGEVAPLHRN
FT                   EFPVIRGTVRGATGHLGAFDLRIDDYALPAPSSRTHLVFGSGRDGAVSTCDLILDLTGG
FT                   TPLFPAHELRSGYLRADPRDPAAVERAVMAASHLVGEFDKTRFIDFRGELCAHSRSRIT
FT                   GCTRCLDVCPTGAIAPAGDTVAIDPYVCAGCGSCAAVCPTGAANYALPPADALMRRLRS
FT                   LMRAYRAAGGADAVVLFHDGDHGEPLIDALGRYGEGLPAHVLPVRVNEVTQFGPEVLAA
FT                   LFAYGAAGARVLVRERPKHDLDSLHRTVALGRTLADALGYGTGTEAPTVALIETDDPDA
FT                   LGAALHSDVPGRATTAPAGFVPVGGKREMLRLAFREMHAAAPTPVAAVPLAAGAPFGGL
FT                   QFRTEDCTLCLSCVGACPTHALSDSTDRPLLAFEESLCVQCGLCAATCPEDVISLKPQI
FT                   DFEAWGEPRRIVKEEEPFCCITCAKPFGTRATIERVIGKLRERHWMFSGEAGEQRIRSL
FT                   MMCDDCRVEAALTQGFDPHAVPPAKTRTTEDYLREREAAGRLPG"
FT   gene            425175..425933
FT                   /locus_tag="Mext_0382"
FT   CDS_pept        425175..425933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_5498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28804"
FT                   /db_xref="GOA:A9VZP8"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZP8"
FT                   /protein_id="ABY28804.1"
FT                   /translation="MTLPLDIGSPGLRLAPLVLPPAFTGLVAAGSAAGLACRMAESGEA
FT                   DAATLLIEERDDVIAFAVVLAPTEPLATARRAVFIGMQALADAVGAFGPPEIPVTFHWP
FT                   DTLSFNGARLGGGALHWPEGCDETETPDWLVFSAMLLASKRDAGDPGLTPDSTSLEEEG
FT                   FPNDLREVLVESFARHLTKAFEIWDEDGAARSTGRYLTRLALPPGVRATIDPSGDARLV
FT                   LADGQSETLPLRPALISPSWRDPATGTVRL"
FT   gene            425930..426496
FT                   /locus_tag="Mext_0383"
FT   CDS_pept        425930..426496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_2443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28805"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZP9"
FT                   /protein_id="ABY28805.1"
FT                   /translation="MSAGKLPRTLRLDPSDTFVFARAAEAGEWAVTGSFLFFDADLSAL
FT                   AGKERAAFRSGFVGVRSFGFSTLVVVSEASEAEREAAIEDLARHIHERFGAPDREAARA
FT                   AAREEIEVAASLCNLPVGSVVAMHRSAQDGEIAEEFRTLHQRAPGADPMHGRAFHFVET
FT                   DEDGPDEQADLVGLLSDASAGAERA"
FT   gene            426493..427503
FT                   /locus_tag="Mext_0384"
FT   CDS_pept        426493..427503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_2444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28806"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZQ0"
FT                   /protein_id="ABY28806.1"
FT                   /translation="MTEFWVSSGHHLTQRTEGGGLAVTDELILAYLARPELVPPEEACA
FT                   AERALHASLLSDPRRPVSSGELQQIADADARENWEVMLAFRERLLTARSVEAAYLALVR
FT                   GGLQGVPGLFLTQLVHLILRNALDGCEDPFVLRAAELFFRSQRASLHEGAVLLADSEVI
FT                   EAREGGAPLSPLVTMLGKEAASELDVLNEENAWTYWSRSDAFTMALNLGTSGRSREGLA
FT                   RAIEAFVRHLLNAEVTVKPLDRLEDPDWRWFVGLDAEGTRIGNALWRGEALDDAAREQV
FT                   IAVFSLTFADPARVDPRVGERPVYLLLAMSPDKTVQLKPQNLVVGLPLASDRAAA"
FT   gene            427512..428030
FT                   /locus_tag="Mext_0385"
FT   CDS_pept        427512..428030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0385"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="KEGG: mes:Meso_2445 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28807"
FT                   /db_xref="InterPro:IPR021736"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZQ1"
FT                   /protein_id="ABY28807.1"
FT                   /translation="MTPEQIPEDRFEVGIIVARRRLKGPWASHAWLPIEALPAAPETAP
FT                   WTQLSESEEEATFYAGAHEVTLHIGETAHYRDNLVSGRPSLWVTLHATSEETYTVASVT
FT                   ADPYEGESMAEGIGEIVEAVPMPPEVQAKLLAFFEAFHIERKFEKRKRDRADPEALARR
FT                   APGTQGKPE"
FT   gene            428027..428737
FT                   /locus_tag="Mext_0386"
FT   CDS_pept        428027..428737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_2446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28808"
FT                   /db_xref="InterPro:IPR021735"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZQ2"
FT                   /protein_id="ABY28808.1"
FT                   /translation="MSGSFLSRWARRKEAVRATERTVAPAVTDEVEAKAALDAEAHTGD
FT                   GSPAPQPVALTGDEPEAGTDDLLARLPSLDALTPETDLTAFLQSGVPTALRNAALRRMW
FT                   SLDPAIRDFVSEAREYAYDWNTPGGVPGMGPLLPTDDVKAMLKRIIDGVPFAAEEEPDT
FT                   EPQDAPTASSEEAAQIADAAPPASETDPETDGVPLPMPDLHAPVAVAAAESPEVVQSPL
FT                   PRPRLRRHGGAMPS"
FT   gene            428825..429460
FT                   /locus_tag="Mext_0387"
FT   CDS_pept        428825..429460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0387"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein;
FT                   KEGG: mes:Meso_2447 cytoplasmic chaperone TorD"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28809"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZQ3"
FT                   /protein_id="ABY28809.1"
FT                   /translation="MSSVASVMALPGDEVSGVVGVPDEIDLLRAQQYDLLAALLGRAPG
FT                   SSLLAALAAVKEGDGVLGRQVAALRRAAAETDTEAVEREFFALFIGVGRGELLPYASYY
FT                   LTGFLNERPLARVREDFAALGIERDESMSEPEDHLAILLEVMAGLAAGRFEAEPGMQAH
FT                   FFARHIEPWADRFFADLEKAKAGRFYRAVGGLGRAFIEIEAEAFAMEG"
FT   gene            429537..429782
FT                   /locus_tag="Mext_0388"
FT   CDS_pept        429537..429782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0388"
FT                   /product="formate dehydrogenase region TAT target"
FT                   /note="TIGRFAM: formate dehydrogenase region TAT target;
FT                   KEGG: mes:Meso_2448 twin-arginine translocation pathway
FT                   signal"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28810"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZQ4"
FT                   /protein_id="ABY28810.1"
FT                   /translation="MRQDPKTLGRRQFFRALGGSTVAAAAAVASPMGATEAQAYDPGND
FT                   ETKARYRESDHVKAFYRTNGYETLKKNTDPASTGPK"
FT   sig_peptide     429537..429656
FT                   /locus_tag="Mext_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.621 at
FT                   residue 40"
FT   gene            429790..432732
FT                   /locus_tag="Mext_0389"
FT   CDS_pept        429790..432732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0389"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: mes:Meso_2449 twin-arginine
FT                   translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28811"
FT                   /db_xref="GOA:A9VZQ5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZQ5"
FT                   /protein_id="ABY28811.1"
FT                   /translation="MLIKRKSGDAARTKHQAVAAGLAAGVLDRRAFLRKSGLTAGALAA
FT                   AGTIQLGSVRKAQAAGSSAVGPDTVIKKNVCTHCSVGCTVTAEVVNGVWVGQEPSYASP
FT                   INRGTHCAKGAAIRELVSSDRRLKYPMKLEGGQWKRISWDQAYEEIGDKLVQIREKNGA
FT                   DSVYWLGSAKFTNEASYLMRKFAALWGTNSIDHQARICHSTTVAGVANTWGYGAQTNSY
FT                   NDIRNAKTMIILGGNPAEAHPISMQHVLSGKEINRANMIVIDPRFTRTAAHATEYVRIR
FT                   SGTDIPVVWGILWHIFQNGWEDKEFIAQRVYAMDDVRKEVAKWTPDEVERVSGVPGEQL
FT                   KRVAEKFAKEKPATLIWCMGATQHTVGTANVRALCILCLATGNVGKPGTGANIFRGHTN
FT                   VQGATDLGLDVTSLPLYYGLVEGGWRHWARVWDVEYEWLQSRFDEVPAKGGRKARTRKE
FT                   NMEAPGITSTRWFDAVNLPPEQIDQRSPIKAFMVFGHGGNTVTRMPEAIDGMNKLELLV
FT                   VADPHPTTFAALDAREDNTYLLPICTSLEMDGSRTASNRSIQWGEQIVKPAFESKSDYE
FT                   VLYRLAQKLGFADKLCKNIKIVDGAPEAEDILREINRGGWSTGYCGQSPERLKAHMRNQ
FT                   HKFDLVTLRAPKDDPEVGGDYYGLPWPCWGKPELRHPGSAILYNTSLHVKDGGGGFRAR
FT                   FGTERNGQTLLAENSFSKGSDLTDGYPEFTFGVFKKLGWDKDLTPDELATILKIGGEKP
FT                   DTVSWATDLSGGIQRVCLDHGVSPFGNGKARANAWNLPDPVPVHREPVYSPRPELVAKY
FT                   PTRPDERQLRMPNIGFSVQKSVVDRGVAKDFPIILTSGRLVEYEGGGEETRSNPWLAEL
FT                   QQDMFVEINTGDAAARGIKDGQWVWVSGPENGAKTKVKALVTDRVGKGVAFMPFHFSGW
FT                   YQGKDMRDFYPKGTDPVVLGESVNTVTTYGFDPVTGMQETKCTLCQIAAA"
FT   gene            432750..433346
FT                   /locus_tag="Mext_0390"
FT   CDS_pept        432750..433346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0390"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bja:bll5476 formate dehydrogenase
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28812"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZQ6"
FT                   /protein_id="ABY28812.1"
FT                   /translation="MARMKFLCDADRCIECNACVTACKNEHEVPWGINRRRVVTLNDGK
FT                   PGERSVSMACMHCTDAPCAAVCPVNCFYTTADAVVLHSKDICIGCGYCFYACPFGAPQY
FT                   PRVGNFGSRGKMDKCTYCSGGPEPDFSTAEYEKYGSNRLAEGKLPLCAEMCSTKALLAG
FT                   DGEMIAEIYKQRVIKRGYGSGAWGWKTAYRETVAI"
FT   gene            433415..434452
FT                   /locus_tag="Mext_0391"
FT   CDS_pept        433415..434452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0391"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   mes:Meso_2451 formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28813"
FT                   /db_xref="GOA:A9VZQ7"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZQ7"
FT                   /protein_id="ABY28813.1"
FT                   /translation="MRRATTFLSTLLLAVMLLAVPGALSPAQAQNPIQADGQNPMGARP
FT                   TADSVNEEFLFKQESKIRGRVSIPDGKSANLIQPQGREYQNFRERWLPWIGALTILGML
FT                   AALGAFFLFRGRIMMEHSQESGKKILRFNAFERFTHWMTAVCFIILSLSGLNYIFGKRL
FT                   LMPLIGPEAFGAIAQWAKYSHVYLAWPFMLGVAFMFVLWIRDNIPNKVDWAWIKAGGGF
FT                   IGKGHPHAARFNAGQKGVFWMVAGFGAAMGVTGLMMLFPFALTDINGMQVMQVIHSVIG
FT                   IIFIAGILAHIYIGTLGMEGAYDAMGSGKVDLAWARAHHDLWVEQEQARTASGPQLKGH
FT                   PAPAE"
FT   sig_peptide     433415..433504
FT                   /locus_tag="Mext_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            434548..434787
FT                   /locus_tag="Mext_0392"
FT   CDS_pept        434548..434787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28814"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZQ8"
FT                   /protein_id="ABY28814.1"
FT                   /translation="MKAFLAAVIAAIALGVLAMFALTSNQKFAYQAFATSGARVSEPGT
FT                   NLVGPRWNGDPKPDEYNGEPHGKAEGEASHPKRS"
FT   sig_peptide     434548..434619
FT                   /locus_tag="Mext_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.797 at
FT                   residue 24"
FT   gene            434832..435449
FT                   /locus_tag="Mext_0393"
FT   CDS_pept        434832..435449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_5488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28815"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZQ9"
FT                   /protein_id="ABY28815.1"
FT                   /translation="MKPSPIIRHLAGGLAACALLAGTALAQDASPSAPATLQTSGKPAN
FT                   LCQELVAFVKQPEPANKAAATPPQQATAVSNPSGKTEGGKPADGGEPQKTSGLSGAVSE
FT                   TGNGPAPGAATNNPKPEAATGNPADNPNAKANALAKNPPPPAPPAPAPKPDPATIEKIE
FT                   AAAGANDLAACREAARSMRVAGVVMPPPLLALAALDLKFFQQ"
FT   sig_peptide     434832..434912
FT                   /locus_tag="Mext_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(435488..436081)
FT                   /locus_tag="Mext_0394"
FT   CDS_pept        complement(435488..436081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvy:VVA1400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28816"
FT                   /db_xref="GOA:A9VZR0"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZR0"
FT                   /protein_id="ABY28816.1"
FT                   /translation="MSPADLAPLAWNAAREHLDLFGGLGLCLGFAGGMMPRRSLILFTS
FT                   AACSACFALHFLRLGAQTGTAMCLVSVMQSVVAARWIGPESRAAWVAPLFLASSLVALG
FT                   LTLATWNGWPSACAGLGSLLATTARLQGNSQAMRRFFLGASSCWALHNMLVGSVFGLTC
FT                   DLLTLTALVIALVRGGAEKPVPVANPVAPLQGAA"
FT   gene            436711..437346
FT                   /locus_tag="Mext_0395"
FT   CDS_pept        436711..437346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0395"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: azo:azo0243
FT                   putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28817"
FT                   /db_xref="GOA:A9VZR1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZR1"
FT                   /protein_id="ABY28817.1"
FT                   /translation="MSAAAGAVIDARSGQAARREHILDAAEACFVRNGFHRTTMQDLAR
FT                   EASMSPGNIYRYFDSKEAVVLGLAERDRERGAVLVEAMERAGDKRAVLMGVLARFFLEI
FT                   SREAAVLRLDLWVEATRNPAIADLVERGDEEGRVWLTEMFDALKTSPDCDPAALFDAIA
FT                   PLMKGMIVSRALSPGYDARPAVAQLQSLIEAGLSGALALPPADKEAGR"
FT   gene            437343..438584
FT                   /locus_tag="Mext_0396"
FT   CDS_pept        437343..438584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0396"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   xau:Xaut_1149 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28818"
FT                   /db_xref="GOA:A9VZR2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZR2"
FT                   /protein_id="ABY28818.1"
FT                   /translation="MIRARTLAVPALVLTVLSFGPAWAETAPPPAKTAPAATVSVVEAE
FT                   RREIVESVVVTGTLVPRDEILVTPEIDGYRLVELLTEEGMRVEKGQVLARLNRDLIDRQ
FT                   LTQQNALIDKVSAAVLQAQSNIGQAEAAELEARLAHDRAKQLIQTGITTAAVMENRTAA
FT                   LRQAEGKLAFARNGLAMAKAELAQAKAVRDELELRLARTEIRAPEAGIVSRRTARVGMA
FT                   TSASAEPLFRLIARGEIELEAEVIETKLPLLREGAPAFIEIGEGERVMGSVRAVYPEVD
FT                   KASRLGKVRVRLDPDPRLRIGTFARGAVELARTRGVTVPQASVLYGGGKRSSVLVVAED
FT                   KVESREVRTGLSDDDDIEIRSGLAEGERVVARAGSFLRDGDRVRPVPLARQGQTPAAVS
FT                   AAPSPQATADAGSR"
FT   sig_peptide     437343..437417
FT                   /locus_tag="Mext_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            438633..441728
FT                   /locus_tag="Mext_0397"
FT   CDS_pept        438633..441728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0397"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   xau:Xaut_1148 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28819"
FT                   /db_xref="GOA:A9VZR3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZR3"
FT                   /protein_id="ABY28819.1"
FT                   /translation="MRLNISAWAIRNPIAPLVLFLVLVVLGLVSFRGLAVTRMPNVDVP
FT                   IVSVTITQGGAAPSELQTQVTKWVEDSIAGVRGVKHITSAITEGASVTTVEFRLEVNTD
FT                   RAVNDVKDAISKIRINLPRTIDEPVIQRVEITGLPILIYGVTSPAMTPADLSWFVEDKV
FT                   ARTLQGVKGVGGVERVGGVAREIRITPLPDRLLALGITAADVNKQVRVTSADLAGGRGE
FT                   VGGREQSIRTLAASRTIRDLKATSIVLPGGRKVRLDDLATVEDSIEEPRTFARFNGESV
FT                   VAFSVSRGSGASDAEVAAGVEKKIAEFAQGYPDIQFQEIDSSVAATRGSYASAMHTLME
FT                   GAALAVIVVFLFLRDWRATLIAAVALPLSVLPTFWAMDALGFTLNGISLLAITLVTGIL
FT                   VDDAIVEIENVVRHMRMGKSPYRASIEGADEIGLAVIAITATLIAVFAPVSFMGGIAGR
FT                   YFIQFGLTIAVSVFMSLLVARLITPLLAAYFLRDHGHAEEREGPVMRAYTRLVGWSVRH
FT                   KWITLMVGLALFAGSIVSTKLLPSGFIPKQDNARTLFMIELAPGARLPDTIAVADRVVE
FT                   RIRALPEVTSVFVDGGRQAGGKKETRLATLIVNLSPKSERVKRQWTIESEIAGLLAQEP
FT                   DIRSWTLRDSGQRDLALVVSGPDVDVVTEVAARLQRDMAAIPHLVSVMSTAPLNRTEVR
FT                   IRPKPGAAADLGVATDVIAETVRVGTIGDIGINLAKFNAADRQVPIRVQLPESARGAIA
FT                   RLENLKVPAKNGTAVPLAAVADIELDQGPGAIERYDRAVRVAVEANMEGSDALGSLIEQ
FT                   ALATPTAKSLPPGVTIRQTGDAEIMQEVFSGFLMAMGAGIMMVYAVLVLLFGSFLQPLT
FT                   ILFSLPLSIGGAILGLLICHMPISMPVVIGLLMLMGLVTKNAIMLVDFAVEEMARGVDR
FT                   VTAIVDAGRKRARPIVMTTIAMAAGMVPSAMALGIGGEFRAPMAVAVIAGLIVSTLLSL
FT                   VFVPAVFLLMDSLGGLIGRGLGRFVGPRDETEDAPAPAARHG"
FT   sig_peptide     438633..438740
FT                   /locus_tag="Mext_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.935 at
FT                   residue 36"
FT   gene            complement(441873..442832)
FT                   /locus_tag="Mext_0398"
FT   CDS_pept        complement(441873..442832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0398"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: atc:AGR_C_3767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28820"
FT                   /db_xref="GOA:A9VZR4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZR4"
FT                   /protein_id="ABY28820.1"
FT                   /translation="MPTVVNRTMSPFEWSMLLGLSVLWGGSFFFAGVALSALPPLTLVV
FT                   LRVGLAALILNAALPLAGFRLPRGREVWAAFFGMGLLNNVVPFCLIVWGQTQIASGLAA
FT                   ILNATTPLFTVVVAHLLTADERMTGNRLAGALIGLLGVAVMIGTAAFADHRSPLLAQLA
FT                   VLGAALSYALAGVFGRRFQRMGVPPLATATGQVTASTLLLLPAALLTDRPWTLPMPGAA
FT                   VWGAVIGIAALSTALAYLLYFRLLATAGATNLLLVTFLIPVTAILLGTGVLGESLEVRQ
FT                   IVGMALIGVGLAAIDGRILKRVRRRRIEEPRFYQGRDI"
FT   sig_peptide     complement(442722..442832)
FT                   /locus_tag="Mext_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 37"
FT   gene            complement(443063..444154)
FT                   /locus_tag="Mext_0399"
FT   CDS_pept        complement(443063..444154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0399"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: xau:Xaut_2534 heat-inducible transcription
FT                   repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28821"
FT                   /db_xref="GOA:A9VZR5"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZR5"
FT                   /protein_id="ABY28821.1"
FT                   /translation="MIEAVQPIVNPQPQALAALNERSREIFRQIVESYVTTGEPVGSRN
FT                   LARILPMSLSPASIRNVMADLEHSGLIFAPHTSSGRLPTELGLRFFVDAMMEIGDVDLA
FT                   EKARIEAQMQAAASRHTFDSALAEASSLLSGISRGAGVVLTTKVDAGLKHVEFVRLDPE
FT                   RALVVLVSIDGTVENRLVDLPPGLPAGALQEASNFLNARLRGRTLDTLRADIENGRKEM
FT                   KRELDALTERLVDAGLATTVGPSEARQLIVRGQANLLDDLRAAEDLERIRLLFNDLETQ
FT                   KDVIELLARAEQGDGVRIFIGSENKLFSLSGSSMIAAPFRDSAQKIVGVVGVIGPTRLN
FT                   YSRIVPMVDYTARVVSGLLDRSR"
FT   gene            444408..444695
FT                   /locus_tag="Mext_0400"
FT   CDS_pept        444408..444695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpb:RPB_0345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28822"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZR6"
FT                   /protein_id="ABY28822.1"
FT                   /translation="MLTGTRKTMVKVAALAIAVTGLSLASAPRAAQAAPLPIQTEATAP
FT                   AGDMIEQAQYRGHRRHYRGHMRHRGHWHRHHRFGGPRHHHHRRHWNHRRW"
FT   sig_peptide     444408..444509
FT                   /locus_tag="Mext_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 34"
FT   gene            444860..445573
FT                   /locus_tag="Mext_0401"
FT   CDS_pept        444860..445573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0401"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: xau:Xaut_2535 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28823"
FT                   /db_xref="GOA:A9VZR7"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9VZR7"
FT                   /protein_id="ABY28823.1"
FT                   /translation="MRPSKRAADAMRDVTLERAVARYAEGSCLVTFGNTRVLCTASLEE
FT                   RGPPWLRGSGKGWVTAEYAMLPRATHERTRREVNSGKPSGRTQEIQRLIGRSLRAVTNL
FT                   PALGERQITVDCDVIQADGGTRTASITGAWVALHDCFAWMRARSIISVDPLKDHVAAVS
FT                   CGIYKGQPVLDLDYAEDSAAETDANFVVTGKGGIVEVQGTAEMEPFTDEQFLELLRLAK
FT                   GGVAGLVELQRKAIA"
FT   gene            445570..446205
FT                   /locus_tag="Mext_0402"
FT   CDS_pept        445570..446205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0402"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   bbt:BBta_0185 putative HAM1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28824"
FT                   /db_xref="GOA:A9VZR8"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZR8"
FT                   /protein_id="ABY28824.1"
FT                   /translation="MSAHRILSGKVVIATHNAGKLVEMRELLAPFGVEAVSAGELGLPE
FT                   PDETGTMFSENAAIKAHAAAKASGLPAFADDSGLCVDALDGAPGLFSARWAGPDKDFSG
FT                   AMARIAAELDKRGATDRRAHFVSALVLAWPDGHTELFEGRVFGDLVAPLGSLGFGYDPM
FT                   FRPEGMDRTFGEISSEEKHGVDWQSGNALSHRARAFVLLAQACLRRPG"
FT   gene            446416..447633
FT                   /locus_tag="Mext_0403"
FT   CDS_pept        446416..447633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0403"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: nha:Nham_0149 putative oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28825"
FT                   /db_xref="GOA:A9VZR9"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZR9"
FT                   /protein_id="ABY28825.1"
FT                   /translation="MRGSSGSMTQDRPMPPATPPDHPTRDAGFGIYLHWPFCAAKCPYC
FT                   DFNSHVRHAGVDQPRFLAAFRREIAHAAALAPGRTVTSIFLGGGTPSLMAPDTVAGLLD
FT                   AVAGAWSVAPDAEVTLEANPTSVEATRFRGYRAAGVNRVSLGVQALDDGDLKRLGRLHS
FT                   VAEALDAVRTASAHFERFSFDLIYARPEQTPEAWAAELRRAIDYAAEHLSLYQLTIEPG
FT                   TPFFGLAQAGRLVPPDDDASRALYDVTQEICGLAGLPAYEISNHARPGAQSRHNLLYWR
FT                   YGEYAGIGPGAHGRLVLPQGRTGTLTEKAPEEWRARVERDGHGIVETETLSAEDQGDEF
FT                   LMMGLRLTEGIDPARYATLKGRPLHAGRLDALVRDGLVARRPDGRIAATARGAPVLNAV
FT                   VAELAG"
FT   gene            complement(447638..448849)
FT                   /locus_tag="Mext_0404"
FT   CDS_pept        complement(447638..448849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0404"
FT                   /product="extracellular ligand-binding receptor"
FT                   /note="KEGG: rpc:RPC_0322 extracellular ligand-binding
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28826"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZS0"
FT                   /protein_id="ABY28826.1"
FT                   /translation="MARRGGRWTARAGAALLGLGLTIGLAGCLGVPDAPRPAARAVPEG
FT                   EPSPTMTAGNVIGAGTVKVALIVPLSGQGAAVGAALRNAAELAYDDFQKPNLQILVKDD
FT                   RGTPEGAREATQAAFAEGAEMVLGPLFAANVQVAGGVARGAGKPVIAFSTDAAVAARGV
FT                   YLISFLPQSEVDRIVDEASAGGRRSFAALIPETVYGNAVEAQFREAVARRGARLVGIER
FT                   YPAGNPGPAVDRLRGVIAGGGAQADALFVPDTAEGLMAVAPALTKVGFSPARVRPLGLA
FT                   LWNDPRVLSQAAFQGGRFAAPDAAGFAGFAQRYQTRFGTMPPRTASLGYDAVSLTAALV
FT                   RQYGSQRFADATLTNPAGFSGLDGTFRFLPEGVSERTLAVYEIRNNAANVVSPAPKVLA
FT                   PSGI"
FT   sig_peptide     complement(448757..448849)
FT                   /locus_tag="Mext_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.589 at
FT                   residue 31"
FT   gene            448970..449920
FT                   /locus_tag="Mext_0405"
FT   CDS_pept        448970..449920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0405"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: xau:Xaut_0340
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28827"
FT                   /db_xref="GOA:A9VZS1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZS1"
FT                   /protein_id="ABY28827.1"
FT                   /translation="MTQRLDKRPEGAPRSPATFTAFGLAAEAESLAPGLYVVATPIGNL
FT                   RDVSFRALATLAAADAVLAEDTRVTRTLLMHYGITTPLLSYHEHSNEAVRERMVMRLKA
FT                   GETLALVSDAGTPLVSDPGFKLVQAAIAAGIPVTPIPGPSAVMTAIVAAGLPTDRFFFE
FT                   GFLPQKSGARRNRLEALATIPGTLVVFESPHRLPEMLADAAATLGPERPAAVARELTKL
FT                   FETIRRDSLGALAEAFAREGPPKGEVVVVIGTAPEDAAPREADTGLDARIEAALARHSI
FT                   KDAAALVADETGQPKRVVYARALVLARRSDDETSG"
FT   gene            449904..450290
FT                   /locus_tag="Mext_0406"
FT   CDS_pept        449904..450290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0406"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   rpd:RPD_0400 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28828"
FT                   /db_xref="GOA:A9VZS2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9VZS2"
FT                   /protein_id="ABY28828.1"
FT                   /translation="MRPPADPGARRRATHGRGLSAEGLALLVLMLKGYRPLARRFAAAG
FT                   GEIDLIVRRGRTIAFVEVKARATLDAAATAIDARKRARVSRAARAWLARHPLAAGATLR
FT                   ADAVFVAPRRWPRHLPNAFEIEGL"
FT   gene            complement(450320..450712)
FT                   /locus_tag="Mext_0407"
FT   CDS_pept        complement(450320..450712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0407"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; KEGG: ccr:CC_3015
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28829"
FT                   /db_xref="GOA:A9VZS3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZS3"
FT                   /protein_id="ABY28829.1"
FT                   /translation="MSVDSNEDRLSGARVLVVEDEAAISMLLEDMLLDFGCEIVGPAAR
FT                   LATALEMARSESFTVAILDVNVAGEPIYPVAEAIAERNLPIVFSTGYGGAGIREPFRDR
FT                   LVVQKPFSQADLKRTLAAAIAAAAEG"
FT   gene            450912..451916
FT                   /locus_tag="Mext_0408"
FT   CDS_pept        450912..451916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0408"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: pmy:Pmen_3115
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28830"
FT                   /db_xref="GOA:A9VZS4"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZS4"
FT                   /protein_id="ABY28830.1"
FT                   /translation="MLIGPMLFRKTFHPHCRNMATAPARGEARSTMSRRGLLAAAVAAM
FT                   LPIRARAEPGRPIVISSKSDTEGALLGNLISFVLEDLGLRVERRLGLGPTLIVRSALLA
FT                   GEIDLYPEYTGNVAFFSGTETDPAWKNSAGAYGLALRLDAAHGLVWLGQAPANNTWLIA
FT                   VQGHLARERGLATMADFAGAVRDGVIRLAASTEFVESPAALPSFESAYGFSLPLSRIVS
FT                   LPGGDTAVTARAAAEGISGINAGMVYGTDGALAALDLAVMSDPKGAQIVYEPAPVIRAA
FT                   TLERHPRIREALDPIFARLDADTLRRLNAAITVEGRTAEAVAKAWLAEAASRP"
FT   sig_peptide     450912..451070
FT                   /locus_tag="Mext_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.632) with cleavage site probability 0.585 at
FT                   residue 53"
FT   gene            451913..453055
FT                   /locus_tag="Mext_0409"
FT   CDS_pept        451913..453055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0409"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rru:Rru_A2384
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28831"
FT                   /db_xref="GOA:A9VZS5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZS5"
FT                   /protein_id="ABY28831.1"
FT                   /translation="MTARLLTGLAAAALLPAVFAGLPLLQLAPNRLVTGAPIAASDALG
FT                   TGLWPIAVLAAGGLGLLAAGRGRMAASFAGLACLGALALLLAGLGAGAADLTAGRPFAT
FT                   RARLASGAWTGVVVLACALAFAARRARLPGGGLIAAAAILALIGGLWRAGRLDALSLVV
FT                   EARARSDALGGAIRDHLVLALGALVLAAGLTGGLALWRRGRGTVDLTVSGLQVVPAVAL
FT                   LGGLVAGLSALLTAAPALRGYGISALGIGPALIGVAAYLLLPLWRGLQAARRATGPDNV
FT                   AAARALGLTSGQILTTLRLPLGTPALIGGLRVATVQALGLATLGALVGAGGLGTLVFDG
FT                   MAQFAPDLILLGALPIIALSLAAEGALGRLEAALRRRWPR"
FT   sig_peptide     451913..451975
FT                   /locus_tag="Mext_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 21"
FT   gene            453052..453780
FT                   /locus_tag="Mext_0410"
FT   CDS_pept        453052..453780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0410"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: esa:ESA_01111 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28832"
FT                   /db_xref="GOA:A9VZS6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZS6"
FT                   /protein_id="ABY28832.1"
FT                   /translation="MNRVSEALGPLALGLALAGASHPAFAGLIGASGRPLTVGHMAELA
FT                   LNHLTLAATGLTLVAALGIGLGLIATRARFAGFRTSIDTLAAFAQAVPPVVVVALALPV
FT                   LGFGGPPTLLALTAYGIMPTLRGTVGALDAVTAEARESALAIGLTPAQILMHIELPLAA
FT                   AGLVDTLRTALILAASVTAVGALAGASTLGTPIVAGLQNQNIAAMLQGALATAALAFLG
FT                   DALLLAIGARLRPPEGRTAG"
FT   sig_peptide     453052..453132
FT                   /locus_tag="Mext_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(453787..454896)
FT                   /locus_tag="Mext_0411"
FT   CDS_pept        complement(453787..454896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0411"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   ErfK/YbiS/YcfS/YnhG family protein; KEGG: rpc:RPC_1255
FT                   ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28833"
FT                   /db_xref="GOA:A9VZS7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZS7"
FT                   /protein_id="ABY28833.1"
FT                   /translation="MERAWMRGALAALSVWSAAAQAAESGAPDLTREAIENAAFRESPE
FT                   ETKPDKSSKPGKRSKKEAEAKKEADAKKDAEKKPDPLLVKVQVLLDRARFSPGAIDGRD
FT                   GENLRGALKAFAAAQGLPEGDRLTREVFDRLQATGKEPVVTQYTITEEDVKGPFVEKMP
FT                   AKMEEQAEVGPMRYTNAREMLAERFHMQRDLFSALNPNVPLDKAGGTLVVAAVPPLGEG
FT                   KVEGAPVAPKVTRIEVDKRTKRVRAFAEDGKLTADYPASIGSSEKPAPDGSAKVKAVAF
FT                   DPWYTYNPKYQFKGVKATKKFSIHPGPNSPVGVVWIDLSIPSYGIHGTPEPEKVGKTES
FT                   HGCIRLTNWDARDLASHTKKGAKVEFLDK"
FT   sig_peptide     complement(454828..454896)
FT                   /locus_tag="Mext_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(455003..455920)
FT                   /locus_tag="Mext_0412"
FT   CDS_pept        complement(455003..455920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0412"
FT                   /product="Extensin family protein"
FT                   /note="PFAM: Extensin family protein; KEGG: atc:AGR_C_4159
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28834"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZS8"
FT                   /protein_id="ABY28834.1"
FT                   /translation="MKPSTLASLLACLLAAGLALPPDPAWSDPAKPPPATVPLPPPQPP
FT                   ARPDDLVPPAPQVTPLPPERPPELATGPDKGAVAKPDEPPKETKTTNDTKDAPAALPEA
FT                   PLPPARPPELSGESALALKVSAPDDTACLRRLERLGARFEAASPLGNGQCSAPHPLTVT
FT                   ALADGVTLEPAATLNCRAAEALARWTTEVQVAAQKEFGESLKSLALGGTYVCRGQNHDT
FT                   DAKLSEHSFANAIDVMVYGFTKRASLKVTAAPDGTPEAAFLASARMGACTFFRTVLGPG
FT                   SDAAHGNHLHLDLRERNAGHRLCQ"
FT   sig_peptide     complement(455837..455920)
FT                   /locus_tag="Mext_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.776 at
FT                   residue 28"
FT   gene            456119..458218
FT                   /locus_tag="Mext_0413"
FT   CDS_pept        456119..458218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0413"
FT                   /product="Peptidyl-dipeptidase Dcp"
FT                   /EC_number="3.4.15.5"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: rpa:RPA0872 putative peptidyl-dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28835"
FT                   /db_xref="GOA:A9VZS9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZS9"
FT                   /protein_id="ABY28835.1"
FT                   /translation="MTADTARDLPEGTEPGRGGVKANPFDVSDWATPFGLPDFEAIRPE
FT                   HYVPAFAHALKAHEAEIAAIVGNEAAPTFANTVAAMERAGAALDRVANVFFNLTGSNTS
FT                   PELQAIERAVAPQLARHSSAITLNPELWARLSAIDAEAEGLGAEERRVLDRYRSRFRRA
FT                   GAGLAPEAKTRIAEIAVRLAELGTQFSQNVLADERDFVLPLNGEADLAGLPPFLRDAAA
FT                   EAAKERGGGQSHVITLSRSLIEPFLVFSTRRDLRALAYAAWTRRGENGGETDNRAIIAE
FT                   IVRLRAERARLLGFDSFAHLKLDDTMAGSPDAAMELLRNVWKPALQRAATEREGLQALV
FT                   RAEGHDFALEAHDWRHYSEKLRRAEHDLDESEIKPYLPLEGMIRAAFDTASRLFGLAFE
FT                   ELRDVPRYHPDVRTWLVRDADGSQVGLFLGDYFARPSKRSGAWMSAFRSQERLNGDIRP
FT                   IIVNVMNFARAPRGEPTLLSFDDARTLFHEFGHALHGLLSDVTYPLLSGTAVSRDFVEL
FT                   PSQLYEHWLQQPEVLRAHARHVTTGEPMPDALLERLLAAANFNQGFATIEYAASAIVDM
FT                   TLHLSAAGEDGLDVVAFEADALRRIAMPAEIAARHRAPHFAHIFSGDGYAAGYYSYLWS
FT                   EVLDADAFDAFREAGDIFHPETAQRLRRMIYGAGNLRDAREAYTAFRGRLPSIEPLLKK
FT                   RGLAA"
FT   gene            complement(458330..460003)
FT                   /locus_tag="Mext_0414"
FT   CDS_pept        complement(458330..460003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0414"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: formate-tetrahydrofolate ligase FTHFS; KEGG:
FT                   gbe:GbCGDNIH1_0047 formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28836"
FT                   /db_xref="GOA:A9VZT0"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9VZT0"
FT                   /protein_id="ABY28836.1"
FT                   /translation="MPSDIEIARAATLKPIAQVAEKLGIPDEALHNYGKHIAKIDHDFI
FT                   ASLEGKPEGKLVLVTAISPTPAGEGKTTTTVGLGDALNRIGKRAVMCLREPSLGPCFGM
FT                   KGGAAGGGKAQVVPMEQINLHFTGDFHAITSAHSLAAALIDNHIYWANELNIDVRRIHW
FT                   RRVVDMNDRALRAINQSLGGVANGFPREDGFDITVASEVMAVFCLAKNLADLEERLGRI
FT                   VIAETRDRKPVTLADVKATGAMTVLLKDALQPNLVQTLEGNPALIHGGPFANIAHGCNS
FT                   VIATRTGLRLADYTVTEAGFGADLGAEKFIDIKCRQTGLKPSAVVIVATIRALKMHGGV
FT                   NKKDLQAENLDALEKGFANLERHVNNVRSFGLPVVVGVNHFFQDTDAEHARLKELCRDR
FT                   LQVEAITCKHWAEGGAGAEALAQAVVKLAEGEQKPLTFAYETETKITDKIKAIATKLYG
FT                   AADIQIESKAATKLAGFEKDGYGKLPVCMAKTQYSFSTDPTLMGAPSGHLVSVRDVRLS
FT                   AGAGFVVVICGEIMTMPGLPKVPAADTIRLDANGQIDGLF"
FT   gene            complement(460242..460463)
FT                   /locus_tag="Mext_0415"
FT   CDS_pept        complement(460242..460463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0415"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: vei:Veis_1021 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28837"
FT                   /db_xref="GOA:A9VZT1"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZT1"
FT                   /protein_id="ABY28837.1"
FT                   /translation="MDQSPIELTMRVDGMTCEGCAEAVRRTIRRLDPQADVSVDVGLGR
FT                   VSATTVAQSLDVAQALTQAGYTATAMTG"
FT   gene            460699..462228
FT                   /locus_tag="Mext_0416"
FT   CDS_pept        460699..462228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0416"
FT                   /product="EAL domain protein"
FT                   /note="PFAM: EAL domain protein; KEGG: bja:blr7477
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28838"
FT                   /db_xref="GOA:A9VZT2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZT2"
FT                   /protein_id="ABY28838.1"
FT                   /translation="MNEKPGRGRQTETRRSTVKTPKARTIRPRGTPWILGLIGVLVLVP
FT                   LALILPLAAVAAVSGLAIVGGALLWRRLSAFAVAQEVVSKEIGVLSQRLVKLEAVTAAL
FT                   IQSRMQDSATADGSARPPDEAVKALDARFNAGIEEVTAEIGILSGIVRELAAVVASQDG
FT                   DIARLRVLAQAPQPKPVPQAAPEPIRPRPAPAAPPPPETEPVAPPMRLVPRTTLPAARP
FT                   SDHFATDADAALLIEAFDGEGLEVFLQPVVTLPQRKVVAYEALARLKVGDAVYAPETFL
FT                   PVLERHGRTTALDRRMLQRVATIARHLQGRGSPASVSYSLTPHSLFEPGFLRSLGRLVS
FT                   EGPELAGRVVIALPQSSWRSLDAEQAALLAGLRGRIGFVMDRPIDLRFDPTALAERGIT
FT                   QVKVAAALLLRPLDREARPDVALEDLVTSLARAGIRLVATGVEAETEVPDLIDLDVPLA
FT                   QGGVFAAPRAVRSEVLSASPEAAPPPPPSPDPPPSPPPQRRPFRDFLRRAG"
FT   sig_peptide     460699..460869
FT                   /locus_tag="Mext_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.971 at
FT                   residue 57"
FT   gene            complement(462263..462490)
FT                   /locus_tag="Mext_0417"
FT   CDS_pept        complement(462263..462490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28839"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZT3"
FT                   /protein_id="ABY28839.1"
FT                   /translation="MANSDLLPDRASGDALDRARAQGQMHHSIATTLLVIAAARAERAA
FT                   PPVHAARQRLAKIYGASRLRKRMERDAARG"
FT   gene            complement(462661..463197)
FT                   /locus_tag="Mext_0418"
FT   CDS_pept        complement(462661..463197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0418"
FT                   /product="chemotaxis protein"
FT                   /note="KEGG: mmr:Mmar10_0609 chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28840"
FT                   /db_xref="GOA:A9VZT4"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZT4"
FT                   /protein_id="ABY28840.1"
FT                   /translation="MKMMATARDGRSQNSHPSAMVKELLDIADYIASLRDAIAILRANE
FT                   LTRDRLPMVHEELSEVVAATAGATNSIMSTAEAVLALRDGPGYRDAVEAKIYDIFEACT
FT                   FQDITGQRIAKVAEAMSQLEGRLARFTAAVKARDAAGIDETEADRRKRNESLLLNGPQM
FT                   GGPATAQDAIDALFA"
FT   gene            complement(463381..463764)
FT                   /locus_tag="Mext_0419"
FT   CDS_pept        complement(463381..463764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0419"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; KEGG: bja:bll7479
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28841"
FT                   /db_xref="GOA:A9VZT5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZT5"
FT                   /protein_id="ABY28841.1"
FT                   /translation="MALDLSMPILVVDDYQTMVRIIRNLLKQLGFEDVDDASDGTAALA
FT                   RLKGRKYGLVISDWNMEPMTGYELLRHVRADEGLRTTPFIMVTAESKTENVIAAKKAGV
FT                   NNYIVKPFNAATLKSKIEAVCGA"
FT   gene            464017..465084
FT                   /locus_tag="Mext_0420"
FT   CDS_pept        464017..465084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0420"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   FAD synthetase; Riboflavin kinase; KEGG: rpd:RPD_4040
FT                   riboflavin biosynthesis protein RibF"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28842"
FT                   /db_xref="GOA:A9VZT6"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZT6"
FT                   /protein_id="ABY28842.1"
FT                   /translation="MLPADNPLRLADIRSQEPMPSGDENAVPPAGTGLRPSSRPFTVCR
FT                   EDDPVPPALAGAVAALGNFDGVHRGHRTLIEAVRTEAGSHPAAVLTFEPHPRAFFAPDQ
FT                   PMFRLTGPSAKEIVFARLGLDGLIVRRFDERLAGTSARDFVEGWLRDGLGLSGVVIGHD
FT                   FHFGRGREGSPGTLAELCAEAGLSCRIVPAVSADPGDAPISSSAIRAALASGDVARAND
FT                   LLGYRWFVLAQVRHGDKRGRTLGYPTANLALESCGLAHGIYAVRVRLADGSLHDGVASY
FT                   GRRPTFDDGAPLLEVHLFDFKGDLYGQEVAVELLAYLRGEEKFSSAEALIAQMDVDSAR
FT                   AKAAIRTDRVPSMLG"
FT   gene            complement(465264..466268)
FT                   /locus_tag="Mext_0421"
FT   CDS_pept        complement(465264..466268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0421"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: xau:Xaut_4126 glyoxylate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28843"
FT                   /db_xref="GOA:A9VZT7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZT7"
FT                   /protein_id="ABY28843.1"
FT                   /translation="MSSLKRKPLVVVTRRLPDAVETRMRELFDTRLNHDDAPLSQEALS
FT                   AAIREADVLVPTVTDEIGAGLLAQAGPNLRLIANFGNGVDHIDVAGALERGITVTNTPG
FT                   VLTEDTADMTMALILAVARRLAEGARIIPDDDWTTGWSPTWMLGRRITGKRLGIVGMGR
FT                   IGQALARRAKAFGLSIHYHNRRRVPSHIEESLDATYWESLDQMLARVDIVSVNCPHTPA
FT                   TYHLLSARRLKLLKPEAIVVNTARGEVIDENALARLIEGGEISAAGLDVFEQEPAVSPR
FT                   LVRLARTGKVVLLPHMGSATHESRTDMGEKVIINIKTFMDGHRPPDRILPSML"
FT   gene            466595..467188
FT                   /locus_tag="Mext_0422"
FT   CDS_pept        466595..467188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0422"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; KEGG:
FT                   xau:Xaut_4125 protein of unknown function DUF1058"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28844"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZT8"
FT                   /protein_id="ABY28844.1"
FT                   /translation="MRPPELPPMNPARLALLAALFALLIPLTAEAAPAPAPEVGKGPVT
FT                   KLPLPRYASLKTNRVNLREGPSKDHRTLWVFQREGLPVEIVAEFETWRRIRDSEGTEGW
FT                   VLHSLLSGRRTAVVIPPSGERADSAKATVPLTARADEQSAEQARLQPGVIGSVKGCTGS
FT                   WCRLVVPLPDKRGDVDGYIRQSRLWGVYPDERVE"
FT   sig_peptide     466595..466690
FT                   /locus_tag="Mext_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            complement(467293..467793)
FT                   /locus_tag="Mext_0423"
FT   CDS_pept        complement(467293..467793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0423"
FT                   /product="ferric-uptake regulator"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: xau:Xaut_3845
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28845"
FT                   /db_xref="GOA:A9VZT9"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZT9"
FT                   /protein_id="ABY28845.1"
FT                   /translation="MSDLMPLQAVLNARSASPGDASGRRGCPLSDLRDRLRRAGLRPTR
FT                   QRLSLGWLLFGRGDRHLTAEMLYDEAMRAKVPVSLATVYNTLHQFTEAGLLRQLALDGS
FT                   KAYFDTNPTEHHHFFFEEEGEVLDMPECGISVDSLPDAPEGMEIAGVEVIVRLRRRKVS
FT                   GRA"
FT   gene            468070..468609
FT                   /locus_tag="Mext_0424"
FT   CDS_pept        468070..468609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0424"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.59"
FT                   /note="KEGG: xau:Xaut_0054
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA;
FT                   TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28846"
FT                   /db_xref="GOA:A9VZU0"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZU0"
FT                   /protein_id="ABY28846.1"
FT                   /translation="MASLDQQSDGASPQRASSFSYEDLLACGRGELFGAGNAQLPLPPM
FT                   LMFDRITSIGTEGGAHGKGHVLAEFDIRPDLWFFPCHFKDDPVMPGCLGLDALWQLVGF
FT                   HLGWLGALGRGRALGVGEVKFTDQVLPTVKQVVYGIDIKRVRQGKLVLGIADGWLEADG
FT                   RRIYEANDLRVALFRA"
FT   gene            468770..469996
FT                   /locus_tag="Mext_0425"
FT   CDS_pept        468770..469996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0425"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: xau:Xaut_0053
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28847"
FT                   /db_xref="GOA:A9VZU1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZU1"
FT                   /protein_id="ABY28847.1"
FT                   /translation="MRRVVISGMGIVSSIGNNTGEVLDSLREARSGIARSEAQAAHGFR
FT                   SQVAGAPTIDPEGVVDRRAMRFHGGGTAWNHIAMDQAIRDAGLEEREISNDRTGIIMGS
FT                   GGPSTRTIVESAAIAREKGPKRVGPFAVPKAMSSTASATLATWFKIRGVNYSISSACAT
FT                   SNHCIGNAAEIIRGGRQDIIFAGGCEELDWTLSVLFDAMGAMSSRYNETPSRASRAYDV
FT                   NRDGFVIAGGAGVLVLEEYEHAKARGAQIYGEVAGYGATSDGHDMVAPSGEGAVRCMRQ
FT                   AMEDLKGVKIDYINPHATSTPVGDDKEIEAIRTVFGAGDACPPISATKSLTGHSLGATG
FT                   VQEAIYALLMMNNGFICESAHIEELDPAFADMPILRQRRDGAQLGHVMSNSFGFGGTNA
FT                   TLVLKHPDA"
FT   gene            470424..471299
FT                   /locus_tag="Mext_0426"
FT   CDS_pept        470424..471299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0426"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="KEGG: xau:Xaut_0052 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28848"
FT                   /db_xref="GOA:A9VZU2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZU2"
FT                   /protein_id="ABY28848.1"
FT                   /translation="MRALRRRADTRTDLRMTGLMAGKRGLIMGVANDHSIAWGIAKTLH
FT                   RHGAELAFTYQGEALGRRVTPLAASVGSDIVLPCDVEDLATVDAAFATLDERFPDGIDF
FT                   IVHAIGFSDKAQLKGRYVDVTTRANFSRTMTISCFSFTEIAQRAAARMPRGGALLTLTY
FT                   AGSTRVMPNYNVMGVAKAALEASVRYLASDLGPDGIRVNALSAGPMRTLAGAGIADARL
FT                   MYNHQKAHAPLRRTVTLDDVGNSALYLLSDLSGGVTGEIHFVDSGYNIISMPRPAVLQA
FT                   QDEAGVVGDL"
FT   gene            471367..472128
FT                   /locus_tag="Mext_0427"
FT   CDS_pept        471367..472128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0427"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: nha:Nham_1390 flagellar biosynthetic protein
FT                   FliP; TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28849"
FT                   /db_xref="GOA:A9VZU3"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZU3"
FT                   /protein_id="ABY28849.1"
FT                   /translation="MTPSPSRPVPRSLPLTLLLAALLLAAGAGAAWAQSVTLDLGAGGT
FT                   TERALQLVALITVLALAPSVLVMATSFTRIVVVLSILRSALGTQTAPPNTVMVSLALFL
FT                   TAFVMAPTAREAYRTGVEPLMAGQISQSQAFERASAPFKTFMLRNVREKDLKLFLDMAR
FT                   QPAPAGPEAIGLEIVTPAFMISELRRAFEIGFLLFIPFLIIDLVVASVLMAMGMMMLPP
FT                   ATVALPFKLIFFVLVDGWTLVAGSLIQSYGS"
FT   sig_peptide     471367..471468
FT                   /locus_tag="Mext_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 34"
FT   gene            472185..472586
FT                   /locus_tag="Mext_0428"
FT   CDS_pept        472185..472586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0428"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: mes:Meso_0934 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28850"
FT                   /db_xref="GOA:A9VZU4"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZU4"
FT                   /protein_id="ABY28850.1"
FT                   /translation="MDLTTTTTHWAPRMLSILRIVSALIFMAHGTQKILGFPASSMNPP
FT                   LLSLPGIAGLLELVGGALLVVGLFSRPVAFILSGQMAFAYFIAHAPKSFFPALNGGDAA
FT                   ILFCFVFLYIAFAGPGPWSIDAQRGRGRV"
FT   gene            complement(472590..475940)
FT                   /locus_tag="Mext_0429"
FT   CDS_pept        complement(472590..475940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0429"
FT                   /product="tetratricopeptide TPR_4 protein"
FT                   /note="KEGG: nwi:Nwi_1127 tetratricopeptide TPR_4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28851"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZU5"
FT                   /protein_id="ABY28851.1"
FT                   /translation="MGGRAGQAKRRPGRALLRAGFAVGLCAAASAAEAARLVSAKGAQP
FT                   PEGFGRIVLTFDEPVSVKARLSGAILVLNFGEAVGSGPERIAAGMPDYVTVVRRDPDGS
FT                   ALRLALQRPYRVNVQDAGEQVFIDLLPESWNGFLPPLPTEVVADLARRAAAAEASLKAR
FT                   NPAPVPRPLTLELARTDARTRLSLRLPAGSEAAFAPDGTGTRLTLPGAWRIDDHALRGR
FT                   LDPNLGRVTVETDTGEARIVASPAEGVTLSTLRDEDVVAIDFVTKPKTPETATSSASPA
FT                   GASAGVAKEVPKEAARPAASSADASPRPAAPPVLSRKAGSGLVFPFAKRVPAALFERGG
FT                   IVTLVFATTEPVAVPPPGATGLVALAPPLRSGGFTILRFTAPAGRLVDLLPVTEPAGWE
FT                   LATGDGLSPSESLTAQRAPTAQGRLGVSVRLPQAGPAGWLDLDGERIAVVTTDGSRPAG
FT                   VVKAQRFVEFELIPSRLGLAVLASADDLIVRPDLDGVTIGRENAREGTREGRDGGLSVS
FT                   GISRPADPPVGAVTELAVDRDAWEKAQRGDVRATLREGLAAAVEAHRRDRGGARLGLAR
FT                   AMMANDLDVEALGALTAAAAEDVVIDGDRQTALMRGILLARIGRAEEARKLLSDERLAT
FT                   NPEARLWRGYADALVGRWNEAAVALRAGESVLERYPEPLASLFHAAAAEAAVETGDWEA
FT                   VTRESIAATRAATDYTRDRLTLLRAKMDEATGRGAAALAAYEILRNQAPWPLAAEATLR
FT                   AAVLGHTLGKTPLPEAIDQLEVLALTWHGGPTEIGTLGALGGLYEEAGRWRKIFTTARR
FT                   ANALSPEAPIARALHERALAVFEDLFLGARGERLGGVEALALYFDFKDFAPAGRRADEI
FT                   VRRLADRLVALDLLESADELLQYQIDHRLEGTARSSVSARLATIRLMEGKPLQALQTLD
FT                   ATHLPELPEDVRRARAMLRARALSDLSRTDLALETVEGETGADAERLRADILWAARRWR
FT                   EAGEAHEMILGPAWRSGKPLDDTARADVIRAGIAYGLAGESLGLERLKAKFAGPMAESA
FT                   DARTFAMLTRPDAPRSAAFRDAALRATKAETLAAFLSEYRKRYPDSAVPEPGSAATGNR
FT                   AEAPSPPPG"
FT   sig_peptide     complement(475845..475940)
FT                   /locus_tag="Mext_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.646 at
FT                   residue 32"
FT   gene            complement(476056..476487)
FT                   /locus_tag="Mext_0430"
FT   CDS_pept        complement(476056..476487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28852"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZU6"
FT                   /protein_id="ABY28852.1"
FT                   /translation="MKHLAIATAILFAWPLAAGAESPAAPDTVKTSPEAASPAPDAASK
FT                   APQTAQERQEANAAKLAGLVRFVGESCKEAQPDYERFKAVVSAMGVDLDAISKGELLMR
FT                   SMGYTEAYRKNVDESCRKAQEMFGEKGKAIPGLVLRKAS"
FT   sig_peptide     complement(476425..476487)
FT                   /locus_tag="Mext_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.852 at
FT                   residue 21"
FT   gene            complement(476641..478788)
FT                   /locus_tag="Mext_0431"
FT   CDS_pept        complement(476641..478788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0431"
FT                   /product="Oligopeptidase B"
FT                   /EC_number="3.4.21.83"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S9A prolyl oligopeptidase domain
FT                   protein beta-propeller; KEGG: rpa:RPA1570 putative
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28853"
FT                   /db_xref="GOA:A9VZU7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZU7"
FT                   /protein_id="ABY28853.1"
FT                   /translation="MTFEPPPFALPPEAPVAETRPHVFELFGRRVEDPFAWLKAENWRA
FT                   VLKDPSALAPDIRAYLEAENAYAETALSGAADLRKTLVAEMRGRIREDDASVPEPDGPF
FT                   AYYSRHREGGQHPLICRRPRTVHRIAEEPEDGEIGEQILLDGDREGEGLAFFEIAGAAH
FT                   SDDHRLLAWGVDTKGSELHTIRVRDLDTGEDRPEQVESTAGEAVWNAAGTAFFYVALDE
FT                   NHRPARVMRHRLGTDQAEDTTVYEEPDPGFFVNIGRTQSGTYLTVTASDHETAEVHLLD
FT                   RADDEGALACVAPREERLIYSVEHWGSYLVILTNADGAVDFKIVTCLLDATARENWQDA
FT                   VPYRPGVMIRHLHVLGNHLVRLELENALPRIVVRDMKGEEHTVSFAEEAYSLGLLPGYE
FT                   FETARIRFSYSSMTTPAETYDYDCVTRARILRKRQSVPSGHEPADYVTRRLFATAPDGE
FT                   SVPISLLHRRGLSLDGSAPLLLYGYGSYGTLMPAGFRTNLLSLVDRGFVYAIAHVRGGT
FT                   EKGWNWYLEGKREKKPNTFTDFVACGRALIEAGYTAQGRIVAHGGSAGGMLMGAAANLA
FT                   PELFAGIVADVPFVDVLNTMLDADLPLTPPEWPEWGNPAESEEAFKTILSYSPYDNVAA
FT                   KTYPAIFALGGLTDPRVTYWEPAKWVARLRATMTGGGPVLMKINMEAGHGGAAGRFDRL
FT                   EEVGLIYAFALMAAARAAKRV"
FT   gene            479217..479654
FT                   /locus_tag="Mext_0432"
FT   CDS_pept        479217..479654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0432"
FT                   /product="ROSMUCR transcriptional regulator"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   rpc:RPC_1774 transcriptional regulator, MucR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28854"
FT                   /db_xref="GOA:A9VZU8"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZU8"
FT                   /protein_id="ABY28854.1"
FT                   /translation="MNETETPVDYVALTADIVAAYVSNNPVPAAELAGLIGNIHGALIQ
FT                   VGTGRAAAPQPVAQEALQPAVPIKKSIQPDYLVCLEDGRTFKSLKRHLRAKYNLSPEQY
FT                   RAKWGLSPDYPMVAPNYAKARSDLAKAIGLGQVRPGYDAAA"
FT   gene            479727..479999
FT                   /locus_tag="Mext_0433"
FT   CDS_pept        479727..479999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28855"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZU9"
FT                   /protein_id="ABY28855.1"
FT                   /translation="MRAEIDESGYQQQSRGTAQLLLHCPHMSDDSPSEQLAKTNEALAE
FT                   WAARSACDSDRLIDRFEQMGYAVRGKSEDEIAEILKKPPTKPSQA"
FT   gene            480108..480950
FT                   /locus_tag="Mext_0434"
FT   CDS_pept        480108..480950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_1869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28856"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZV0"
FT                   /protein_id="ABY28856.1"
FT                   /translation="MSKEQNMNKTGGLGREAERLLAALAPEGAYAFPDPSAPETLIVRS
FT                   GGRGVSLGAGRFPVRAGEALVAADLASRDDGRRNRLVIGAAGRARLRRAEIGGPDSFRI
FT                   QHLAVVREGTGDGERVRDTAESPLAWMARRRGRDGEPMIDAAAFAAGERLRHDLASAQM
FT                   MPQLSTDWTAPRVDGGGPRDPSSGSDRVIAARQRVDLALAVVGSDLSGLLIDLCGFLKG
FT                   LERIEAERRWPARSAKVVARIALGRLAEHYGLAREATGPERARTRAWRLKTDQPPASS"
FT   gene            complement(480989..481417)
FT                   /locus_tag="Mext_0435"
FT   CDS_pept        complement(480989..481417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0435"
FT                   /product="Fe-S metabolism associated SufE"
FT                   /note="PFAM: Fe-S metabolism associated SufE; KEGG:
FT                   bja:bll3069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28857"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZV1"
FT                   /protein_id="ABY28857.1"
FT                   /translation="MLPDLDTIIENFEILDDPMDRYEYVIELGKLMPKMPEAAKVEDNR
FT                   VSGCESQVWIDVSLKKDAGHPALKLEGDSDSHIVKGFVALMVALYEGKTPDEAIKADGF
FT                   DLLKRLDFGSHITSKRSNGVRAMVDRIRKDAGRLQTLN"
FT   gene            complement(481506..482585)
FT                   /locus_tag="Mext_0436"
FT   CDS_pept        complement(481506..482585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0436"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: dvu:DVU0449 sensor/response regulator;
FT                   TIGRFAM: PAS sensor protein; PFAM: histidine kinase
FT                   dimerisation/phosphoacceptor; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; SMART: PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28858"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZV2"
FT                   /protein_id="ABY28858.1"
FT                   /translation="MGADTPQGGLSGNHGADTPFDLGDGFRRFADHVPLMMWRTDESGR
FT                   STYHNECWLQFTGRPLAEEIADGWRGGVHPDDFKRHAEIVEKAVESRLPFTVEFRLRRH
FT                   DGAYRWLLDTGRPLEENGVFHGYLGSCFDITDRKNAEEHAEHALVEKETLLAEIYHRVR
FT                   NNLQVMVSLIGLYGRAAPEACRGSFDALGQRVRAIALVQQHLHEAPHIASIDLRDYLHR
FT                   LASGLGQLRRAGRIGVTVEGDGTSLVEPRTANALGMIVAEVVAECLDATTETVTCGISI
FT                   RIDAAAGAPVRLSVISGAGEAAAAGREGVPKLGPRLIAAYAAQAEIAVCGTATEADPLH
FT                   LQLPEVRADVAPTISPSLS"
FT   gene            complement(482738..486415)
FT                   /locus_tag="Mext_0437"
FT   CDS_pept        complement(482738..486415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0437"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: nha:Nham_0235 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; GAF domain protein; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28859"
FT                   /db_xref="GOA:A9VZV3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZV3"
FT                   /protein_id="ABY28859.1"
FT                   /translation="MTGMRNGEGVPASLRFLEEGGQTGREILAYPWSDTPLGPLEDWPV
FT                   SLRTTLATMLACPAAMFLAWGPEGISFFNDAYRPVFGDRLPRALGARFREIWADLWEDI
FT                   GPLVDAALRGESVAQRNLPLLMDRYGVPEESWWSFTYSPVRDDAGRINGMICVTAETTA
FT                   EVLAERARRRSDERLEMALSAGGSIGIWDWDVAADRVTADPRFAALYGVDPEMAAAGAP
FT                   IAAFFSGVHPDDLPSLKASIGAVFGTGGQFDAEYRLVQGDGSIRWVAAQGRCTLGEDGT
FT                   PRHFPGVSFDITERKRIEQALRDSQDRFRGIINSVDQMIWSTRPDGYHDFYNERWYAFT
FT                   GVPAGTTDGEAWNGMFHPDDRERAWAAWQHALATGENYQIEYRLRHRSGLYRWVLGRAQ
FT                   PVRDPDGRIVRWFGTCTDIHDRKLAEERQAFLLGLNDRLREADEPQAVTLAAAATLGAH
FT                   IGVARAGYGEIDETGEIVRVERDWTRDPSVPSLAGASRILDGFGPAVIAELRAGLTLVV
FT                   DDCYADPRAGHDYAATWDSIGCRSLVVVPLIREGRLRAILYLHEPKPRVWSAEEIGLVE
FT                   DVAQRVGHAAERARAEQAERANARELRLIADSLPVLIALFDADGVCRFANAASADWFGV
FT                   APAESVGQTLAALIGPADFAEARPRFESARAGRDVRAGRAWPRRDGSPRIADIRYLPRP
FT                   MPDGSTDGAYLFVTDISDAKRIEAMLEREVGERTRERDRLWQTTNDLMGTAGLDGHLRS
FT                   VNPAWGRLLGWSEQELLERPFLDFIDPEDRAGTGAVLARLAGSDQITDFVDRILSKDGR
FT                   RRTVMWTAVPESGCFHIVGRDITDQRLAEEQLRQAQKMEAVGQLTGGIAHDFNNLLTGI
FT                   IGSLDLMQTRIAQGRIDTLERYAGAALTSAHRAASLTHRLLAFARRQPLEQKPVDVNVL
FT                   LAGMEEMLRRALPEQVHLDIVATEGVWPTLCDPHQLENAVLNLAINARDAMPEGGRLVV
FT                   ETSNAHIGPADLSLHSGAREGAYVCIRVTDTGHGMPPEVAARAFEPFFTTKPLGMGTGL
FT                   GLSMIYGFARQSEGHARIVSEPGRGTTVTICLPRYRGALSSERASVSLPEPARFERNET
FT                   VLVVEDELVVRDLVVEVLRELGYRAIEAPDGPSGLEIVRSSARIDLLVTDVGLPGLNGR
FT                   QLADHARTLRPELRVLFMTGYAENATFGGGPLDPDMQMITKPFPVERLAARIREMMELS
FT                   "
FT   gene            487093..487602
FT                   /locus_tag="Mext_0438"
FT   CDS_pept        487093..487602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_0358 signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28860"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZV4"
FT                   /protein_id="ABY28860.1"
FT                   /translation="MNTDDFAYDFDAPDSDWNYEPSRADLFRQIDAPLYTTDSNGWLTY
FT                   YNEAAAQLWGFRPVIGKARWCGAWRLFEADGAPLPHDLSPMALTLKGARPVRGVQIGLE
FT                   RPDGSRMAFLPYPTALRDGTGAVVGGCNILLAVERSSLRVPLRGALQGRPTLRAAQLAS
FT                   MHRCSA"
FT   gene            487717..487881
FT                   /locus_tag="Mext_0439"
FT   CDS_pept        487717..487881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28861"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZV5"
FT                   /protein_id="ABY28861.1"
FT                   /translation="MSVDTNWSLDAVQSLRSMAREGIPLSVISLRLKRPVDAVCAKLAE
FT                   LGITPKLEL"
FT   gene            complement(487928..488368)
FT                   /locus_tag="Mext_0440"
FT   CDS_pept        complement(487928..488368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0440"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: csa:Csal_0685
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28862"
FT                   /db_xref="GOA:A9VZV6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZV6"
FT                   /protein_id="ABY28862.1"
FT                   /translation="MEFLHTMVRVADLDRALAFYVDAFGLKEVRRVENEKGRFTLVFLA
FT                   APGDVERAEATKSPLIELTYNWDPETYSGGRNFGHLAYQVDDIYAFCQRLKDAGVTINR
FT                   PPRDGYMAFVRSPDGISIEILQKGGAKPPQEPWASMENTGTW"
FT   gene            complement(488513..488848)
FT                   /locus_tag="Mext_0441"
FT   CDS_pept        complement(488513..488848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0441"
FT                   /product="putative insertion element protein"
FT                   /note="KEGG: bbt:BBta_p0210 putative insertion element
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28863"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZV7"
FT                   /protein_id="ABY28863.1"
FT                   /translation="MPTLPADEDGLTRAIVALASEYGRYGYCRVTALLQADGWQVGKDR
FT                   VQRIWRREGLKVPSRHRPRSRLWLNDGSCVRLRPLHRNHVWSFDFVQAQTHDGRSLRIL
FT                   TLIDEHK"
FT   gene            complement(488956..489237)
FT                   /locus_tag="Mext_0442"
FT   CDS_pept        complement(488956..489237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0442"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bbt:BBta_p0209 putative transposase IS3/IS911 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28864"
FT                   /db_xref="GOA:A9VZV8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZV8"
FT                   /protein_id="ABY28864.1"
FT                   /translation="MKRGQRPSADQVVLMLRQIEVQTAQGKSIAVACKEADVSEQSYYR
FT                   WRKEYGGLKVDQAKRMKDLERENARLRRLVADLSLEKQVLADVASGNL"
FT   gene            489465..489716
FT                   /locus_tag="Mext_0443"
FT   CDS_pept        489465..489716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0443"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: nwi:Nwi_2918 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28865"
FT                   /db_xref="GOA:A9VZV9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZV9"
FT                   /protein_id="ABY28865.1"
FT                   /translation="MPDNGQVERMNRTIKDATVKRYHYTSHDELRQRLQLIVDADNYGR
FT                   RLKTLRGLTPYEFICQTWTNEPERFRLDPSHHIPGPYI"
FT   gene            complement(489721..489927)
FT                   /locus_tag="Mext_0444"
FT   CDS_pept        complement(489721..489927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28866"
FT                   /db_xref="InterPro:IPR021327"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZW0"
FT                   /protein_id="ABY28866.1"
FT                   /translation="MNHFIADPTSDEIRQRAYEIWERRHQPKGYDTEFWFEAERELKAE
FT                   RLHNDRPEGGGIPKSGAGSDCAY"
FT   gene            complement(490384..490974)
FT                   /locus_tag="Mext_0445"
FT   CDS_pept        complement(490384..490974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0445"
FT                   /product="protein of unknown function DUF1003"
FT                   /note="PFAM: protein of unknown function DUF1003; KEGG:
FT                   swi:Swit_4796 protein of unknown function DUF1003"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28867"
FT                   /db_xref="GOA:A9VZW1"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZW1"
FT                   /protein_id="ABY28867.1"
FT                   /translation="MNASQANADSQVTQLARQLLDGGASCLSAREQRVILHVAKRMHVI
FT                   QDVNIVLAEQQTFGERLADRVAQLGGSWAFIMVFTGMLLAWVLVNTVVLARSGGGFDPY
FT                   PYIFLNLILSMVAALQAPMILMSQNRQTARDRLAAALDYEINLKAEVEIMSLHDKLDRI
FT                   QIEHLEGMLITQSAQIEAVGKAVGIRTAKPITV"
FT   gene            490974..491261
FT                   /locus_tag="Mext_0446"
FT   CDS_pept        490974..491261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28868"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZW2"
FT                   /protein_id="ABY28868.1"
FT                   /translation="MSPDSPVDSRHRLPGEDLGSGPVEDPQAIGRLGHVQGLKQRLRPD
FT                   LGILQRRNVLRNAIQDGMSGITRPDPEKLDGKVHGSLLLGEIYTFFRKAA"
FT   gene            491895..492071
FT                   /pseudo
FT                   /locus_tag="Mext_0447"
FT   gene            492064..492360
FT                   /locus_tag="Mext_0448"
FT   CDS_pept        492064..492360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecw:EcE24377A_2232 conserved hypothetical
FT                   protein TIGR02594"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28869"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZW3"
FT                   /protein_id="ABY28869.1"
FT                   /translation="MQRAPTRGGASGLKELALGAIATKKRGNSSRQSHVGFVVGANPTQ
FT                   IFLLGGNQGDAWSIAAFPRKKFTSFRWPADVSLPAPHTLPTTIAGARSGVSEA"
FT   gene            492660..492989
FT                   /locus_tag="Mext_0449"
FT   CDS_pept        492660..492989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28870"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZW4"
FT                   /protein_id="ABY28870.1"
FT                   /translation="MDHSHRADCHRDPDPAHRCRPRHCRRKLPWLVSMYLTEARIDRMV
FT                   RLAADYALNAVEKDVADKTLSVDVGYTVLKVGLKREIDRIIPLLEYPKSDCDAAVVASR
FT                   LARST"
FT   gene            complement(493066..493833)
FT                   /locus_tag="Mext_0450"
FT   CDS_pept        complement(493066..493833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28871"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZW5"
FT                   /protein_id="ABY28871.1"
FT                   /translation="MLLQGHAARHAVLALTASGLVLASAVHAQAAGESDFGGLFQQLFS
FT                   PQPTPAAQPITPSVDQTSSSGQVNSGPGMARRAKGRWDERQSARRRQLKEPQAQVKPKV
FT                   RYASLPKPAKVAAPTDKPQPSGASLDLREYAGNPDAAFMHDSTLRKGDIVITTFGPKVF
FT                   KGKTGERHAAAEFEPAGRSSAVDRKTRKLLAAMVAPYGALPAYEADKLLAKQRRLSDPS
FT                   SASAGQQVQTADLRVVYPSVLQRAAVRVSLQGD"
FT   sig_peptide     complement(493747..493833)
FT                   /locus_tag="Mext_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.868 at
FT                   residue 29"
FT   gene            complement(493948..494142)
FT                   /locus_tag="Mext_0451"
FT   CDS_pept        complement(493948..494142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0451"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: syn:slr0423 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28872"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZW6"
FT                   /protein_id="ABY28872.1"
FT                   /translation="MTAAHRTLPFGVRVRVTNKNNGRSVVVRINDRGPFVGGRVIDLSK
FT                   ASARAIGVSGVAKVSLTRV"
FT   gene            494427..495263
FT                   /locus_tag="Mext_0452"
FT   CDS_pept        494427..495263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0452"
FT                   /product="protein of unknown function DUF1236"
FT                   /note="PFAM: protein of unknown function DUF1236; KEGG:
FT                   mmu:100041170 similar to loricrin"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28873"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZW7"
FT                   /protein_id="ABY28873.1"
FT                   /translation="MTRFFRSTATAAILALGAATALAQGGAGGGAGGGAGGGAGGAGMS
FT                   TGGGAGGGAGGAGGGAGGAAGGAGGAGVGSGSAGGGAAGTGAGGAGTRGDGAGGTGGAA
FT                   GTRGGDTGSGTGTRSGTGGASERGGAGERGGASDRGTAGERSNASDRNGSRDGASDRGG
FT                   DRGNATGERGGRGEAGTRGEASGRSEARGAVSRLDSSKRTEFRQSITRSGVSRVDNVNF
FT                   SVSVGTAIPRSVTLHTLPPAVLSLVPAYRSYRYILVRDDIVIIDPDTYEIVDVIQG"
FT   sig_peptide     494427..494498
FT                   /locus_tag="Mext_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 24"
FT   gene            495312..495713
FT                   /locus_tag="Mext_0453"
FT   CDS_pept        495312..495713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28874"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZW8"
FT                   /protein_id="ABY28874.1"
FT                   /translation="MAYSFGVDLAVVRADILVQVGALHDRRLLDRAGGNGGEGALGGVE
FT                   RHHGRSGSDQPRHAPQVRWLARVLSHALGIRLEAQVTSLRRQRTVRRASVMTGAGLVKG
FT                   VDRSERRIVARPAVVAMHQHLRCAGHIAG"
FT   gene            complement(495919..496143)
FT                   /locus_tag="Mext_0454"
FT   CDS_pept        complement(495919..496143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28875"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZW9"
FT                   /protein_id="ABY28875.1"
FT                   /translation="MPETLFQVTLETRDGRRALTASTERDAALMAETVLRRYEGQTLTV
FT                   GFSVECADREAGTRVAFYLTDLALELELA"
FT   gene            complement(496314..496568)
FT                   /locus_tag="Mext_0455"
FT   CDS_pept        complement(496314..496568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:C18D11.9 C18D11.9"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28876"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZX0"
FT                   /protein_id="ABY28876.1"
FT                   /translation="MKALMMAAAVGLGLFASVGSASADPWKDESGHGRWGRHEGRGHGW
FT                   GHHRPRFGYGYDRPRGYGYYSGHREYRGARFGGYRGYPY"
FT   sig_peptide     complement(496497..496568)
FT                   /locus_tag="Mext_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.923 at
FT                   residue 24"
FT   gene            496791..497036
FT                   /locus_tag="Mext_0456"
FT   CDS_pept        496791..497036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28877"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZX1"
FT                   /protein_id="ABY28877.1"
FT                   /translation="MRKTIALGFVAAAALAGLAAPASAEETTVIRRDSAPSVSVERRQG
FT                   VVERREVTTGSVDCGSKTVHKEDGMGNSKTVHKEGC"
FT   sig_peptide     496791..496865
FT                   /locus_tag="Mext_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            497084..497500
FT                   /locus_tag="Mext_0457"
FT   CDS_pept        497084..497500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0457"
FT                   /product="protein of unknown function DUF1236"
FT                   /note="PFAM: protein of unknown function DUF1236; KEGG:
FT                   nha:Nham_0234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28878"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZX2"
FT                   /protein_id="ABY28878.1"
FT                   /translation="MTNKLLLALTAAGMLALPMTAQAQGTLRGAAEGAEAGAAAAGPVG
FT                   GIVGGAVGAATGTVGGILGVDDRPRFRSYVRERGVSSYSWGGPVRVGTVLPEDSVTYYE
FT                   VPTEYRVRQGYRYTIVNEQPVLVDRSHRIVEVID"
FT   sig_peptide     497084..497155
FT                   /locus_tag="Mext_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(497599..498279)
FT                   /locus_tag="Mext_0458"
FT   CDS_pept        complement(497599..498279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0458"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: mes:Meso_3107 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28879"
FT                   /db_xref="GOA:A9VZX3"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZX3"
FT                   /protein_id="ABY28879.1"
FT                   /translation="MAEGTYRTASPRLRPGRIPEGARHHLGSELRSYYASMLAEVQPSA
FT                   LLDLIARLDSAAPTRDAAAFRDGLLASLPALRAFALSLAANPAVADDLVQETLLKAWKN
FT                   QDRFEPGSNLQAWLCTILRNHFYSEIRRRKREVEDADGTMAGQMVAPAAQEASSELQQV
FT                   GQHLAKMPAVMCEALLLVGAQGLTYEDAAALIGCQVGTVKSRVSRARALLASSLGMDTR
FT                   RAVV"
FT   gene            498693..499223
FT                   /locus_tag="Mext_0459"
FT   CDS_pept        498693..499223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0459"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; KEGG: rle:RL3611
FT                   putative two-component response regulator transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28880"
FT                   /db_xref="GOA:A9VZX4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZX4"
FT                   /protein_id="ABY28880.1"
FT                   /translation="MLALVLDDAEMNNLVMAASLRPLAGCVPHDFTVPAEALALAQARA
FT                   SEIGVVITDYEMPGMNGIEFIRAVQRIPGLAHVPTVMVTSHDQRSLRREALKAGATDFL
FT                   TKPADAAEIRARVTNLLALSEAHRAQRDHAAQLAREVAAAVALVEEREREIVSTLMRAA
FT                   EHRDADTGDHRCC"
FT   gene            499430..500554
FT                   /locus_tag="Mext_0460"
FT   CDS_pept        499430..500554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0460"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein; KEGG:
FT                   maq:Maqu_0775 ion transport 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28881"
FT                   /db_xref="GOA:A9VZX5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZX5"
FT                   /protein_id="ABY28881.1"
FT                   /translation="MVRSRLPRTRPLHFRRSVVRDLRNRIRFALVGLLILIGLHVVSMV
FT                   AFEHLRVGEAIWLTFTTITTTGYGDYSAKTAAGRASTIVLIYLSGIFLLTQAGGAFFEF
FT                   RILRRERKRRGEWRWNMRDHIVFVNAPADEPGDYLRRLLDQLHRSHANFISVPSLILTE
FT                   AFPDGLPPDLEDDPLIVQLKGRFDDPAALEAAGVDHARVLVILAEQEGDRLSDSRTFDI
FT                   IHRLRERGINARIVAECVDDLNRERLKRAGASAIVRPLRGYPEMIVRAIVAPGTEWIIE
FT                   RLFSSEGDECLRFDVQLRDVPWLGIVPAVLAANFGTPIGYVDAQGQLHSNPPPQIRVTG
FT                   EALFVLVDETQKPSGAALQKLIDNIPTYGIAERP"
FT   sig_peptide     499430..499576
FT                   /locus_tag="Mext_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.429 at
FT                   residue 49"
FT   gene            complement(501034..501966)
FT                   /locus_tag="Mext_0461"
FT   CDS_pept        complement(501034..501966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0461"
FT                   /product="regulatory protein LysR"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mes:Meso_4540 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28882"
FT                   /db_xref="GOA:A9VZX6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZX6"
FT                   /protein_id="ABY28882.1"
FT                   /translation="MDLDWLTDFLALAELKTFSRAAEARNVTQPAFSRRIRALEDWVGT
FT                   PLFVRGPQGATLTPAGAHFQPAADELARGLERTRREVRAIGDRNTVALSVAATHALSFT
FT                   FFPNWIRGLMQHQALGTLNLISDSMDACEAIMMSGEVHFLLCHFHPSAPARFEADRFPS
FT                   VSVGEDVLVPLCAPSADGQPIWSLPGSAAAPVPYLAYSQASGLGRILAADQEREVTHTE
FT                   TTLTSHLAATLMTMARNGHGVAWLPHSLAGDDESRGQLVRAGPPEFDVPIEIRLFRSLE
FT                   CRNRAADTLWDHLSAMSLGALVPPKSSDT"
FT   gene            502108..503439
FT                   /locus_tag="Mext_0462"
FT   CDS_pept        502108..503439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0462"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   pfo:Pfl_2773 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28883"
FT                   /db_xref="GOA:A9VZX7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZX7"
FT                   /protein_id="ABY28883.1"
FT                   /translation="MKDWLSRLYVQVFIAIIIGGLVGYFLPHIGVTLQPLADGFIKLIK
FT                   MLLAPVIFGTIVVGIAKMGNMKEVGRIGVRALIYFEVVSTLALIIGLVVVNVMQPGAGM
FT                   NIDATHMDSSAIAGYAKRAEAQPGIIGFLMDIIPSTMVDAFAKGAMLQIILISLLFGLA
FT                   FVQAGERGKPVVVVIDSLLDALFRIVGMVMRLAPIGAGAGVAFTIGKYGFGTVWSLAYL
FT                   MLGVYATSIMFVGLVLGAVCTWTGFSLIKVLSYFKDEILITFGTCSTEAVMPRMMAKLE
FT                   RLGCEKSVVGLVLPTGYTFNADGTCIYLTMAAIFVAQATNTPLGFGDQLVVLGVLLLTS
FT                   KGSAGVAGAGFVTLAATLSSINTVPVAGLVLLLGVDRFMNEARAVTNLIGNAVATIAVA
FT                   KWEGAFDHAKAEDAYRNRAAVAAEEVIPETTAGHALPRPVAVAQ"
FT   gene            503504..504667
FT                   /locus_tag="Mext_0463"
FT   CDS_pept        503504..504667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0463"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bja:bll6730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28884"
FT                   /db_xref="GOA:A9VZX8"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034611"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZX8"
FT                   /protein_id="ABY28884.1"
FT                   /translation="MRIVDVCEVTKPISSPIRNAYIDFSKMTTSLVAVVTDVERDGRRV
FT                   VGYGFNSNGRYGQGGLIRERFKNRILEADPKSVLNEAGDNLDPHKLWAAMMTNEKPGGH
FT                   GERSVAVGTLDMAIWDATAKIAGKPLFRLLAEQKGVEANPRVFVYAAGGYYYPGKDDTQ
FT                   LRAEMRGYLDRGYNVVKMKIGGVPIEEDQRRIEAVLKEIGSQAQLAVDVNGRFNLEQGI
FT                   TYAKMLRQYPLFWYEEVGDPLDYALQAALSEFYPGPMATGENLFSHQDARNLLRYGGMR
FT                   PDRDYLQFDCALSYGLVEYLRTLDVLHQFGWSPSRCIPHGGHQMSLNIAAGLGLGGNES
FT                   YPDLFQPYGGFPDGVRVENGHIVMPELPGIGFEGKSDLIKVMRELAE"
FT   gene            504774..505382
FT                   /locus_tag="Mext_0464"
FT   CDS_pept        504774..505382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0464"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bra:BRADO4306 putative
FT                   glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28885"
FT                   /db_xref="GOA:A9VZX9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZX9"
FT                   /protein_id="ABY28885.1"
FT                   /translation="MDVQAVLNALTDEFMSTSVVKVRAGIASTDRNTAALAACLELERR
FT                   GLAEHTGSLSRSSLRWRRASYRPERTSLPVNVRCDHVHLRSRNAVAAAHFYIDLFGARE
FT                   IRREGSPVVSRVTIDLGGLTVFIEQTAEGTASAPAQPHLGTEHIGFGVEDIEQAYAHVQ
FT                   RHGIEIISGINDVNPSLRTVFIKGPDGAIIKLLQRLPHP"
FT   gene            505493..505885
FT                   /locus_tag="Mext_0465"
FT   CDS_pept        505493..505885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0465"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /note="KEGG: ppf:Pput_4013 D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28886"
FT                   /db_xref="GOA:A9VZY0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZY0"
FT                   /protein_id="ABY28886.1"
FT                   /translation="MKPDVLLLKAILPDKIRALEVRVTPHRLDQPADRDAFLAAVGRDI
FT                   RAVVVGGQAPATQALFAQLLHLETVANFGVGYDTIDVILTPCRPSSLPAETSAWSEEAD
FT                   LCAAVTTSGGCATLGTVDVSSFPGWA"
FT   gene            505929..506693
FT                   /locus_tag="Mext_0466"
FT   CDS_pept        505929..506693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28887"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZY1"
FT                   /protein_id="ABY28887.1"
FT                   /translation="MQRMSTEPLLPPHGRMACTACFPSGAVWGRTKIQSEDGWSLENNP
FT                   CAWGAQNPRFLLLGFSKGERQSKDILAKRHDAIPYAGFRDRLTAGLRMLTLLGEGDTLD
FT                   KHIRADERDWAFGSLVRCSLAKDGRKSGTVISSSATARRYEEWRDRCTDLYLSRLPPRL
FT                   QIVLMLSNDASYMKGCRERITRLHPRTREINEVAYGDGRVTWVHIVHFGGQGFNHMNSW
FT                   TALADDTAGRKGRAARDAVLEALARTEVQAQD"
FT   gene            506699..507466
FT                   /locus_tag="Mext_0467"
FT   CDS_pept        506699..507466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28888"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZY2"
FT                   /protein_id="ABY28888.1"
FT                   /translation="MRWLGAPVLSQIRGKRDSIGDAWSSALDTGARFPILADFDNDGRR
FT                   VLVQLIGVSAWRSLDQALASLTVFAHPDAVEAVGARAVFRTIRGGPKGTILGDVMLDDN
FT                   ASPATAFEWATGLKRGADLQCNHLYRDARDPASYSDLRNICYTPSFIAKLTDSQREVVP
FT                   DEHLSHLLRYRAFELYGYTGSRSSLAPPKPSGYDNLIWPDPIGGGATVEGVTAIFRRKM
FT                   ARRPKDRLAKAARLVGWTFSDYLPDETVIFSGS"
FT   gene            508251..508562
FT                   /locus_tag="Mext_0468"
FT   CDS_pept        508251..508562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_2486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28889"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZY3"
FT                   /protein_id="ABY28889.1"
FT                   /translation="MTKKVVWVARDEGDGAGYDVSSIDLATGEKLLIKVKTTRGSKTTP
FT                   FFVTQNEEPVFRERPEKWRLYRVFEFTATTRIFVLDPPLDRAVNLPPPRSRRRFVDDE"
FT   gene            complement(508806..509087)
FT                   /locus_tag="Mext_0469"
FT   CDS_pept        complement(508806..509087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZY4"
FT                   /protein_id="ABY28890.1"
FT                   /translation="MREAYTLRGFERKLYLSVIFACVADRHGRIIRTFRDTLASCFAHA
FT                   REGLLYLRTKAFGTLCLTPRQLGAKAGQDQTLVPGRLVERFKLDYPGL"
FT   gene            509166..515303
FT                   /locus_tag="Mext_0470"
FT   CDS_pept        509166..515303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll8089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28891"
FT                   /db_xref="GOA:A9VZY5"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR021754"
FT                   /db_xref="InterPro:IPR025103"
FT                   /db_xref="InterPro:IPR026851"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZY5"
FT                   /protein_id="ABY28891.1"
FT                   /translation="MPTSGEADHLKLSYEKLREKLLDMGLRNPMLSYKHRPTSKRQLQI
FT                   IDEVPETVFDLLVDGTSLEIVPLPEPDDVPPDEKTDEFVSALSYAKATETEYLEAIEAI
FT                   EAEGGENAEAELAKAERALRNRLRAQFDLPPLEKPKAVDPVQHARTLGFDPSFDLQAHA
FT                   TEDKHRDKRLQTLKFPKPLDAILEKIRSDARLAEQETGLSTLFLVFGFLEWSEQDSDTK
FT                   LLAPLLLLPVQLVKTSRHGRTVYEVSATTTVAEGNLSLMKRVHRDRGITLPEPETDVEN
FT                   SLSVEAYFRRVRDVIADEKGWRVRRLMTLGHFMFGRFAMYADLDPLRWKQHPTETDLVG
FT                   SVMRGIEHGQGDGPLFGEREDHTIDDPAVAAKAPVLIQDADASQHSALVDAMDRKNLVI
FT                   QGPPGTGKSQTITNLIANALMDGRTVLFLAEKQAALDVVRRRLDNAGLGQFCLELHSDK
FT                   ASPKATIGRLKERVELTPDRAFRAVGGMDAALVDAREEVSKYAAALNGETPDGKTPFGL
FT                   MWQALKARSDIGEALDAFNGIQIPQAATNRLHEIAGAQTQVGLYAEIATNFVTGFGPPE
FT                   RSAWSAFEFGSEVTPGTAGLLVGGLRDLRDLAGAVETYLTTVPDLGLVDIAGLRRMTAA
FT                   VASLTGDVPDHGVLTKLRGQVSETVTGHLRDVEHALELDRRAAEAPLPADFDDALLDAV
FT                   EALVTVLGRDRRAPSEIIAEAERTLEAGGAAHEALDAATPLMEVLGLRVNFPCEGLRAT
FT                   MVAAYAVAKVPPELRTWFAWRPSGDLATALAEWRSLTADEASWRGTFTSVRGDWPDQTL
FT                   LRDVAAHLRKGWLSRSFASSENKAAVGNLASQLGLQEVTAAHADALDGLARHVDAVRGF
FT                   SARGDQAAMWGARWAGLHTPFEAAAKGQEVRGITLTHLANCPCGAEVAERVGMLDEGAL
FT                   GRLAAIAPGLEPIRRLPEDAFSAMGNACDQARRELPARRTKAERILVADSAHRLRDLTI
FT                   PLDHLAVAVEVERDRRVARRRLDEGSLSVAHDSVTLDKARLAWRWIKAVMASPDLQVVR
FT                   EGLLGADAGETRSGLKERLEGGIRLADRLEEAHRELQGRYGIRGLTMDPPGTLRECLDG
FT                   VVDRQDELSALVDLRRQRHELERLGLLPFVVRAAERGLPTDALPGLFEGLLARRRAENF
FT                   RQRDEVLSRAVGSRIQAQRRTFIDADKKKIENDRRAVRERLLARHALPGSAQGRKSTWT
FT                   EGALLRNEMGKQQKFVPVRDLIRRASESLQQLTPCFMMSPLSLAKFLPRGQVRFDLLVI
FT                   DEASQMKPEDALGGMLRAKQVVVVGDQKQLPPSEFFNRSVGSDSSDGDDQVEDIDDESI
FT                   LESCAKTFRETRLLKWHYRSRCESLIAFSNREFYDDKLITFPSAAPRSFSVELIRLKGR
FT                   YEASRNPIEAQAVAEEAILFMRHHAEEPVAPSLGVVAVNSEQRDLIDEEIQRLATEDEL
FT                   VQLYQERVAERGEPFFVKNLENVQGDERDFIFVSMTYGPKEPGGPVMQRFGPINGKHGH
FT                   RRLNVLFTRARLRIALFASFGSVDVKPSDTSPEGLRVLKRYFEYAERRGYAEVDPEGRA
FT                   DSDFEVEVARRLQREGFQVDHQVGVSGFRIDLGIRHPDYPERFIAGVECDGARYHSSKS
FT                   ARDRDRLREEVLTALGWNILRVWSTDWFDNPDLQTRNLVSRLRELQAAPRPVHQGYKLA
FT                   TSFLSAVEPTDPAANDDGASESDPLDASTELEHTQAVTADPDPVVVEPAASFLSGDGPL
FT                   NEEELRSALREFRDTVIARQMPDWEPHRSILRETMVETFVAQKLDDISDWFLKVPGFQR
FT                   SGTDPVEKKLYLGAICDLVARLSEREPGRTRPVTKEATSLDTSGPAPQQATHLPITRSG
FT                   GPYVVAKVEDSGVRPDPTRFYDPDYRTPLSRMVAHVIDVEGPLYAKLLVHRIARAHGFD
FT                   RSGGRIVELVLAAISPRCAQTEDDGRKLIWPSQSQPMVPFRKSAGQERALEDVPVVELA
FT                   SIAAPHVARGVPDEEILVRMRDQFALGKLREGTRQRFQAAVETCRRQRLEAAE"
FT   gene            515701..516042
FT                   /locus_tag="Mext_0471"
FT   CDS_pept        515701..516042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28892"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZY6"
FT                   /protein_id="ABY28892.1"
FT                   /translation="MTDNLKPPAARYEASASPAPSELTAPPPVSDDPARHVGEIFRRLT
FT                   LASETFPGAAFARIVAAVLVALGRACMEEAERQAAWLRERATPVRPGIRVSATARRVDF
FT                   DSFDIDRPE"
FT   gene            516226..516630
FT                   /locus_tag="Mext_0472"
FT   CDS_pept        516226..516630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28893"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZY7"
FT                   /protein_id="ABY28893.1"
FT                   /translation="MSFKNIPPNRLVAHAKCAVRQAEESDLYEFLPDPSETEPDPAVSL
FT                   LDALRDAPVSNILAAVMIYEALPPKELRRIETDECVAMVVGVTTRCRRRLSPRICSGRE
FT                   KRMYEYALAMARTVSAVGGQGQLSILCGTT"
FT   gene            complement(516906..518039)
FT                   /locus_tag="Mext_0473"
FT   CDS_pept        complement(516906..518039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0473"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: xfa:XF0678
FT                   phage-related integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28894"
FT                   /db_xref="GOA:A9VZY8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZY8"
FT                   /protein_id="ABY28894.1"
FT                   /translation="MGRYTKREHVAGRFWLDKRSNSPAYCICWLDGRQVKRKSTGTDDL
FT                   DAAIRALKAHYLSEDSPEVQDVARVPLADVLQAYYLQHGQHLPAAKWLRYAVAHWVRFF
FT                   GETISVWNATRPPQIERFIDDLRERGLKPSSINAVLTAGKAALNRSWRRGELTRQIHVP
FT                   SVKVTRMQPKGRPLSVEECAAWLDASAPHFHTLLFVCLATGSRPEAVKELRWEQVDFED
FT                   GLLHLNPEEREQTSKRRPVVKMPPILIAYLRQLPRESDFVVSYRGRPVDRYYTALGEGR
FT                   KRAGLDERVNLYSARHTVARWMRKERVPIEEISGQLGHRVRGFAITEIYAAYSPDYQQN
FT                   ATSALERLLHAIATRAQSCHTLIGSSTTNVGDRILAD"
FT   gene            complement(518691..521003)
FT                   /locus_tag="Mext_0474"
FT   CDS_pept        complement(518691..521003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28895"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZY9"
FT                   /protein_id="ABY28895.1"
FT                   /translation="MRSKPKASFAVVQHGEASISSDSIEQDGVEISTAVADATEAAALI
FT                   AEAAFSENDTRIRASSGSTDVHTYEFSNISSVEANFRAALSSSQAEVVAKISIPAETLP
FT                   IRVTSGFGSKGRSLLTSLRAGVTEREQTAEAACNERRQRKPARQKRVIAALRAQVENDP
FT                   QYRSACEEARRVQQRYANALKSQSDNPSAAHRSLEEVERAADFAQDFYLVNLAAIATRI
FT                   ERCGSEGAFACGSDYCPHCRRRFGARLLEDTQVQLSRRYGEDLEKARNELVHVTILNDI
FT                   VIPDPDLDRDYLANFSASTIRRDHRELLAYLKRWQSDRLSAMSHLLAKRKLSMELFEDW
FT                   MTAENRDRRFYNADNLYADAIHLVRFNELIESARRKFKRKRNWLESPPNSFVSWRAAED
FT                   VDPYMWQLRQAQILSRDDIFKLAHGLQCIYRQFDGLTKTNFPERLKFKSSIEKVIRRER
FT                   SKLYRLNKDLPGVSLIGQFELELVDLRHSIGGTHQHRTKSQTLRALASQPRKQPKQRTS
FT                   NEPPSPEAERRRIKQSAKARLLDDARERIAGNLELPESDFPGLQFAVLLHIHALVDLNG
FT                   HYRDDLERWLSGKQVGKRKFKGFWRLPYQVMVKKLFEAKPVHDSLRDISFYPFKGPTTF
FT                   NYENTAPKHDEDLPDEDPANFPDEALALLAWLQVGIGHESLRLSINWPSVDRERRGRKP
FT                   NKTVIPKVTEEEFYEEIEPMLAERGLSFPIEPSGQTDLSELFEAEDIREGMSRGSRNDE
FT                   CEEEGDINDTAPSPTKD"
FT   gene            521724..522438
FT                   /pseudo
FT                   /locus_tag="Mext_0475"
FT                   /note="transposase mutator type"
FT   gene            complement(522568..523185)
FT                   /locus_tag="Mext_0478"
FT   CDS_pept        complement(522568..523185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0478"
FT                   /product="regulatory protein MerR"
FT                   /note="PFAM: regulatory protein MerR; KEGG: sal:Sala_2558
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28896"
FT                   /db_xref="GOA:A9VZZ0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZZ0"
FT                   /protein_id="ABY28896.1"
FT                   /translation="MGITIRELSERSGVKVPTIRYYERQGLLPEPEKTGSGQRRYGSVD
FT                   VARLRFVRFGRGLRLEADEIRALIEMVGEGDGEAIVVLAGAVVDRAERLRALSESLRSV
FT                   SAAIIGGAIDEQGAFGQLVDGSTSTPFLEVVAKGPIADLVPTENDESAAAPTEEMPVDG
FT                   TSRRMPLKEGAIEASTAVLAEEGVARKAPHPKPVRKRTRAKS"
FT   gene            complement(524101..524445)
FT                   /locus_tag="Mext_0479"
FT   CDS_pept        complement(524101..524445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0479"
FT                   /product="TM2 domain containing protein"
FT                   /note="PFAM: TM2 domain containing protein; KEGG:
FT                   cyb:CYB_1650 TM2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28897"
FT                   /db_xref="GOA:A9VZZ1"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZZ1"
FT                   /protein_id="ABY28897.1"
FT                   /translation="MGRKSGFLAFVLWLPGLLLICGLHRIYVGRFWTGVLWFFTLGLFG
FT                   IGQLIDLFRLADMVRMANSEGSSDLRYAAPANTVAPVFNVSINSVPLGNPAEQPDMAEG
FT                   GTRRLLQKRL"
FT   gene            524655..524867
FT                   /pseudo
FT                   /locus_tag="Mext_0480"
FT   gene            524921..526312
FT                   /locus_tag="Mext_0481"
FT   CDS_pept        524921..526312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0481"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; Resolvase domain;
FT                   Resolvase helix-turn-helix domain protein; KEGG:
FT                   nwi:Nwi_2917 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28898"
FT                   /db_xref="GOA:A9VZZ2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZZ2"
FT                   /protein_id="ABY28898.1"
FT                   /translation="MGQVLHGSATTTATVRRAIQARQESVRAAAKRYGISPTTVQKWRS
FT                   RQTSTDARMGPKEPRSSVLSLEDEAVIVAFRRHTLLPLDDCLYALQPSLPHLTRSSLHR
FT                   CLQRHGISRLPDVDGDKPKRSRFKAYPIGYFHIDIAQVSTEQGKLHLFVAIDRTSKFAF
FT                   VQLHGRATQRIAAAFLHDLVAAVPYTIHTVLTDNGIQFTDNHPVDEEAEAKAAAYWAER
FT                   DEPRIYRWHSFEWACEQTKIEHRLTKPRCPWTNGQVERMNRTIKDATVKRYHYASHDEL
FT                   RMHLQLFVDAYNYGRRLKTLRGLTPYEFICQTWTKEPERFRLDPSHHMPGPNISSQLIA
FT                   TFDDLDRRGIELRSLTEVIDTTTSGGKLVFHIFGALAEFERSIIRELTLSGLIAARARG
FT                   RLGGRPKLLSSADLDVARVLLRDGTLTVSEVAARLGVIASTLYRYLLAARSTNPKQLNE
FT                   AVPVP"
FT   gene            complement(526452..526919)
FT                   /locus_tag="Mext_0482"
FT   CDS_pept        complement(526452..526919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28899"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZZ3"
FT                   /protein_id="ABY28899.1"
FT                   /translation="MQLPSINMPKWIVAAAKLKGNAFNRIILLGNHPLAEIYSKDCQDM
FT                   NIDFVWLKERRCIFAATEKFEHACLLIIFGKDGAAYLRENLLELKAKLHGLPIVEVFDN
FT                   SWTETDEPFEIKTTPVRIYNDEISHQLLLEMEAIILECYPNSYLNRKAKIQ"
FT   gene            complement(527114..527545)
FT                   /locus_tag="Mext_0483"
FT   CDS_pept        complement(527114..527545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0483"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; KEGG: rfr:Rfer_1464
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28900"
FT                   /db_xref="GOA:A9VZZ4"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZZ4"
FT                   /protein_id="ABY28900.1"
FT                   /translation="MRIVVYADGGCEPNPGTGGWGAVISGTDGAIELYGGELATTNNRM
FT                   ELTAAIRALEHFHDGAQVEMRCDSQYVVKSITEWMPGWKARGWRTSKGLVQNLDLMQRL
FT                   DELNSLHDVCWIWVRGHSGDPRNERADRLAAQGRREVLR"
FT   gene            complement(528568..529146)
FT                   /locus_tag="Mext_0484"
FT   CDS_pept        complement(528568..529146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpn:KPN_pKPN5p08190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28901"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZZ5"
FT                   /protein_id="ABY28901.1"
FT                   /translation="MLPNRSATATPSFPEAGLPERLGPPVTLDAEQQAAAEELINGPRR
FT                   GVYGPFRPLLHRPSLLQAVAKVGETLRYAGTLDGALREWTICIVSRELSNVFEWDMHLP
FT                   LAEAAGVPSAALAAIERGAPLPADLRADLVLAHAVASELVRRHRVSDETYAAALSMWGE
FT                   AITVELLTLVGYFVMVCWLMNVARTPGPQ"
FT   gene            complement(529146..530366)
FT                   /locus_tag="Mext_0485"
FT   CDS_pept        complement(529146..530366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0485"
FT                   /product="protein of unknown function DUF1228"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1; KEGG: rso:RSc0805
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28902"
FT                   /db_xref="GOA:A9VZZ6"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZZ6"
FT                   /protein_id="ABY28902.1"
FT                   /translation="MSTTHSSPAQPSRATRPVVASGLVALAMAMGVGRFAFTPLMPLMI
FT                   RDGTLDATTGTEWAAVNYVGYFVGALTASWFSGNPRRGLLLSLIGVALTTLAMVAVDAV
FT                   PTTLLGVMLRGAAGVFSAWALVCTSSWCLAELARRRAGQLGAWIYTGVGLGIALAGVLA
FT                   WLGGRQRADWLWLELGLIASAGAVLVWTQSRGQSTIPAEIEEREATAIAPTRGSGQLAL
FT                   VLCYGIFGFGYIVPATFLPAMARELAPDPLVFGLTWPLFGLAAALSVAAVAHWLPSTSR
FT                   QRLWALSQGVMALGTALPLFVQALWAVAASAVLVGGTFMVATMAGLQLAREAQPDNPTP
FT                   LLARMTAAFAAGQIAGPLLVRALGSGRWAGWDALGWTGALATLLLVLTAIWLWRSTKPS
FT                   LESLRPV"
FT   sig_peptide     complement(530256..530366)
FT                   /locus_tag="Mext_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.944 at
FT                   residue 37"
FT   gene            530424..531320
FT                   /locus_tag="Mext_0486"
FT   CDS_pept        530424..531320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0486"
FT                   /product="LysR substrate-binding"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RSc0804 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28903"
FT                   /db_xref="GOA:A9VZZ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZZ7"
FT                   /protein_id="ABY28903.1"
FT                   /translation="MVLCMRTMDLDDLHIFRCVVREGGVTRAAHQLHRVPSNVTTRIKQ
FT                   FEERLGVALFRREGRSLTLTDAGRTLLGHAEKLLQLADLAEQELRSGIVRGVLRLGSLE
FT                   SAAGARLPPILSAFHAQNPNVTIELQTGTTRAMLRQLERFEVEAAFVSEPFERGNLSSM
FT                   PAFNEELVLITARGVPTVRQAVELGGRTVVAFPHGCSYRQRLIEWLAEGGASPQRVLEM
FT                   SSYHAIVACVAAGTGAAIVPAEVLDHAVLSTAVERHALPPHLRINRTHLVWSGAASGPL
FT                   QALIALLPSARVDERAA"
FT   gene            complement(531608..532087)
FT                   /locus_tag="Mext_0487"
FT   CDS_pept        complement(531608..532087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0487"
FT                   /product="multimeric flavodoxin"
FT                   /note="KEGG: reh:H16_B2110 multimeric flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28904"
FT                   /db_xref="GOA:A9VZZ8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZZ8"
FT                   /protein_id="ABY28904.1"
FT                   /translation="MLEGADAIIFGTPTYMGSASGTFKTFMDATSQVFVSGAWRDKIAA
FT                   GFTNSGSRSGDKLLTLIELNILAAQLGMHWVSLGMLPGNNRSDGSEEDLNRLGFFLGAA
FT                   AQSNTDQGPESTPPASDLRTAEMLGARVARVTQQFIRGRRATEGARSLPAEAALT"
FT   gene            complement(532197..532439)
FT                   /locus_tag="Mext_0488"
FT   CDS_pept        complement(532197..532439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28905"
FT                   /db_xref="UniProtKB/TrEMBL:A9VZZ9"
FT                   /protein_id="ABY28905.1"
FT                   /translation="MGISAISSPAFAQSISTVRGEKPSSFFTDRPAPNAYDDLTTGSIS
FT                   TGWNRSVDRSSKEGNAELNDRYVPNYGMTSGGPRR"
FT   gene            533775..534593
FT                   /locus_tag="Mext_0489"
FT   CDS_pept        533775..534593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0489"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rpc:RPC_4049
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28906"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:A9W000"
FT                   /protein_id="ABY28906.1"
FT                   /translation="MTYASIMVSLDLGSGSGERTRVAAQLAEHFQARLIGVAAREMDYP
FT                   RGYAETSVLGREATEEIRDAALADVAEVEAAFRLAVGSGRPIEWRSNLTDPEIFLEEQS
FT                   RAADLVVLGRRGGQDLSDPRLAVNAGRALMGLGRPVLMVPPGVDHLSLKRVVVAWKNTL
FT                   QTRRAISDAMPLLKVAQQVQVVRITTDEDNEDLEDVVRYLGLHGVNASAFRKSQNGASV
FT                   ALALEEAAKAFGASLIVSGAYGHNRLREWFFGGVTRALLNHCSVCCLMSH"
FT   gene            535501..535755
FT                   /pseudo
FT                   /locus_tag="Mext_0490"
FT   gene            complement(535771..535983)
FT                   /locus_tag="Mext_0491"
FT   CDS_pept        complement(535771..535983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28907"
FT                   /db_xref="UniProtKB/TrEMBL:A9W001"
FT                   /protein_id="ABY28907.1"
FT                   /translation="MDATRMAVAQEFVEILANRAQRSGACPAQMLREHRRRLASLAKLA
FT                   PDTHFQAIIAELDHWAMKLELSASL"
FT   gene            complement(536033..536533)
FT                   /locus_tag="Mext_0492"
FT   CDS_pept        complement(536033..536533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_0358 signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28908"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9W002"
FT                   /protein_id="ABY28908.1"
FT                   /translation="MFIDECDLLPPDRGWNYEPARAELLQKISAPLYTTDAEGLLTYYN
FT                   DAAAELWGRHPVVGEERWCGSWRIFDTDGKLLMREQWPLAVAFQQGSSVRGLQAVLEQP
FT                   DGTRVPVMPYPALLRDRSGIVVAGSNILLKITQPSARHDQSSAPSNSERGQVRVLERSL
FT                   APS"
FT   gene            536930..537253
FT                   /locus_tag="Mext_0493"
FT   CDS_pept        536930..537253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_1250 phasin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28909"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:A9W003"
FT                   /protein_id="ABY28909.1"
FT                   /translation="MRDFAEMSVEQARAALIVFMQSARKATESVQAQTRAAELPVSVAY
FT                   VRGLELFENNLAATFDVAQKLVRTSSLQDALQIQSEYVHAQFASLQSQAKELISAAQPA
FT                   KAA"
FT   gene            537456..537647
FT                   /locus_tag="Mext_0494"
FT   CDS_pept        537456..537647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28910"
FT                   /db_xref="UniProtKB/TrEMBL:A9W004"
FT                   /protein_id="ABY28910.1"
FT                   /translation="MLRQTEVQTAQGKSIAVACKEADVSERGPSSAYGGGRFRSEGRRR
FT                   GKEAPPLASTWSAGAWFY"
FT   gene            537817..539541
FT                   /locus_tag="Mext_0495"
FT   CDS_pept        537817..539541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0495"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; histidine kinase HAMP region domain
FT                   protein; KEGG: azo:azo2649 GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28911"
FT                   /db_xref="GOA:A9W005"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A9W005"
FT                   /protein_id="ABY28911.1"
FT                   /translation="MLRLTNKVPLRRQISLLAGAIGLIVVGVTTVGSALLARGQAADMA
FT                   QDALRQVARSMADRLDQDMAERLREIRNVASLEPLRPHWLENTGNLRTVLDAMQRTLPD
FT                   YAWIGFADQDGRVRAATGGILEGASVGQRPWFLNGIRQAAVEDVHAANLLQSLLKPHAD
FT                   GTPFRFVDVAAPVSDSSGRIVGALGAHLSWRWADVVRREVLSSRRPELKEDIIVLDRSG
FT                   RVLLGPDLAEAPFTAAELVAGHFIDHRTGGDRLAAAASTRGRGDYAGLGWIVVALQPVD
FT                   TALAGANRLTSLILFVGLGAAVLGMIGIGIIAGRLSRPLTRLTEAVDRIGRQPNARMTD
FT                   RVHGSPEVLRLSTAIRSLLRRIGTAEEDARLSRAEATDKVHAAEDRVRRLGADLHAMQV
FT                   LADTDALTGLLNRRAFLPLANDAMSYFMRYRRSICVLMIDIDHFKRVNDLYGHAAGDEV
FT                   IRQVGRIIRDAIRATDKVARFGGEEFVVLLRETDLQGAVIFAERIRQTVAGTVFEPEGQ
FT                   CLRATISIGMAGAEVTDDDIDHTIERADRALYAAKSGGRNCVRTFEDRPSRDLRAAA"
FT   sig_peptide     537817..537936
FT                   /locus_tag="Mext_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.291 at
FT                   residue 40"
FT   gene            540368..540658
FT                   /locus_tag="Mext_0496"
FT   CDS_pept        540368..540658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28912"
FT                   /db_xref="GOA:A9W006"
FT                   /db_xref="UniProtKB/TrEMBL:A9W006"
FT                   /protein_id="ABY28912.1"
FT                   /translation="MFLIMFAAIPAGLLAMSFTASTSLLLALMAGPLVGSLTGFCAALF
FT                   LAWYRGSEWKSDHDFDQQTDAMVGALRALAEQGGAVDAAPAIRTTKPSRAA"
FT   sig_peptide     540368..540460
FT                   /locus_tag="Mext_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.479 at
FT                   residue 31"
FT   gene            540990..541199
FT                   /locus_tag="Mext_0497"
FT   CDS_pept        540990..541199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28913"
FT                   /db_xref="UniProtKB/TrEMBL:A9W007"
FT                   /protein_id="ABY28913.1"
FT                   /translation="MATSVLAAPMSADDKAALQQQCMGDFTTFCGDMPLEDGPETQACF
FT                   EKNMSKLSPSCQGAIQSYKQGKKG"
FT   gene            complement(541630..542445)
FT                   /locus_tag="Mext_0498"
FT   CDS_pept        complement(541630..542445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:RL3648 putative galactosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28914"
FT                   /db_xref="UniProtKB/TrEMBL:A9W008"
FT                   /protein_id="ABY28914.1"
FT                   /translation="MAEPFTFGIPLIARDAASNWPLVEALLSLTIRSVAAQTDPSFRVV
FT                   IAGHDRPAFAPIDPRITFIAADWPAESVRADNLDSGRKKHLISQHILAEGGGLLMFLDS
FT                   DDWIDRRLVEAARTMIPSEALGGYIADGFISDIRANRAVRLPDKHIFDGDFQRLCGSSI
FT                   VARLVPKAPDALRRNPHAVLHEHYRWPETAQERGGEAVPLPVNGAYVINSSVNHSEVHG
FT                   PFSSWRRSLSSAVGEAGFPMSDEFLSEFGLRAQDVAQTVGRHLRGLQMG"
FT   gene            complement(542458..543459)
FT                   /locus_tag="Mext_0499"
FT   CDS_pept        complement(542458..543459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO2649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28915"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9W009"
FT                   /protein_id="ABY28915.1"
FT                   /translation="MRIAAHPTDPPRPIRTLLVATMRNEGPYIPEWLAYHRAIGFTDIV
FT                   ICTNDCVDGSPALLDRLQALGLLTHLPHIVEPGDKPQLAAYARAETLPILREADWVMVL
FT                   DADEFLNIHVGEGRVIDLIRAVPGSTAVLVNWRVFGSSGHRTWSSGFVTERYTRAASLE
FT                   HGVNRSYKTLFTRTEAYGCKLLPHQPRFPRPEALRTLRYVDGAGSTLPARYYDESCGDF
FT                   LQSEPGAVSWKLAQINHYNTRSWEDYIVKHRRGGGLNVDWAREANWPVFDRNEEEDLSI
FT                   AAKLPVVRASYDKLLMDEGIRTLHEQCCHLYATHVGVLARDVTAAYCGSEPC"
FT   gene            complement(543899..544837)
FT                   /locus_tag="Mext_0500"
FT   CDS_pept        complement(543899..544837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_3881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28916"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A9W010"
FT                   /protein_id="ABY28916.1"
FT                   /translation="MLEAVMLWNEPNNKSHWDPEIDPDWFLFGEMVKDTSRAIRAEAPS
FT                   LSQVLGGISPIDPHFMRRMQAQGVLDGLDAVAVHGFPLDWNLWQIHEWPQKIAEIRAVT
FT                   HLPVWVSEVGVSSFGAEEVQAWGCRRTAELLTGQAPRIHWYSLYDLPLEWGATTRHKEA
FT                   EGSSYYRHFHMGLLRQDGTPKLALEEFARCTPEFGLCQWFHFEDHRLDEAVAWMKRLGV
FT                   THLRTGLSWADSFRPNALDWFDRQMEALRDFQVTATFCFTPEHRGIAPHHTSAPLVREE
FT                   FAEFCAAMVRRYAGSRTARVAAPPVPEAALP"
FT   gene            complement(544837..545601)
FT                   /locus_tag="Mext_0501"
FT   CDS_pept        complement(544837..545601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0501"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bra:BRADO2072 putative
FT                   3-demethylubiquinone-9 3-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28917"
FT                   /db_xref="GOA:A9W011"
FT                   /db_xref="InterPro:IPR027554"
FT                   /db_xref="InterPro:IPR027555"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9W011"
FT                   /protein_id="ABY28917.1"
FT                   /translation="MNQADLRRQAEALGPWFHNIDLGEGVWTAPNHFLGDYPGFKWRRF
FT                   AQALPDDLTGKSVLDVGCNAGFYSVEMKRRGAARVLGLDSDEHYLAQARFVAERLGYDI
FT                   EFRNLSVYDVGRLGERFDVVIFMGVFYHLRHPLLALDLIHEHVADDLLVFQSMLRGSLK
FT                   VEPVAEDYDFFDMDAFERPGYPRMHFVEHSYAHDCTNWWIPNRAGIEAMLRSSGFSIQN
FT                   RPEAEVYLCRRVEAPYGAEAAYPARPVGQRET"
FT   gene            complement(545598..546203)
FT                   /locus_tag="Mext_0502"
FT   CDS_pept        complement(545598..546203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0502"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: sme:SMb20250
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28918"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A9W012"
FT                   /protein_id="ABY28918.1"
FT                   /translation="MRRALFLRHGSHDRLERILCGRMPGVSLSEAGRVEARTVAEGLAR
FT                   RLAGERDLRLLSSPQPRTRETAAPLAEALGVEAEIRDELDEIAFGDWTGKPFAELEGDP
FT                   VWTAWNTQRGSARPPGGESMGAVQARVGGLLDRLAAEEGAPVILVSHCDPIRAALLTVL
FT                   GLSLDAYDRIVVAPASCSELELWPGGGRVVSLNERLAG"
FT   gene            complement(546200..547291)
FT                   /locus_tag="Mext_0503"
FT   CDS_pept        complement(546200..547291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0503"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /note="PFAM: Myo-inositol-1-phosphate synthase;
FT                   Myo-inositol-1-phosphate synthase GAPDH domain protein;
FT                   KEGG: mes:Meso_2694 myo-inositol-1-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28919"
FT                   /db_xref="GOA:A9W013"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9W013"
FT                   /protein_id="ABY28919.1"
FT                   /translation="MAAMNAEPIRVGIVGVGNCASSFVQGLHYYRETAAGEAVPGLISP
FT                   ELGGYRIGDIEIVSAFDVSAGKVGQDVAQAIHARPNNTHVFADVPPTGVTVRRGPTLDG
FT                   IGRYLEGVIPESPEPVADVVEALQRSRTQVLVNYLPVGAQRATEFYARCALDAGCALVN
FT                   CIPVFIASDDAWRARFEARGLPVVGDDIKSQVGATIVHRVLANLLRERGVKLERTYQLN
FT                   FGGNADFLNMLERERLESKKLSKTRAVTSQLGAPLPPGDIHVGPSDHVPWLEDRKWAQI
FT                   RLEGTGFGGVPLNIELKLEVWDSPNSAGIVVDAVRCARIALDRGVSGALDGPSAWFMKS
FT                   PPVQYTDAEAHARTLRFAAGEPA"
FT   gene            complement(547291..548361)
FT                   /locus_tag="Mext_0504"
FT   CDS_pept        complement(547291..548361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0504"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: mes:Meso_2774 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28920"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9W014"
FT                   /protein_id="ABY28920.1"
FT                   /translation="MRSGAMDGQDGRHVLVAGGAGFIGSHLVDALLARGARVVALDSFL
FT                   TGRRDNLAHLAREPRFELVEADVTRPLPPLPRFDRIFNLACAASPPHYQADPMHTMMTS
FT                   VVGTNHLLERANDDGARFLQASTSEVYGDPEVHPQTESYWGNVNPTGPRACYDEGKRSA
FT                   ETLAYDFERVHRLDVRVARIFNTYGPRMRADDGRVVSNVVCQALAGEPITVYGNGEQTR
FT                   SFCYAADLVEGLMRLMDHEISPGGPVNLGNPCEMTVAELVDLVTRMTGTRSAVVRRPLP
FT                   VDDPQRRRPDITRAETLLGWSPQVPLEQGLEATIAWFAKEIRPPEPAVPSLGRFVGSRT
FT                   FQPAASSLGDLAQGPR"
FT   gene            complement(548484..549605)
FT                   /locus_tag="Mext_0505"
FT   CDS_pept        complement(548484..549605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_1058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28921"
FT                   /db_xref="UniProtKB/TrEMBL:A9W015"
FT                   /protein_id="ABY28921.1"
FT                   /translation="MTDRPLRLVVLGLSLSSSWGNGHATTYRALLKAFAARGHAVTFFE
FT                   RDVPWYAAHRDLPDPDFCELVLYSDLAELQAHRAEIQEADAAIVGSYVPDGIAVGNRAL
FT                   AWARGVRAFYDIDTPVTLAGLEAGACAYLSRAQIRDYDLYLSFTGGPTLERLERAYGSP
FT                   AARALYCSVDPQAYPALERAPAYDLSYLGTYSPDRQPTLERLLIEPARRAPELRFAVAG
FT                   PQYPAGIDWPDNVTRIDHLPPDAHPEFYAASRYTLNVTRADMIAAGWSPSVRLFEAASI
FT                   GTPLLSDGWDGLDAILAPGREILLPETPEAVLAILRDQRDAERRAIGAAARAAVLARHS
FT                   AAHRAAELEANLREAAARREAGVTAPERDLEVL"
FT   sig_peptide     complement(549531..549605)
FT                   /locus_tag="Mext_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.867) with cleavage site probability 0.805 at
FT                   residue 25"
FT   gene            complement(549602..550714)
FT                   /locus_tag="Mext_0506"
FT   CDS_pept        complement(549602..550714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_2776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28922"
FT                   /db_xref="UniProtKB/TrEMBL:A9W016"
FT                   /protein_id="ABY28922.1"
FT                   /translation="MKRIAFYGSSLLSSYWNGAATYYRGLLRDLAGRGYHITFYEPDAF
FT                   DRQSHRDIDPPDWAEVRVYPATQEAMRSVVAEAVRADIVVKASGVGVFDDALLAGVTAA
FT                   ARPDAIRIFWDVDAPATLAEMRGDPGHALHRAMPDLDLVLTYGGGPPIISAYEGFGARA
FT                   CIPVYNALDPQTHHPVPPDPRFAADLAFLGNRLPDREERVQKFFLVAAARLPERQFLLG
FT                   GSGWESRGLPVNVRHLGHVSTRDHNAFNVTPLAVLNIARESMAAVGYSPATRVFEAAGA
FT                   GGCLITDAWVGLDLFLKEGEEVLVARDGRDVADHVAALTPERARAIGEAARRRILAEHT
FT                   YARRGAQVDAILTEEAARKRECRPIERSVA"
FT   gene            complement(550711..551832)
FT                   /locus_tag="Mext_0507"
FT   CDS_pept        complement(550711..551832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_2428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28923"
FT                   /db_xref="UniProtKB/TrEMBL:A9W017"
FT                   /protein_id="ABY28923.1"
FT                   /translation="MRIVYFTHSLASCWNHGNAHFLRGVLRELIAEGHAVEAYEPEGAW
FT                   SLDNLLRDRGPAGLDTYRAAYPELSSQTYRHADEAVEWAEGADLVIAHEWNAPHLIAAL
FT                   GRARKNGRFGTLLFHDTHHRAVSAPEEMAAFDLSGYDGVLAFGEALARVYRAQGWDGRA
FT                   FVWHEAADTRLFHPPVEETERAGLVWIGNWGDGERTSELVTFLFRPAQAAGLALDIYGV
FT                   RYPEEALATLERFGARYHGWAPNAAAPSLFARALTTVHVPRRFYVAALPGIPTIRVFEA
FT                   LACGIPLASAPWEDAEGLFTPGEDYLVARNSAEMERHLRALAHDPDLRRALAARGLATI
FT                   RARHTCRHRAAELLAIAASLAAPAASPRNWRRA"
FT   gene            complement(551829..552965)
FT                   /locus_tag="Mext_0508"
FT   CDS_pept        complement(551829..552965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0508"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rsq:Rsph17025_2429 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28924"
FT                   /db_xref="GOA:A9W018"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9W018"
FT                   /protein_id="ABY28924.1"
FT                   /translation="MPVRPAPAHILMTADALGGVWQYSLELAEGLGRRGLSVTVALMGP
FT                   APSDAALARAEAASGARIRPTGLPLEWTAGRPEDVTGAAAAIARLARAEGADLVHLHSP
FT                   ALAMAAFDVPVVAVCHSCVATWWAALGSGPLPDDLAWRADLAARGCRTADRLLAPTRAF
FT                   AEATRAAYGLAHAPEVVRNGRRLPDVPSVGEPASHAFTAGRLWDRAKNATTLDRLAGRL
FT                   GAPVYAAGPAEGPNGECFGGKHLRLLGRLDAARMERELAQRPVFVSLARYEPFGLAVLE
FT                   AAGAGCALVLSDIPSFSELWEGAALFVSPDDDAAAAEAVRNLLADSERRASLADAARER
FT                   AAHYGTEAMADGVLAVVRGLLGETRSHTHVRPLSGAAA"
FT   gene            complement(552956..554248)
FT                   /locus_tag="Mext_0509"
FT   CDS_pept        complement(552956..554248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0509"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: bra:BRADO2067 putative Fe-S
FT                   oxidoreductase homolog to magnesium-protoporphyrin IX
FT                   monomethyl ester (oxidative) cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28925"
FT                   /db_xref="GOA:A9W019"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR027559"
FT                   /db_xref="UniProtKB/TrEMBL:A9W019"
FT                   /protein_id="ABY28925.1"
FT                   /translation="MRVALANPAWDYRNSIYFGCREPHLPLELGYAAALLRAAGHEALI
FT                   VDAHLEGLTTDEAADRVAAFAPGMTVVTTAPTYLFWRCAPPELRVPRLFLDALRGRGGR
FT                   TVAVGPHGSATPRPTLEKLGCDFVVRGECEEIVARLADAEDPRTVPAIAYREGEETVVT
FT                   GLPHAGGFTDLPALHWPDAWIARHHHHHHRFDTTPDGPGAEVEASRGCPYTCSFCAKID
FT                   FRDKYRRRDLEIVLDEIDGLIAQGATYLYFVDEIFLPQKPLLEALVDRTIKFGVQTRID
FT                   LWKPDMLDLLGAAGCVSIEAGIESLTEEGRAALDKRCRASTDDLAERLIYARRSVPFVQ
FT                   ANLIAVAGDDPDLVARWRDRLRGQGVWANDPVPLYPYPSSPDYRRLWGEPDDGAWERAH
FT                   AHYLGLFERFSDIQEERPLPLSELEAGCGCR"
FT   gene            complement(554245..555348)
FT                   /locus_tag="Mext_0510"
FT   CDS_pept        complement(554245..555348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0510"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: ret:RHE_PB00053 probable nucleoside diphosphate
FT                   epimerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28926"
FT                   /db_xref="GOA:A9W020"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9W020"
FT                   /protein_id="ABY28926.1"
FT                   /translation="MSAAGPGPGPDRRPILVTGGAGFVGANLADRLAAEGHTVIIYDAL
FT                   ARAGVERNLAWLTERHGDRIAPVIADIRDRDELARAVGEVGAVFHFAAQVAVTTSLTAP
FT                   RDDMEVNLGGTLNLLEALRARGEAVPLLFASTNKVYGSLPDVALTLAGDAYLPEDPSLR
FT                   QRGIGEDRPLDFHTPYGCSKGAADAYVLDYARTYGLPTVVMRMSCIYGPRQMGNEDQGW
FT                   VAHFLIRALKGEPITLYGDGRQVRDILHVGDCVAAYQAALARIDRVAGRAFNLGGGPAN
FT                   AVSLRGLIAHAGQLLGREIAVETGPWRPGDQRYYVSDPSRAVEALGLARPLSWREGVAQ
FT                   LAGWLGERVGDDQAAEPRLRRQPEAAL"
FT   gene            complement(555345..556511)
FT                   /locus_tag="Mext_0511"
FT   CDS_pept        complement(555345..556511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0511"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; Male sterility domain; KEGG: afw:Anae109_3216
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28927"
FT                   /db_xref="GOA:A9W021"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9W021"
FT                   /protein_id="ABY28927.1"
FT                   /translation="MSFVVSDLLQGRGSRASPMENLVLITGGAGFIGRHLASALIARDY
FT                   RVRVLDSLIEQVHGAGGGPAALDPSVEFVEGDVRDGEAVARALDDVTHVVHLAAEVGVG
FT                   QSMYAVERYVSVNDCGTAVLFQAMIEAPVKRVVVASSMSIYGEGLYRTEGGALVEDAVR
FT                   KARKPGEPWDPLGADGHPLRPVPTPETKRPALASVYALTKYMQERLTLTLAPAYGMEGV
FT                   ALRLWNAYGPGQALSNPYTGVLAIFAARLLNGQPPMIFEDGEQRRDFVHVEDVAQAFVL
FT                   ALEHPAAVGQVYNVGSGQDRTVNEVARLLARAMGREDIAPQTTGQARLGDIRHCIADIG
FT                   KITRELGYAPKRDFAEGLAELAAWVAEQQAVDRVAEARRELEARGLVA"
FT   gene            complement(556903..557151)
FT                   /locus_tag="Mext_0512"
FT   CDS_pept        complement(556903..557151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0512"
FT                   /product="short chain oxidoreductase"
FT                   /note="KEGG: sco:SCO0647 short chain oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28928"
FT                   /db_xref="UniProtKB/TrEMBL:A9W022"
FT                   /protein_id="ABY28928.1"
FT                   /translation="MPGPTETNFFHRAEMIDTKIGASNSKDDPASVAEAVFAALQADSG
FT                   RVVTGLKNKNMSAVTEALPDRAAAALHRGMPKPGSAA"
FT   gene            complement(557153..557296)
FT                   /pseudo
FT                   /locus_tag="Mext_0513"
FT   gene            complement(558034..558399)
FT                   /locus_tag="Mext_0514"
FT   CDS_pept        complement(558034..558399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:RL1211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28929"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A9W023"
FT                   /protein_id="ABY28929.1"
FT                   /translation="MFTHATIGSNDLERARGFHDATCTALGGKPGEREARGRLISAHDG
FT                   GRLLITKPIAAIRRLRQDYQCCCGKSAYIPAWHEVGATNGGTAFEGSPSEHPNRSFADC
FT                   LRDPDGSKRTARCPAAK"
FT   gene            complement(558559..560289)
FT                   /locus_tag="Mext_0515"
FT   CDS_pept        complement(558559..560289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0515"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; cytochrome c biogenesis protein
FT                   transmembrane region; Redoxin domain protein; KEGG:
FT                   ret:RHE_CH02415 putative cytochrome biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28930"
FT                   /db_xref="GOA:A9W024"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041017"
FT                   /db_xref="UniProtKB/TrEMBL:A9W024"
FT                   /protein_id="ABY28930.1"
FT                   /translation="MTLYLAAFLAGMLTIVSPCILPVLPFVFARADRSFVSSTLPFLTG
FT                   LVAAFAAAASLAAVGGGWVVRLSAAAHVAALVLLGVFAVALMSQRVAALISVPSVWLGE
FT                   ALARRVDRRGSTGVVSSLGLGAATGLLWTPCAGPILGLVLTGAVLSGPSPETTGLLVAY
FT                   AAGAAMSLAAAVAAGGALYARLRGGLAFSEQVRRIKGAAMIAVVAAIAVGFESDLLASL
FT                   PSPQATRVEAALVAALHLEPTQPAPAAGLYRSSLPVERRLPSLQGASHWLNAGPPTNEQ
FT                   FRGKVLLVHVWTYSCINCIRTLPYIRAWEVRYRDQGLAVIGVHAPEFAFERDIDNVRSA
FT                   VRRFALPYPIAVDNDFRIWRALRNTSWPALYIVDAEGRIRHHQFGEGGEAQSEAAIQDL
FT                   LAEGAVRRTAEVSVTVPRPDGPEIPADLGELRSGETYLGADKTEGFVSPEGLSRRTQTY
FT                   SPAGPKLNQWSLSGNWSFGPDAVRLDQEGGGITYRFRARDLHLVLGPGADGRPVRFRVA
FT                   LAGQPPRTDHGSDITPDGDGIVTETRLYHLVRQSSPVEERTFEIYFQDPGVRAYAFTFG
FT                   "
FT   sig_peptide     complement(560200..560289)
FT                   /locus_tag="Mext_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.792) with cleavage site probability 0.407 at
FT                   residue 30"
FT   gene            560545..561288
FT                   /locus_tag="Mext_0516"
FT   CDS_pept        560545..561288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0516"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: pfo:Pfl_2086 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28931"
FT                   /db_xref="GOA:A9W025"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9W025"
FT                   /protein_id="ABY28931.1"
FT                   /translation="MNHIDHVLIVDDDREIRDLLSNYLRKNGLRVTLAADGRQMRAFLD
FT                   ADRVDLVVLDVMMPGDDGLVLCRELRSGRHKATPVLMLTARSDETDRIVGLEMGADDYL
FT                   VKPFAARELLARIKAVLRRTRMLPPNLQVTEAGRLLAFGAWQLDTTTRHLIDATGTVVP
FT                   LSGAEYRLLRVLLDHPQRVLSRDQLLNLTQGRDAELFDRSIDLLVSRLRQRLKDDAREP
FT                   SYIKTVRSEGYVFAMPITIAQAREG"
FT   gene            561288..562586
FT                   /locus_tag="Mext_0517"
FT   CDS_pept        561288..562586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0517"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: reu:Reut_B3910 ATP-binding
FT                   region, ATPase-like:histidine kinase, HAMP region:histidine
FT                   kinase A, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28932"
FT                   /db_xref="GOA:A9W026"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9W026"
FT                   /protein_id="ABY28932.1"
FT                   /translation="MGSLLGWPGSLRGRLFLILLAGLASAQLFSFVVITAERDQTARAI
FT                   MLTTLQRDVAVAVALLDRLPAPQRPEWVPLLDRPTYGFALGSGAPGSAMLSSRLTMIAN
FT                   EIRTALEPRFPVRFDAVSGPPDRLQGHVALSDGSALTIVVQPAHWPVASWLPVALAVQL
FT                   LVLVGCVWLAVRLAVWPLTRFAQAADALEPGQPATRFAEAGPDEVARAARALNAMQERV
FT                   ARHLDERVRILAAISHDLQTPITRMRLRVETGVEGPEQDRILGDLEAIEALVREGIAYA
FT                   RSVHGDVEPPARLDLRAFLESIVFDYQDTGRDVAVAALPDVTIVTRPQALRRILTNLID
FT                   NSIRYAGRAELDLRIADGSISIAVLDRGPGIPADKLDAVLLPFVRLERSRSRETGGTGL
FT                   GLAIADQLASAIGGRLTLSNRPSGGLKAVVTLS"
FT   sig_peptide     561288..561395
FT                   /locus_tag="Mext_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.439 at
FT                   residue 36"
FT   gene            complement(562616..564217)
FT                   /locus_tag="Mext_0518"
FT   CDS_pept        complement(562616..564217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0518"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_CH01180 probable ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28933"
FT                   /db_xref="GOA:A9W027"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9W027"
FT                   /protein_id="ABY28933.1"
FT                   /translation="MPAHLSLLNITWTAPDGRTVLSDISASFAQERTGIVGRNGAGKST
FT                   FLNLVAGRMRPTSGSIIVNGTVALLRQFASIPPDETVADLFGATAKLALLRRAEIGAAT
FT                   ADELAEAEWTLEERLTEALDRMGVPVNPAARLCCLSGGQRARAALAAAMFAGPDFLLLD
FT                   EPTNDLDWDGRQTVCEALRHWRGGAIVVSHDRSLLDAMDVIVELSPSGATRYQGNFDAY
FT                   QEAKAIRIAAAEHDLAVAEKRTAELARRAQETVERQQHRDAAGHRRGARGDLPRILVGA
FT                   RRDNAEKTAGGSARAAERLRSEAQQKVEEARSRIEAVKAVSITFPPSCLHAAKAVLSIE
FT                   RVTVGYQPGQPILEDVSLSIIGPERIAISGRNGAGKSTLLELIVGHLSPWSGRVSVGVR
FT                   SARLDQRLAVLDHSRTVVENFARHNPEDDANGCRAALARFQFRSAAADRPVSALSGGQQ
FT                   VRAALACVLGNAAPPQLLLLDEPTNHLDLEAVEAIEAGLASYDGALLVVSHDKAFLRAL
FT                   RITRWLTLEDLTRKFD"
FT   gene            564594..565619
FT                   /locus_tag="Mext_0519"
FT   CDS_pept        564594..565619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0519"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bbt:BBta_1119
FT                   putative hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28934"
FT                   /db_xref="GOA:A9W028"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9W028"
FT                   /protein_id="ABY28934.1"
FT                   /translation="MPEQSHLTRRHWMRTAGALLVAGPAMSAEAVAAQPAGPAASQASF
FT                   GPLKQIVTSDLNVAYVEAGPPTGQPVLLLHGWPYDIHSYIDVVPVLAAVGYRVLVPYLR
FT                   GYGATRFLSDTTPRNGQQAALAIDALEFLNALKIETALVAGYDWGARTACILTALWPER
FT                   CRGLVSVSGYLIGSQAANAMPLPPSAELQWWYQFYFATERGRGGYARYTKDFARLIWQL
FT                   ASPKWQFSDDTFARSAQAFENPDHVAVSIHNYRWRLKLAQGEARFDETERKLAGFPTIA
FT                   VPTITMEGDANGAPHPEPATYAKKFTGRYEHRLISGGIGHNLPQEAPQAFAQAVIDVDG
FT                   F"
FT   sig_peptide     564594..564692
FT                   /locus_tag="Mext_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.586 at
FT                   residue 33"
FT   gene            565603..566124
FT                   /locus_tag="Mext_0520"
FT   CDS_pept        565603..566124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0520"
FT                   /product="putative cytochrome P460"
FT                   /note="KEGG: pfo:Pfl_2256 putative cytochrome P460"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28935"
FT                   /db_xref="InterPro:IPR032033"
FT                   /db_xref="InterPro:IPR038142"
FT                   /db_xref="UniProtKB/TrEMBL:A9W029"
FT                   /protein_id="ABY28935.1"
FT                   /translation="MSMASDLRPRRRLLIPASALALGLALTATAQEAGKPASPIFGVTV
FT                   PDGYRAWQLIAPALEGEPLNELRAVVGNDVAVKAYTSGTLPFPDGTVLVKLAWQHVPSP
FT                   EFEPATVPDRATTVQVMVKDAKRYPETGGWGFGRFVDGKPVDEAQHQTCLACHEARVKD
FT                   RDYVFTRYAR"
FT   sig_peptide     565603..565695
FT                   /locus_tag="Mext_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 31"
FT   gene            566114..567241
FT                   /locus_tag="Mext_0521"
FT   CDS_pept        566114..567241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0521"
FT                   /product="adenylyl cyclase class-3/4/guanylyl cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: sme:SMc00621 adenylate cyclase 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28936"
FT                   /db_xref="GOA:A9W030"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A9W030"
FT                   /protein_id="ABY28936.1"
FT                   /translation="MPAEAPTAGRVQSGGLVYHGPTPPFRAGFWIVAPVIGMLAGLLYG
FT                   LIFDVELLVSGIRGAFIGAPVLLYERGLLFQTWRDLIRRAATPIFVATTLATYIAMIAA
FT                   GNAGAGTVLHHAFGYMPNPRVAMLMSDAGLAYALGISALSAFVFRVRDLIGPRVFANLL
FT                   IGRYHRPIREERIFLFLDVAGSTRFAEQHGDLAAQRYLGAIFSALALPVHRSRGSIDDY
FT                   VGDMALVSWTMKRGTREAACLRCVFDFAQVIAGDAERWVAEFGQVPGFRAALHCGSVVT
FT                   AEIGLERHKIAYFGDTLNSTSRLESVAKELGVSILVSGDLLDRLGTLPSGIIVEDLGSR
FT                   AVRGRHEPLRIAAVHNGFGPSSTSQASAMHSAETG"
FT   gene            complement(567786..568067)
FT                   /locus_tag="Mext_0522"
FT   CDS_pept        complement(567786..568067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28937"
FT                   /db_xref="UniProtKB/TrEMBL:A9W031"
FT                   /protein_id="ABY28937.1"
FT                   /translation="MPTGNNTSMPDLGKGAILIWLKEGLEPGKGQFGAKPDGVNPKPVS
FT                   WSRFDLALSFAMHDPRTDERLPWIKTGGRVIRPTELRAMFGAAEGLLG"
FT   gene            complement(568212..569384)
FT                   /locus_tag="Mext_0523"
FT   CDS_pept        complement(568212..569384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0523"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rme:Rmet_1715 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28938"
FT                   /db_xref="GOA:A9W032"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A9W032"
FT                   /protein_id="ABY28938.1"
FT                   /translation="MVPYIDAGTVISISGEAPASAPATNLHAEIRIASIEVAPPLDHQG
FT                   GRGGTLRELPLVLRTLGFEPDAIIGGYGLNPRLLDNGDNPLPATSVGGLLEACVTTTGC
FT                   RHVGLLVGARARTSCFGMVGLLMQHLPTVSDALRCLISHGHLYHPGAVSILDATDGTAM
FT                   LRYRFSPADAPGGIQMVDGALASGFRMMQALCGPDWTPVEVLLSHPGGGDEEAYRRVFD
FT                   VPVRFGQEATALVFDAEWLSHPVPGADPGFRAILELQVDALEHLHDEALSSQLRRSLRT
FT                   LLLRKGCSAGRTAQLFAMHRRTMSRRLKAEGHSFQHLVDEVRYDIARHLLGNASMPLAE
FT                   VAAALGYSEASAFTRAFRRWSGLNPKAWRLGAVVRHGLPEPAVAPALPVV"
FT   gene            complement(569640..570524)
FT                   /locus_tag="Mext_0524"
FT   CDS_pept        complement(569640..570524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_1623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28939"
FT                   /db_xref="GOA:A9W033"
FT                   /db_xref="InterPro:IPR025902"
FT                   /db_xref="UniProtKB/TrEMBL:A9W033"
FT                   /protein_id="ABY28939.1"
FT                   /translation="MKSLKLLGQRTLVAVLGLITVWLILVLFYDVADRRLPLVLALACT
FT                   YVAAAYLILPRAIRLGAHILNRRRVPSYTLTGDGLPGDPVNLVLIGTFDDLRRAFALAG
FT                   WTQADSLGIRSSWRMACAFVLNRPYPSAPFSTLFLFNRGQDAGFQCSIGGSPRKRHHVR
FT                   FWGLSAERDEASLDRVAFWLASGSPAASERAMWVGAATKDIGLSLTSLSFQVTHATDVD
FT                   ADAERAYLVRVLTEHSGIGPVRYHRPGERLTVGAVNRYLSDGLLAVADLRPGPDHPLPL
FT                   DGLTPIDAVVKSV"
FT   gene            complement(570601..571077)
FT                   /locus_tag="Mext_0525"
FT   CDS_pept        complement(570601..571077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28940"
FT                   /db_xref="GOA:A9W034"
FT                   /db_xref="UniProtKB/TrEMBL:A9W034"
FT                   /protein_id="ABY28940.1"
FT                   /translation="MDRSMSLFQELLARPPTLSTPSKYTAANGLIYLAAGTLLIAWPGA
FT                   TQTLFGDRAFVGDEQGLVRVIGVAVAVIGWLYLFGGRSGARQMVAATVVNRLTFVPAVL
FT                   LPLAASEVFPHLLVTFGILDPALAVGTWFLFGRDDAKAIGAETKAPESLPQPLP"
FT   gene            complement(571349..573043)
FT                   /locus_tag="Mext_0526"
FT   CDS_pept        complement(571349..573043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0526"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: bja:bll5074 putative
FT                   arylsulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28941"
FT                   /db_xref="GOA:A9W035"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A9W035"
FT                   /protein_id="ABY28941.1"
FT                   /translation="MSHDDTHEKHQECPGTGSALSRRSILLTGTSALAAAALVSTAQAQ
FT                   QQTQQQPTAVGQKPNIIVIMGDDIGIWNIGAYHRGMMAGRTPHIDQLAAEGMLFTDYYA
FT                   EASCTAGRAAFITGELPIRTGMTTVGQAGAAIGIPAEAVTIATALKGMGYATGQFGKNH
FT                   LGDKNEFLPTVHGFDEFFGYLYHLDAMEDPAHPAYPQELLNRVGPRNMVHSWATNVDDP
FT                   TDDPRWGRVGKQRIEDAGTLYPKRMETIDDEIRDLALGFIDKAKANGKPFFVWLNPTRM
FT                   HVTTHLSPKYQAMRNSKNGWSIQEAGMAQIDDVVGAVMKKLKDLGVDDNTIVVFTTDNG
FT                   TEVFTWPDGGQTPFAQSKGTVMEGGFRAPAMVRWPGKVPAGTVDNGVISGLDWFPTLVA
FT                   AAGNPDIGEELKKGKQIADQTYKVHLDGYNQLDLITGKGPSKRNEVWYFGESELGAVRI
FT                   GDYKYRFIDQPGGWLGDKTKPDVPYITNLRLDPFERTGWPDSGTKIGTQNYMNWFLYEF
FT                   WRFTFVQQEVEKLAMTAVEFPPMQKGASFNLEAVKAKIVAARSAMGK"
FT   sig_peptide     complement(572909..573043)
FT                   /locus_tag="Mext_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.893 at
FT                   residue 45"
FT   gene            complement(573046..574023)
FT                   /locus_tag="Mext_0527"
FT   CDS_pept        complement(573046..574023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0527"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   bja:bll4742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28942"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A9W036"
FT                   /protein_id="ABY28942.1"
FT                   /translation="MSAGFADDVGFSSKAEDTSGMRWISGGTFRMGSDRHYPEEAPIHR
FT                   VAVDGFWIDEAPVTNRQFSQFVLATAYRTVAEIEPDPKDYPGALPHLLFAGSLVFTPTP
FT                   GPVDLRVCSQWWRFLKGADWRRPYGPGSSIKGLDDHPVVQVAYKDAEAYSDWAGKALPT
FT                   EAEWEFAARGGLDGAEFAWGADFMPEGRQMANIWQGEFPHQNLSRRAFKRTTPVGAFPP
FT                   NAYGLVDMIGNVWEWTSDWFAEKHQGDAKKACCIPQNPRGGREADSLDPRDLQSLIPRK
FT                   VVKGGSHLCAPTYCRRYRPAARHPQPIDTSMSHVGFRCVARDRS"
FT   gene            complement(574468..576837)
FT                   /locus_tag="Mext_0528"
FT   CDS_pept        complement(574468..576837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0528"
FT                   /product="putative RND superfamily transporter"
FT                   /note="KEGG: rpa:RPA3746 possible RND superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28943"
FT                   /db_xref="GOA:A9W037"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A9W037"
FT                   /protein_id="ABY28943.1"
FT                   /translation="MNTHRGRLTGEPVDAGHPAPDRLALGIERLGLIGLRFTGAATLLL
FT                   LGLCLGAIFGAARLNVDDSLSQLFRADTPEFRQYESLSRRFPSAEFDVLLLVEGDALLA
FT                   RPSLEALRDLVTDVQLVEGTKGVISLFSARRPPEGGHVPPALFPEELPEGAGYDDLIAR
FT                   VRANEILRGKILSEDGRLALVVLALDPRTVDRQRSSEVIGEVRDIARRDLEGSGLTVRL
FT                   SGVPVMQMEIREAVERDRLLYNGLGFFGGCLIAILFFRRVSFMVVAAAPPLVAILLALG
FT                   TLGWLDFRLNMFLNMMTPLIMVISFSDSMQLTFAARERLLAGELKREAFRNAVLVVGPA
FT                   CVLTHAAAGLSFGALMFSESDLIRTFGQAGLISTVIALLTVLTLVPLLGILLVRTSTLV
FT                   SGERRHADTGVDFLRVGCAWIAARMTRRPGIPSLLGLLVVSGLAVAYAHLQPRYRLADQ
FT                   VPDRQHAIAASNRLDAKLTGSNPVDILIEFPPGASLYAPETIAVIGEVHARMEGQPGVG
FT                   NVWSLETLRRWLDKSGDGMNPGLLRHYAELLPRHLTRRFIPDAGDATVVTGRVPDIDIE
FT                   HLLPLVDALDKNFGPIRERHPGYGISVTGLSAVAARNSAGMIERLNRSLTVEVAFMAVF
FT                   VGLAFRSVVVGLACILPGIFPVLAAGTVLWLHGDGLQFAGIVALTVAYGLGLSATIHFL
FT                   NRLRLVRVPGEHPAAAVERATVLVGPALVVTSVVLTCGLGVTVLSDLPSLRVFGWVSAL
FT                   AMVAALVADFLILRPTITLLGRWEARLGSVLSGRAG"
FT   gene            complement(576874..577446)
FT                   /locus_tag="Mext_0529"
FT   CDS_pept        complement(576874..577446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpc:RPC_1715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28944"
FT                   /db_xref="UniProtKB/TrEMBL:A9W038"
FT                   /protein_id="ABY28944.1"
FT                   /translation="MANVITFPAAGGEANGPSPAGAAQGGTPMRFSGIVAAIFLLQFAV
FT                   VGAEAQRWMAQTPFAGLAGTWSGSGTVSLTGGGRERIRCRSTYRVGSDGTAVQGNLRCA
FT                   SDSYQFELASQIDYGAGAVNGTWSETTSGVSGTLTGQADVGQLSARATAPGFTADLSLS
FT                   TRGRRQVVTIRSQGTDLTGASLTLNRE"
FT   gene            578813..579877
FT                   /locus_tag="Mext_0530"
FT   CDS_pept        578813..579877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0530"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: pfo:Pfl_2761 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28945"
FT                   /db_xref="GOA:A9W039"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A9W039"
FT                   /protein_id="ABY28945.1"
FT                   /translation="MTTGHPKPSPTGNTPTPRPVSWSAVVNLGVAQETATVLARFGLVP
FT                   DPTMPGSGPEAVPDASGADSPGLADIGRIMAASVRRSGCGHFGLLAGQGDVLAALALAG
FT                   CLIPGVRTVGNALENLVGHLKVHAGAAAPTLVVEGPVAHLAFVTLGASDEGADQAADVA
FT                   AALAVNLMRTLCGADWYPTEVTLPRSAPTDRAPFTRYYCSPIRFGARAAAVAFPAEILD
FT                   RPVEAANLLRAVIAAHHAPHTQRSCSGFGDDVRRVLRARLTVQDCSATAVAASFSMHQR
FT                   TLNRHLRAEGLSFNVMVNEVRFEIARRLIAETGMSLKQIAAVLCFSELSAFTRAFRRWS
FT                   GQSPTAWRADQPAS"
FT   gene            580688..581725
FT                   /locus_tag="Mext_0531"
FT   CDS_pept        580688..581725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_3413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28946"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A9W040"
FT                   /protein_id="ABY28946.1"
FT                   /translation="MLDFGYSRRVLASATLAAACMLFPGQAEAAESALGVYVLGNCGPM
FT                   AGVTPPPGFYFENETYFYQGNLGGNRTFQSGGVVAANVKLDISATFMTPVWVTPVEVLG
FT                   GNLGFSITIPFGTPNVSAGAVLSSPRIDRIVSGRERDAIFNVGDIYLASFVGWHSGNLH
FT                   WSTTVLGVVPSGSYETGQLSNISLNRPALDLSAALTYLDPVLGYELSVVPGVTFNWINP
FT                   ATQYLTGTEFHLEWSASKFLSKEFSIGMVGYFYDQLTGDSGRGDRIGPFKGRVTALGGQ
FT                   IGYTFKVGEIPVSTNVRVLREFNTTNRFEGTATYLTITAPLWVAPGAAVAEAKPAMTKP
FT                   VIRKF"
FT   sig_peptide     580688..580777
FT                   /locus_tag="Mext_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 30"
FT   gene            complement(581806..582096)
FT                   /locus_tag="Mext_0532"
FT   CDS_pept        complement(581806..582096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28947"
FT                   /db_xref="UniProtKB/TrEMBL:A9W041"
FT                   /protein_id="ABY28947.1"
FT                   /translation="MTSPRSLCTLLTLSLTFGTFECPALADPAFRMAQTVTIPTDAQID
FT                   RMERDAISTPPLDVSEGAQRGDEAARIRQMDKRAHRVDEKLLTDDGVCDDC"
FT   sig_peptide     complement(582016..582096)
FT                   /locus_tag="Mext_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.943 at
FT                   residue 27"
FT   gene            complement(582224..582496)
FT                   /locus_tag="Mext_0533"
FT   CDS_pept        complement(582224..582496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0533"
FT                   /product="Na+/H+ antiporter"
FT                   /note="KEGG: mlo:mlr5309 Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28948"
FT                   /db_xref="GOA:A9W042"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:A9W042"
FT                   /protein_id="ABY28948.1"
FT                   /translation="MFLGKKVGVFGFVQRPAHAGWAHIYGVALMCGIGFTMSLFIGLLA
FT                   FAGTPAVEAETKVGVLVGSLTCMVLGAMVLRFSPAAEMPRRSASP"
FT   gene            complement(582663..583124)
FT                   /locus_tag="Mext_0534"
FT   CDS_pept        complement(582663..583124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpd:RPD_2417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28949"
FT                   /db_xref="GOA:A9W043"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:A9W043"
FT                   /protein_id="ABY28949.1"
FT                   /translation="MRHLLLISATITGALAMIPMSADARGGGFRGGGFHGGGFHGGVGR
FT                   AGFAGRGIGGRGAGFYGARRGIGYGALGVGAGVGLGLAAGNLGYGYGGYDAGGYAPAGY
FT                   GGYDATYAPTEVQVPSAAGDADYCIQRFRSYDPGSGTYLGNEGLRHSCP"
FT   sig_peptide     complement(583050..583124)
FT                   /locus_tag="Mext_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.897 at
FT                   residue 25"
FT   gene            complement(583860..584168)
FT                   /locus_tag="Mext_0535"
FT   CDS_pept        complement(583860..584168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_p0210 putative insertion element
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28950"
FT                   /db_xref="GOA:A9W044"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9W044"
FT                   /protein_id="ABY28950.1"
FT                   /translation="MRRGQKTSAEQVVLKLRQIEVQTAQGKSLALACEEAEISEQSYDE
FT                   CLRKEIFYSLREAQAVIGLWQDTYNRVRPHSSLGYRPPAPVSFPDLAFRLPMATTMQ"
FT   gene            complement(584530..584778)
FT                   /locus_tag="Mext_0536"
FT   CDS_pept        complement(584530..584778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28951"
FT                   /db_xref="GOA:A9W045"
FT                   /db_xref="UniProtKB/TrEMBL:A9W045"
FT                   /protein_id="ABY28951.1"
FT                   /translation="MKAFFDSAAEGVEELSEEISRRTFAELYDEIDAAARRRPGVTFAA
FT                   AALAGFALFRFLKASKMRPVPRSRAVLPIEVFPTPDI"
FT   gene            complement(585179..586042)
FT                   /locus_tag="Mext_0537"
FT   CDS_pept        complement(585179..586042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0537"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: xau:Xaut_1905 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28952"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A9W046"
FT                   /protein_id="ABY28952.1"
FT                   /translation="MLVRRLTAGGLSSCCTLLIGLGMLASPARSTPAVNVDVVLSTLPL
FT                   PPDVDPPTQASLMEGLPLNKLTLGKPVADGNLRSGFGIRRHPILLSSKMHTGVDWAARL
FT                   GAPILSAGEGTVILAEWAAGYGRRVEIQHADGVVTAYSHMSRFSTDIEPGAQVRQGQVI
FT                   GFVGSTGLSTGPHLHFEVLVNGYFVDPMDIYAPGGGRVAARVQKKASPTNGRTDTAPAE
FT                   QIAALAASAAPLAQPARKPVRLAERTTTRRIAAASLKPAEKWAEHDQRMRAIQSKITAS
FT                   TLMIMR"
FT   sig_peptide     complement(585950..586042)
FT                   /locus_tag="Mext_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.966 at
FT                   residue 31"
FT   gene            586445..586777
FT                   /locus_tag="Mext_0538"
FT   CDS_pept        586445..586777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28953"
FT                   /db_xref="UniProtKB/TrEMBL:A9W047"
FT                   /protein_id="ABY28953.1"
FT                   /translation="MSFEIPDTAKPGDILTPDGKILCRDHELHEFGYFIVTYEQAQIAR
FT                   KYGWGCRAGVVLDVEHDDEWSWAYAEEERREALQNGEKPPLVPIYREAPVCPLDTPPSC
FT                   PIAEGR"
FT   gene            586872..587291
FT                   /locus_tag="Mext_0539"
FT   CDS_pept        586872..587291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_04570 transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28954"
FT                   /db_xref="GOA:A9W048"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A9W048"
FT                   /protein_id="ABY28954.1"
FT                   /translation="MAAKREPEPSAVILDSRTLRSSPESGERAGYDGAKRKRGANMHLA
FT                   VDTPGHVVALHVTLADVDDRAEVGWLPAEVQAETGDIVEWALSFRAIPVPSPRPPRRPT
FT                   ASSWRWSRRRKPSAALCCCRAAGWWSAPSMDALKS"
FT   gene            587437..587733
FT                   /locus_tag="Mext_0540"
FT   CDS_pept        587437..587733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0540"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28955"
FT                   /db_xref="UniProtKB/TrEMBL:A9W049"
FT                   /protein_id="ABY28955.1"
FT                   /translation="MSSGSATTGRRGSTSSSGWPQSGNCARNAAARRMRWSRIARRHNR
FT                   RTREMASLFKELDYRPTRLGALSLRRRRDLVTGADVHEILLGDAYLMSSRFTP"
FT   gene            588418..589326
FT                   /locus_tag="Mext_0541"
FT   CDS_pept        588418..589326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO2970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28956"
FT                   /db_xref="UniProtKB/TrEMBL:A9W050"
FT                   /protein_id="ABY28956.1"
FT                   /translation="MIAGSVIRGVGEVEHATPEQILAHPDFAAARRVFVSEHAKVYEAG
FT                   VFPAQFGADAGRVTTLAIIVCQHANYDPADRATWPTLSLLKETVARFGFASPRLIDSFV
FT                   ARLVQTNYLELRQQPGDSRVRLLFPTERLLAWDREWKAAHYAPLDILYPDPGFEPARRR
FT                   DLDFQAAHARSAVAAFDAIIAMMWSNLEIIVFLSSTSALIILLTLSEMGGSGPESRIRG
FT                   SDLVHLAPRFAVSLSHVRNILAVAQERNFLVRSGPRNAYIHLTPHWVAAFDRFIAGSLA
FT                   QSDLTYRLALRHQAKQAVSTA"
FT   gene            589405..592041
FT                   /locus_tag="Mext_0542"
FT   CDS_pept        589405..592041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0542"
FT                   /product="aminopeptidase N"
FT                   /note="TIGRFAM: aminopeptidase N; PFAM: Peptidase M1
FT                   membrane alanine aminopeptidase; KEGG: xau:Xaut_4749
FT                   aminopeptidase N"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28957"
FT                   /db_xref="GOA:A9W051"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:A9W051"
FT                   /protein_id="ABY28957.1"
FT                   /translation="MRTETPPTVRLEDYRPSDHLIDRVELDVRLDPHDTRVTATLALRP
FT                   NPAGRAGAPLVLDGDDLTLLALELDGQAPASDAVRADASGLTLHRPPQRPFTLRIETRL
FT                   DPTANTRLMGLYRSNGVYCTQCEADGFRRITYFLDRPDVLSVYTTRIEAEREAAPVLLG
FT                   NGNPVGAGTVPGTDRHYAVWHDPLPKPAYLFALVGGRLDRVAKPFTTMEGRAVEIAVYV
FT                   EPGKADRAAYALDAVERSMAWDEMAFGRAYDLDLFNVVAVSDFNMGAMENKGLNIFNDK
FT                   YVLASPETATDGDYAAIEAIIAHEYFHNWSGNRVTCRDWFQLCLKEGLTVFRDQEFSSD
FT                   MRSRAVHRIAEVRNLRARQFPEDAGPLAHPVRPKQYAEINNFYTATVYEKGAEIVRMLR
FT                   TLIGETAFRAGMDRYFADNDGTAATVEDFLNAFAAVTGRDLSRFAEWYERPGTPRVAVS
FT                   GTYDPAARTYRLAFRQTRPGAGADAPPLVIPIGLGLVGPDGPLDGPRAERVEDGVFVLE
FT                   TAEDAITFENVAVDPVPSLFRAFSAPVRVESPLDDDARLTLLRHDPDSFNRWEAAQRIA
FT                   LGLMTAQVRGETAANAGAGDFVVALGAFLDAEALRDPAFAAQVLALPSEGDLADEIGIE
FT                   IDPDAIFAARRDLRRRLGTGLRERLLRLREALAEPEGTPFSPDAAAAGRRALRNAALDL
FT                   IAAADPEAGTALAQAQIAQATNMTDRLAGLAALALVPGEAREAALSAFAERYASEPLVL
FT                   DKWFAIQAMIPEDGTVARIRRLQGHPAFANTNPNRVRSLVGSFSLANPTQFNRADGAGY
FT                   ALVAETVLALDGTNPQVAARLMTAFGPWRRLEPVRRAAAETALRRIAATPGLSRDVTDI
FT                   GTRSLAG"
FT   gene            592227..594587
FT                   /locus_tag="Mext_0543"
FT   CDS_pept        592227..594587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0543"
FT                   /product="PAS sensor protein"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: xau:Xaut_1626 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; SMART: PAS domain containing
FT                   protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28958"
FT                   /db_xref="GOA:A9W052"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9W052"
FT                   /protein_id="ABY28958.1"
FT                   /translation="MSGAVSASLSARARADTILGIQRTTGTAQARLIRAETWLRYALPA
FT                   LLVVFMLTLLGVAALQMRGRHDEAMRVATREVEAFARLSALALSNASSAAETRLERVLP
FT                   VHLLPTGREVLVIGPGGRIRAAYPAPAPAETFAGYLADGEPIAILGESAGAMTVNLQAG
FT                   GQAVVAARRLSHGMGEVAVVQRFEPLADNWWRMFGHHAVSLSAIALVLAGMATAYILQT
FT                   QRAQAADEVCDLVKQRLDTALGRGRCGLWDWDIARGTIFWSDSMYALLGYTPEKDLLSF
FT                   GDVNALLHAEDGDLYSLARHLAASHATVDHEFRIRDASGEWIWLRTRAEIVEDAVDGSR
FT                   HLVGIAMDVTEQRRLAEFTATADMRLRDAVEAVSEAFVLWDASNRLVLCNSKFRDLHAL
FT                   ASEDAVPGRRYDEIMGRGALPPVRRGIPGSERGPSRTFEVELTDGRWLQVSERRTKDGG
FT                   YVSVGTDITSLKRHQEQLVTSERELIETVKDLKRSRRTLETQTQQLADLAERHLDQKAR
FT                   AEIANQAKSEFLANMSHELRTPLNAIMGFAELMESEVYGSLGSPRYADYCRDIQQSGTY
FT                   LLSVIDDILHMSRIEAKRVKLVRRDIDLGTALTSALTLVAKEAASKSVSIDLELAGTLH
FT                   VLADERALQQILLNIIQNAVKFTPERGRIALRGRSCNGFVHLFIGDTGIGIPKTAISKL
FT                   GRPFEQVETNLTRSYKGSGLGLAIARSTAELHGGSLRIRSEEGIGTLVLVRLPMPTPER
FT                   LAEVAREAERDTLKAIGDMPGVARTEGDRIAAL"
FT   gene            594996..595922
FT                   /locus_tag="Mext_0544"
FT   CDS_pept        594996..595922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0544"
FT                   /product="arginase"
FT                   /note="TIGRFAM: arginase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: smd:Smed_2891
FT                   arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28959"
FT                   /db_xref="GOA:A9W053"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A9W053"
FT                   /protein_id="ABY28959.1"
FT                   /translation="MPAPTTIDLIGAPIEIGTSEPGAVMGPAALRTAGLLRVLRDLGFT
FT                   VRDQGDLAPDCTPGQRDLPAIRAWMTEISRAVETALDGGSLPLVAGGDHSLSLGSIDGA
FT                   LRHCGRTGRPVFVLWLDAHADFNTLETSPSGNVHGMPLAALCGEPGFDDLFAGGERPLL
FT                   DPRRIHLFGLRSIDAGERAIVTQRQVNVIDMRTIDEFGVVAPLRRILDRVAAANGHLHV
FT                   SFDVDFLDPAIAPGVGTTVPGGATFREAHLIMEMLCDSGLVGSLDVVELNPFLDERGRS
FT                   ARALVELVASLFGRRIIDRPTEPPLEA"
FT   gene            complement(595986..597593)
FT                   /locus_tag="Mext_0545"
FT   CDS_pept        complement(595986..597593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0545"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: gbe:GbCGDNIH1_0798 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28960"
FT                   /db_xref="GOA:A9W054"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9W054"
FT                   /protein_id="ABY28960.1"
FT                   /translation="MPGLFELRQPLGCEPRGRRSRFCRRPAPRIPRETILRETWEPRLA
FT                   TIIPVSPFDYVVFGATGDLTQRKLLPALYQRYRDAQIPETSRIIGASRSHMSVEEFREH
FT                   ARDALKSFVPPAEIDDARLAGFLDHLFYVAIDALGDEGWDDLKTLLDERPDRIRPYYLA
FT                   TSPDLYGAICRNLDRYGLIGENSRVVLEKPIGKDLKSARAINDAVGAVFPESQIFRIDH
FT                   YLGKETVQNLLALRFANTIFERLWNADVIDHVQITVGETVGVEGRGGYYDTSGALRDMV
FT                   QNHILQLLCLTAMESPISLDANSVRDEKLKVLRALKPITAADVQSVTVRGQYVAGAVSG
FT                   RPVESYHTDLGSNAASRTETFVALKLEVRSGRWAGVPFYVRTGKRLPKKLSEIVVQFRA
FT                   SPFSIFPNDAFGREPNRLVIRLQPEEGMKLEVMTKDPGPGGMRLRPTNLDISFEETFKQ
FT                   RYPDAYERLLMDVVRGNATLFMRRDEVEVAWAWADTLLKAWADRPDPPRPYAAGSWGPT
FT                   ASIALIERDGRTWHEEIG"
FT   gene            complement(597734..598291)
FT                   /locus_tag="Mext_0546"
FT   CDS_pept        complement(597734..598291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28961"
FT                   /db_xref="UniProtKB/TrEMBL:A9W055"
FT                   /protein_id="ABY28961.1"
FT                   /translation="MPGCGATKRHAAGGGLPRCKCCINTLLVSSDSRSLMPRAPMPDSQ
FT                   PPFADFPFDLTADETAAQVEAALVARREERTSTNWIALIRLFDGTEIPCNVKDISKSGA
FT                   KLGVPATYELPSAFMIRIIGRDFVLRVNLAWRRGNYAGVRIERIAKLPVVEEKKAPADG
FT                   PASKPTPNYSSIGTRRSRISPD"
FT   gene            598561..598722
FT                   /locus_tag="Mext_0547"
FT   CDS_pept        598561..598722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28962"
FT                   /db_xref="UniProtKB/TrEMBL:A9W056"
FT                   /protein_id="ABY28962.1"
FT                   /translation="MSELIRVKPTQDGTYTVYRGSMALVAGLTRLQAERYEASIAHQQR
FT                   SFSPLVGA"
FT   gene            complement(598802..599125)
FT                   /locus_tag="Mext_0548"
FT   CDS_pept        complement(598802..599125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0548"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   pla:Plav_2702 CutA1 divalent ion tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28963"
FT                   /db_xref="GOA:A9W057"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A9W057"
FT                   /protein_id="ABY28963.1"
FT                   /translation="MERPLLVYTTFPDAPTALEIGEALVRARLAACVNVIPGMQSVYAW
FT                   KGAVERGTEVVAILKTRDGLADALAAELKRRHPYETPIILHLPVSGADPDTAAWIASET
FT                   GLG"
FT   gene            599230..600000
FT                   /locus_tag="Mext_0549"
FT   CDS_pept        599230..600000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0549"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: xau:Xaut_1643
FT                   NAD(+) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28964"
FT                   /db_xref="GOA:A9W058"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A9W058"
FT                   /protein_id="ABY28964.1"
FT                   /translation="MPRRFSRIAFVASPTADAREAADLLMRRYDHVSPEEADVVVALGG
FT                   DGLMLQVLHRFMDAPKPIYGMNRGTVGFLMNEFREEGLLERLEATKRSTIHPMTMIATD
FT                   TEGKSHTARAINEVYMLRQTHQTAKLRVSVDDHVRLPELIADGILAATPAGSTAYNLSV
FT                   GGPILPLNAHLLALTPISAFRPRRWRGALLPNHARIRIDVIDAEHRPVAAVADHTEFRR
FT                   VCTVETWLDHATDLVLLHDPGHSLEERILREQFG"
FT   sig_peptide     599230..599286
FT                   /locus_tag="Mext_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.630) with cleavage site probability 0.614 at
FT                   residue 19"
FT   gene            complement(600069..600296)
FT                   /locus_tag="Mext_0550"
FT   CDS_pept        complement(600069..600296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0550"
FT                   /product="protein of unknown function DUF1674"
FT                   /note="PFAM: protein of unknown function DUF1674; KEGG:
FT                   rpe:RPE_0029 protein of unknown function DUF1674"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28965"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:A9W059"
FT                   /protein_id="ABY28965.1"
FT                   /translation="MKEIGMMQADAKEKDAASRALSPAAQRALAEAAERRAAIDARAAK
FT                   IAERPETLGRGGLEPVRYEDWEVKGLASDF"
FT   gene            600473..601750
FT                   /locus_tag="Mext_0551"
FT   CDS_pept        600473..601750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0551"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; methyltransferase
FT                   small; Methyltransferase type 11; KEGG: xau:Xaut_0038 sun
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28966"
FT                   /db_xref="GOA:A9W060"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A9W060"
FT                   /protein_id="ABY28966.1"
FT                   /translation="MATLLGPARGLALEDALAQAARGAGLDAGEAALARAIATASFRRL
FT                   GFIKAALAARLRDGLPEDRPHLLALLVTGAAQILDLAVADHAAVDLSVRLAKADPQLQH
FT                   LVPLVNAVLRRIARERDAIRAQESDPLAHNTPDWLARRWQAAYGEEAARRIAVAHLEGA
FT                   AVDLTVPHDPDIWAERLGGIRLDLGSVRLAEVRQAVAELPGYAEGAWWVQDAAAALPVR
FT                   LLAPVSGERVVDLCAAPGGKTAQIAAAGAAVTAVDRSAVRLERLGRNLERLGLSAEVVT
FT                   ADALALPEDAPFDAVLLDAPCSATGTIRRHPDVVWTKSEADVIRLAGLQRRLLDKAARL
FT                   TRPGGRLVYCTCSLEPEEGSAQVAAFLARNPDFERIAITPDRLSGHAELIDASGDLRTL
FT                   PSHVVGGIGRAGGLDGFYASLLRRRD"
FT   gene            complement(601810..601974)
FT                   /locus_tag="Mext_0552"
FT   CDS_pept        complement(601810..601974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28967"
FT                   /db_xref="UniProtKB/TrEMBL:A9W061"
FT                   /protein_id="ABY28967.1"
FT                   /translation="MIALLSLVSLTCGLALAGQAPRFPGWTARMEMAGGLSLVTGLATV
FT                   GAGLKAYCI"
FT   sig_peptide     complement(601921..601974)
FT                   /locus_tag="Mext_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.991 at
FT                   residue 18"
FT   gene            602321..603355
FT                   /locus_tag="Mext_0553"
FT   CDS_pept        602321..603355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr1554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28968"
FT                   /db_xref="GOA:A9W062"
FT                   /db_xref="UniProtKB/TrEMBL:A9W062"
FT                   /protein_id="ABY28968.1"
FT                   /translation="MLAGAAGFLIFGTGAASAHVKWFCAFDVAGQPRGLEQVLCADFEL
FT                   LTGLALVCLMFGCLMEGTPLGTALLNALDRVTASARVHSGLIVRAVVGFFLVSLWNLGG
FT                   IILTPELKTDATWIPWLQLAMAAGLLWKRTLPFTAAGIVFLFGFAVWNYGVFHLADYPV
FT                   FLGVAAFLALTALDRDLFGQRPIDVVRIAAAITLMWASVEKWAYPHWTDPLIAAKPAMT
FT                   MGASPELFMQAAGIIEFTLAFALIWTPLVRRASAIILTAVFISAIFEFGKVDAIGHSGI
FT                   IAVLIAIAADDVRVPATRRDVVLAPVYYASALMLFLGVYYFAHEALFGDGYRIGASMAG
FT                   LPVI"
FT   sig_peptide     602321..602377
FT                   /locus_tag="Mext_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.932 at
FT                   residue 19"
FT   gene            603725..604918
FT                   /locus_tag="Mext_0554"
FT   CDS_pept        603725..604918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0554"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase class I and II;
FT                   aminotransferase class-III; KEGG: mxa:MXAN_2571
FT                   aminotransferase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28969"
FT                   /db_xref="GOA:A9W063"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9W063"
FT                   /protein_id="ABY28969.1"
FT                   /translation="MRHREQTDATDRDRTDGVHLLPKAASFGDRPLRGLDFASQDCLGL
FT                   STHPEIVATAADTLRRFGVRSVCAAAEAGDPGLSVALERRIADFLQMEEALLCATGRAA
FT                   ARTVIRGLVRSTDHVVIDAAIRSGLRESAEAATAHLHPFRHLDAEHCRARLRAIRARDA
FT                   ENGILVVTESLSPLDSGTPDLAALRTLCDEYGATLLVDVTQDLGCLGEDGRGHLGLQDM
FT                   LGKADLVTGSFTKSFASNGGFVAARTRAVTACLRAAEADAQALSPIQIAVLLKAFTLID
FT                   EADGCERRARLMRNVLNLRTALRERALTVCGEPCTSVSVAIGSGELARLAAPRLIELGL
FT                   LVDLTASGEASRLRMHVTAEHSDADIARAALGVAEALDRARADLAERSRRPNLLVAA"
FT   gene            complement(604979..605308)
FT                   /locus_tag="Mext_0555"
FT   CDS_pept        complement(604979..605308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28970"
FT                   /db_xref="UniProtKB/TrEMBL:A9W064"
FT                   /protein_id="ABY28970.1"
FT                   /translation="MFRTMYPQEAVGHAHALIGAYETAHAGLARISHEFRRDLCLALDR
FT                   LGPGAAPYLRIVRSDLEVRTSAARATWPLWIDRLTDPMIDRRLIASRALLDAVESEADA
FT                   RGMIL"
FT   gene            605654..606586
FT                   /locus_tag="Mext_0556"
FT   CDS_pept        605654..606586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0556"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG: rpb:RPB_2466
FT                   malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28971"
FT                   /db_xref="GOA:A9W065"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A9W065"
FT                   /protein_id="ABY28971.1"
FT                   /translation="MTRAFIFPGQGSQAVGMGKALSEAFPAARQVFEEVDAALGQNLSR
FT                   LMFEGPSDALTLTANAQPALMAASLAVLRTLEAERGLDLARDAAFVAGHSLGEYSALAA
FT                   AGTFSIADTARLLRIRGEAMQRAVAPGIGAMAALIGPDLATARDIAGEAAEGLVCDVAN
FT                   DNGGGQVVLSGHREAVERAMALAQSRGVRRAVLLNVSAPFHCALMAPAAEAMRRALAEV
FT                   PMNAPAVPVFANITAGPLTEPDAIRNALITQVTGTVRWSESVAAMAEAGVDRFFELGAG
FT                   KVLTGLVKRIAPSATASAVGTPDDVAAYA"
FT   gene            606696..607436
FT                   /locus_tag="Mext_0557"
FT   CDS_pept        606696..607436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0557"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; Male sterility domain; KR
FT                   domain protein; KEGG: pla:Plav_3359
FT                   3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28972"
FT                   /db_xref="GOA:A9W066"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9W066"
FT                   /protein_id="ABY28972.1"
FT                   /translation="MFDLTGRKALVTGATGGLGGAIARALHAQGAHVALSGTRRAVLDE
FT                   LAAELGGERVAVVEANLADKEAVEALLPAAESALGGLDILINNAGITRDNLFMRMKDEE
FT                   WEAVLNVNLTAAFRLSRAALRGMMKRRHGRIIGIGSVVGATGNPGQGNYAAAKAGLVGM
FT                   TKALAAEVATRGITVNCIAPGFISSAMTDALNEKQRETILTRVPAGRLGTGAEIGAAAV
FT                   YLASEEAGYVTGQTLHVNGGMAMY"
FT   sig_peptide     606696..606782
FT                   /locus_tag="Mext_0557"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.966 at
FT                   residue 29"
FT   gene            607700..607936
FT                   /locus_tag="Mext_0558"
FT   CDS_pept        607700..607936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0558"
FT                   /product="acyl carrier protein"
FT                   /note="TIGRFAM: acyl carrier protein; PFAM:
FT                   phosphopantetheine-binding; KEGG: xau:Xaut_3132 acyl
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28973"
FT                   /db_xref="GOA:A9W067"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9W067"
FT                   /protein_id="ABY28973.1"
FT                   /translation="MSDIAERVKKIVVEHLGVEPEKVTEASNFIDDLGADSLDTVELVM
FT                   AFEEEFNVEIPDDAAETIQTVGDAIKFLEKNSA"
FT   gene            608075..609337
FT                   /locus_tag="Mext_0559"
FT   CDS_pept        608075..609337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0559"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 2"
FT                   /note="TIGRFAM: 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   2; PFAM: Beta-ketoacyl synthase; KEGG: rpa:RPA3072
FT                   3-oxoacyl-acyl carrier protein synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28974"
FT                   /db_xref="GOA:A9W068"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A9W068"
FT                   /protein_id="ABY28974.1"
FT                   /translation="MRRVVITGLGMVSPLGGSVEHTWSRLIAGDSGASAVTAFQTDDLA
FT                   CRIACTLPFGDGSNGTFNPDLWMEAKEQRKVDPFIVYAMAAAGQALDDADWHPKSDADQ
FT                   EASGVLIGSGIGGIGTIYDASVTLHEKGPRRISPFFIPGRIINLASGQVSIQHGLKGPN
FT                   HAVVTACSTGAHAIGDASRLIALGDADVMVAGGTEAPVNRLSLAGFAACRALSTGFNDQ
FT                   PTKASRPYDRDRDGFVMGEGAGIVVLEEYEHAKARGAKIYAEVIGYGLSGDAYHITSPA
FT                   PDGDGGYRCMKAAVKRAGIDPSEIDYINAHGTSTPLGDELELKAVERLLGDAASKASMS
FT                   STKSAIGHLLGAAGAVEAIFSVLAIRDGVMPPTLNLDNPSVETAIDLIPHEAKRKRVDT
FT                   VLSNSFGFGGTNASLLMRRVA"
FT   gene            609600..611003
FT                   /locus_tag="Mext_0560"
FT   CDS_pept        609600..611003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0560"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="PFAM: aminodeoxychorismate lyase; KEGG:
FT                   nha:Nham_2350 aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28975"
FT                   /db_xref="GOA:A9W069"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A9W069"
FT                   /protein_id="ABY28975.1"
FT                   /translation="MFRRRQEPPSPPPASEEPSLPNRPSPRSPSEAIKPTVAPAPPEKP
FT                   ERRRGGLLATISGFLTLGVVLALGALIGLTLLNRQTSEPGPLSADKVVVIPSRSGTSEI
FT                   ASILAREGVIDHPSLFEMSARFGGKGPLKHGEYMFKAHSSVKDTIETLTNGRQVQHAIT
FT                   FPEGLTSEQIVARLGDNDILSGEISETPPEGSLLPDTYKFERGATRQQILNLMRSKQRE
FT                   VLNQIWQRRSPEVPVKTPAEMVTLASIVEKETGRADERPRVAGVFVNRLQKRMKLQSDP
FT                   TIVYGLVGGRGTLGRGIMRSEIERATPYNTYVIEGLPPGPIANPGRAALEAVANPSRTK
FT                   DLFFVADGTGGHAFADTLEGHQRNVTRWRQVERSRQQSQPADPGAVDKVDPNTAEPNAG
FT                   QPGAAPGRASAYAPGSNSAFAIDGANDGGVGGPRPKAFDASEGTRLDPLRNKTYDLGSP
FT                   KTVPALRNP"
FT   gene            complement(611033..611779)
FT                   /locus_tag="Mext_0561"
FT   CDS_pept        complement(611033..611779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0561"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: csc:Csac_0438 beta-phosphoglucomutase
FT                   family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28976"
FT                   /db_xref="GOA:A9W070"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9W070"
FT                   /protein_id="ABY28976.1"
FT                   /translation="MPPNRDAVPRMLSAVIFDVDGVLVDSPHEQAWREALAGFADPAGF
FT                   TTAFYQAHVAGKPRLEGARAALERLGDAEAAAHAALFAERKQAVIDRLIAEDRFVAFPD
FT                   AIRLAVALRDTGLRIVLASSSKNADAVLARVILPDGRTLRSLFDADVSGRDVPRGKPDP
FT                   ALFLRAAKAVNVPPARCLVVEDAPAGIRAAKAGGMASLGIARLGDEALLRVAGADLVVT
FT                   SLDQLDVAALGSGSLRTRSVEAAREP"
FT   gene            complement(611763..614150)
FT                   /locus_tag="Mext_0562"
FT   CDS_pept        complement(611763..614150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0562"
FT                   /product="Kojibiose phosphorylase"
FT                   /EC_number="2.4.1.230"
FT                   /note="PFAM: glycoside hydrolase family 65 domain protein;
FT                   glycoside hydrolase family 65 central catalytic; KEGG:
FT                   nca:Noca_3421 kojibiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28977"
FT                   /db_xref="GOA:A9W071"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A9W071"
FT                   /protein_id="ABY28977.1"
FT                   /translation="MLRPRLIPPTDMFPPNPWAVEAVRYDGRMARELTGQAETMFALSN
FT                   GYLGMRGATDEGMPVREPGTYLNGFYEYRPIVYGERAYGFPTVGQSILNCPDGTVLKLS
FT                   VDDEPFTLPEAEILSYRRVLDFRAGTLSRDVSWVTPAGKRLNLRTLRLVSFPHRHLAAI
FT                   TYELTAENAEVAVVIASELRNDQPLATDTSDPRLAEGFVGRVLHPTGTQSEALRSILSY
FT                   RTGSSGLVLGCGMDHVVTADCPLAVRAACDDDLATVVLRGVLAPGGVIRIQKYLSYHYS
FT                   GSVAPEQIRFQVAWTLDHAVESGISSIVARQRRDMDRFWERADVTVESASPRIQQAIRW
FT                   NLFQLMQASERAEGHGIAARGLTGRTYEGHYFWDTEVYVLPFLIYTNPPMARSLLKVRY
FT                   DMLDCARDRARELGQRGATFPWRTINGREASAYYAAGTAQYHINADIAYALRKYVEVSG
FT                   DVDFLCRYGAEILVETARLWCDLGFFSERMGGRFCIHGVTGPDEYTALVNNNCFTNLMA
FT                   RENMRYAAQTVRMLERDHPDSFDALVRRTSLDPDEPDAWDQAAERMYLPYDEALKVHPQ
FT                   DDTFLELEKWDFAGTPEDHYPLLLHYHPLNLYRAQVIKQADMVMAMFLLSEQFTPEAKQ
FT                   RNFAYYDPLTTHDSSLSVCIQSIVANEIGLREKAFHYFNFAVAMDISDIGGNMMHGAHI
FT                   AAMGGTWLALVYGFAGMRDTGGRITFNPCLPDAWTRLSFTLTVRGQTIRVALSHASATY
FT                   SLLAGEGLTLWHSEEGVRLSGAEPSVTKAIRRPAGDDHAAEP"
FT   gene            615009..616211
FT                   /locus_tag="Mext_0563"
FT   CDS_pept        615009..616211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0563"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: sme:SMb21184 putative acetate kinase
FT                   (acetokinase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28978"
FT                   /db_xref="GOA:A9W072"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A9W072"
FT                   /protein_id="ABY28978.1"
FT                   /translation="MRDSILVVNAGSSSIKFKLYRIEGADLAPSLSGGMSGIGSTPSLK
FT                   VTDGSGALLEDRRLEAGEVPDASAAQHHLADWLVHHLGDTTVVAVGHRVVHGGADFAEP
FT                   VLIDDAVLRRLETFIPLAPLHQLGNLDPIRVLRQRRPDLPQVACFDTSFHRGHPELSDR
FT                   FALPRFLHDEGVRRYGFHGLSYEYVAGRLTEIAPETADGRVVIAHLGSGASLCALKDGR
FT                   SQETTMSFTALDGVPMGTRCGALDPGVVLHLIEHRGMTPAEVGHMLYYESGLLGLSGIS
FT                   NDVRTLLASDRPEAALAVAFFCRRVAQAAAALAVTLGGLDAFVFTAGIGENAPEIRRRI
FT                   IADLSWAGLILSNDANGSGVARLDASGSRAQIWVIPTDEELMIAKHTMRLLDRIASGAR
FT                   A"
FT   gene            616208..617239
FT                   /locus_tag="Mext_0564"
FT   CDS_pept        616208..617239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0564"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   rpa:RPA0681 membrane permeases, predicted cation efflux
FT                   pump"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28979"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A9W073"
FT                   /protein_id="ABY28979.1"
FT                   /translation="MRRTRPGPRARGALLAILLATGFAVAAPPPSFAQSRLKQLIDRLR
FT                   GQKMPDGIAKSNGRIEATQVDVAAKYAGRIAKLLVKEGDEVSAGQVVATISSPETEAQL
FT                   RGAQSQVLRAKKSLAEAVALIAQRNSDLTFADADYNRGKELVGKGYMAKQIFDQRKAKA
FT                   EAAKAALDAAKAQEDQAKFAVQSAEADVQRLEAMLVDLVLRAPRDGRVQYRLAREGEVV
FT                   GAGTRILTLLDLSDVYMTIYLPASQAGPLALNDEARIILDPVPQYVVPATISFVAADAQ
FT                   FTPKSVETEEEREKLTFRIKLQIDPQVLKTYRKRVKTGVRGIGFVRIKGNVAWPPDLAV
FT                   KLP"
FT   sig_peptide     616208..616288
FT                   /locus_tag="Mext_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.795 at
FT                   residue 27"
FT   gene            617247..619985
FT                   /locus_tag="Mext_0565"
FT   CDS_pept        617247..619985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0565"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC-2 type
FT                   transporter; SMART: AAA ATPase; KEGG: rpa:RPA0682 possible
FT                   ABC transporter ATP-binding component, membrane bound"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28980"
FT                   /db_xref="GOA:A9W074"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9W074"
FT                   /protein_id="ABY28980.1"
FT                   /translation="MTDAAEIARLDHVSHRYGRTVALDDVSLGLPAGRMVGVIGPDGVG
FT                   KSTLLALVAGVRRIQTGQVLALGGDMAERRHRAAQGARIAYMPQGLGRNLYPTLSVFEN
FT                   IDFHGRLFGQGQRERRARITDLLTATGLEPFEARPAGKLSGGMKQKLSLCCALIHDPDL
FT                   LILDEPTTGVDPLSRGQFWDLIGSIRARRPGMSVVVATAYMDEASRFEWLVAMDDGKVI
FT                   ASGSPAELLERTAKPDMEAAFIALLPPEKQAQHKPVVLRPRPPGLDTEPAIEAEHLTRR
FT                   FGSFTAVDDVSFRIGRGEIFGFLGSNGCGKSTTMKMLTGLLPSTEGTARLFGRPVGSND
FT                   METRRNVGYMSQAFSLYSELTVLQNLELHAQLYHLPPHDRPVRIRELLDRYELEPVRDA
FT                   RPDSLPLGIKQRLQLAVAVLHRPAMLILDEPTSGVDPIARDAFWRTLIDLSRDEGVTIF
FT                   LSTHFMNEAERCDRISLMHAGRVLAVGTPNDLVRERGSTSVEDCFIGYLAEAAGIDREE
FT                   PAGPPADLPDAGARPTPHRHLFDPRRLWAYARRETMELLRDPIRIAFAFIGPMLLLVAF
FT                   GYGISFDVENLRFSAFDQDNSPESRQLTEAFTSSRYFSEQEPIRSAAELDERFRSGTVQ
FT                   IALEIPPRFGRDLQSGRVPEVAVWLDGAMPFRAETSRGYVTSLASQYAQQLVIERTGAA
FT                   ATGNTVSVETRFRYNQAFRSVNAMVPSVMMLLLILIPAIMSAIAVVREKETGSIANFRS
FT                   TPVTKFEFLVGKQLPYIGIAMISFLLLVLVALIVFDVPVKGSFIALALGTLFYVSATTG
FT                   FGQFISTFMKTQVAAVFATALLSIIPAVNFSGLLVPISSLSGSARIIGLSLPPAWYQPV
FT                   TAGAFTKGLPFIELAPNIAVLAGFAFLFLVLSQLLLRKQEA"
FT   gene            619987..621186
FT                   /locus_tag="Mext_0566"
FT   CDS_pept        619987..621186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0566"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rle:pRL90045
FT                   putative ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28981"
FT                   /db_xref="GOA:A9W075"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A9W075"
FT                   /protein_id="ABY28981.1"
FT                   /translation="MAAPAQAPAQVPARAQVPAPAPLGFGTHVANVFRLIVKELRSIRA
FT                   DPVMLFLVVYAFSFAIVSVASGASTEVRNVSIGVVDEDQSDLSRQIVSAFNPPLFKDVV
FT                   LIGPEEVDPAMDTGRLVFVIDLPPRLQRDVLSGHPTSIELDVDATAMTQAGNGSVYIQT
FT                   IITQEIAAFAARSELNDTAPVRVVTRAKFNPNLQTSWFTSVMQVINNITLLTVILTGAA
FT                   LIREREQGTVEHLLVMPLVPVEIMLAKVIANGMVILVAAGFSLLIVVEWWLGVPIAGSI
FT                   ALFLFGAGLYALAVAALGILLGTIATSMGQFGLLVIPVLLLMQLLSGSSTPMESMPVWL
FT                   QYLVQTVSPTPHFVALAQAVLYRGADLSIVWPQLLALAALGSVYFAFALARFRRVIFGD
FT                   "
FT   gene            621266..623701
FT                   /locus_tag="Mext_0567"
FT   CDS_pept        621266..623701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0567"
FT                   /product="Phosphoketolase"
FT                   /EC_number="4.1.2.9"
FT                   /note="PFAM: D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase; KEGG: bja:bll2518 putative
FT                   phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28982"
FT                   /db_xref="GOA:A9W076"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A9W076"
FT                   /protein_id="ABY28982.1"
FT                   /translation="MTEPTNPQGRTAPSSAPLGGEELALIDRYWQAANYLSVGQIYLLD
FT                   NPLLREPLQPQHIKSRLLGHWGTTPGLNFIYVHLNRLIKARDLDAIYICGPGHGGPGIV
FT                   ANTYLEGTYSEVYPDIAQDTEGMRRLFRQFSFPGGIPSHVAPETPGSIHEGGELGYAIV
FT                   HAFGAVFDNPDLIAACVIGDGEAETGPLAASWQSNKFLSPVTDGAVLPILHLNGYKIAN
FT                   PTVLGRMRDDELESLFTGFGYEPFFVEGDQPEPMHRAMAEALDRAVARIKDIQAEARGG
FT                   GMGFRRPRWPMIILRSPKGWTGPKTVDGKRVEGFWRAHQVPVGNARTDDGHRQILEDWM
FT                   RSYRPETLFDETGRLRPELAALAPEGNRRMSANPHANGGLLRRELRCPRWQDFALTVSM
FT                   PGAEVGEATRTLGRYLRDVIRLNAEARNFRIMGPDETASNRLDAVFEATDRVWIENIEP
FT                   YDVSLAHEGRVMEVLSEHLCQGWLEGYLLTGRHGLFSCYEAFIHIVDSMFNQHAKWLKV
FT                   SRELGWRRPISSLNYLLTSHVWRQDHNGFSHQDPGFIDLVANKKSDIVRVYLPPDANTL
FT                   LWVADHCLQTYDRINVIVAGKQPQPQWLGAHEAGLHCEAGIGIWSWAGTDETGLEPDVV
FT                   MACAGDVPTLETLAAVDLLKQAVPGLRIRVVNVVDLMTLQSNRDHPHGLTDAAFDSLFT
FT                   RDKPVIFAYHGYPYLIHRLTYSRANHANMHVRGFIEEGTTTTPFDMVVLNELDRFHLAI
FT                   EAIDRVPGLVTRAAGAKQAFRDRLTAHKLYIREHGEDMPEIQGWKWPYETRQETGTPH"
FT   gene            623825..624955
FT                   /locus_tag="Mext_0568"
FT   CDS_pept        623825..624955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0568"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG:
FT                   stp:Strop_2657 monooxygenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28983"
FT                   /db_xref="GOA:A9W077"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9W077"
FT                   /protein_id="ABY28983.1"
FT                   /translation="MDTQQAGRVLVAGGGIAGLAVRRALHQQGIASLTLERRGEQADAG
FT                   LAINLPGNAVHALSQFGLLDALRAVGAPVQRREYRTERGRLLFAVDETAFWGTETGPHC
FT                   LRRADLLRLLQGDLPPGDIRRGVEIAAVRQGAQGVTAELADGSTESGGLLVGADGVHSA
FT                   VRRSLFGEQALGSAMLASQSWRFMTPNPGVEAWTLWAGAGALFLLIPVDRGEAYGWASV
FT                   SAGRERGSDPAAIRGAFASFPRLVRDTLDAVLSQPDAIYHSPLEEVRIPAWTRDRVVLL
FT                   GDAAHATAPVWAQGAALALEDAQVLARLLAERPDWDRVGPDYERLRRPRVAHVQSMTDR
FT                   LSRTARMPDWARNVLLPVVGPRSYRATYAPLRTPTG"
FT   gene            complement(625034..625107)
FT                   /locus_tag="Mext_R0007"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(625034..625107)
FT                   /locus_tag="Mext_R0007"
FT                   /product="tRNA-Gly"
FT   gene            625248..626423
FT                   /locus_tag="Mext_0569"
FT   CDS_pept        625248..626423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0569"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: xau:Xaut_4408
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28984"
FT                   /db_xref="GOA:A9W078"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:A9W078"
FT                   /protein_id="ABY28984.1"
FT                   /translation="MRGRGTTGQVLPVQARSSDPPPLFPRRKPAPPTATGQDGVSAASS
FT                   SVRLDIRGVSRRYGRMLALDDVSLSLSAGEILAVLGDSGCGKSTLLRLVAGLDEPDAGE
FT                   IHIDGRRMAGRGGGEPPETRGVGLMFQDYALFPHLTVLANVRFGLSHLPGARARTVARE
FT                   RLAEVGLAGRETSYPATLSGGEAQRVALARALAPRPRVLLLDEPFSNLDAGTRERVRAD
FT                   TLAVLRQDGISAILVTHDAAEAVEFADRIALMRKGRLIQCDTAEALYRAPVSPFAARAL
FT                   GDVVTVAGLASGGRLATPLGTVALPSSRPDGAVQVCLRPEAIRIVPRGEGVPGRVLRRN
FT                   FAGGSTRIDVEIPGLDEPLRLTAAQEDHVDDRIELGLVEGKILVFTQCESA"
FT   gene            626526..627551
FT                   /locus_tag="Mext_0570"
FT   CDS_pept        626526..627551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0570"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bov:BOV_A0655 putative iron compound ABC transporter,
FT                   periplasmic iron compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28985"
FT                   /db_xref="GOA:A9W079"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A9W079"
FT                   /protein_id="ABY28985.1"
FT                   /translation="MLRLRRFGCFVGFSLAFALAGQAESAEVNLYTTREPGLIRPLLDA
FT                   YTAKSGVTVNTVFVEKGLAERVAAEGARGNADVVMTVDIGNLIELVDRDLAQPVRSAVL
FT                   EAAVPAPLRDGDGRWYALSMRARVLYADKALSDLNAATYESLADPKWRGKICLRSGQHP
FT                   YNTALIAAFLVRHGAEKTEEWLRGIKANLARKAAGGDRDVARDIAADLCEIGLANSYYV
FT                   GLMRSGRGGPDQQKWGEAIKVVLPTFEGGGTHVNVSGAVVAKHAPHREEAVKLLEYLVS
FT                   DEAQALYAKADFEYPVKAGVAADSMLQALGPLSFDTTPLVEIARNRKAASLLADKVGFD
FT                   N"
FT   sig_peptide     626526..626603
FT                   /locus_tag="Mext_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.695 at
FT                   residue 26"
FT   gene            627628..629280
FT                   /locus_tag="Mext_0571"
FT   CDS_pept        627628..629280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0571"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pde:Pden_4446
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28986"
FT                   /db_xref="GOA:A9W080"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9W080"
FT                   /protein_id="ABY28986.1"
FT                   /translation="MTPARGLLYAAAALLAAVLLAPVASLAVAAADGSGELWPHLAAYV
FT                   LPQAIRETGLLLAGVGILVIGLGTGTAWLVSAFAFPGRRLLDAALLLPLAVPTYVVAYA
FT                   YLDLMHPLGPVQSGLRGLLGLSSPRDLSFPDLRSLPGCILLLGFVLYPYVYLPTRALFL
FT                   MRAGTLLEAARMLGAGPARTFFRVALPLARPAIALGTGLALMEALNDVGAAEFLGVRTL
FT                   TVQVYATWVNRSDLPGAAQIALVMLAGVVGLVALERLARGGRGYAGSGHRDRPTARRPL
FT                   SGWRAGLALGLGLTPVLLGFGLPAGYLAWAVWQRLKGMGLPDTLAAQALNTVLYAGAAT
FT                   LVTVAVGLLVAASPHLLGRRSGLALIRAAGLGYAMPGTVLAVGLLAPLALLDTGLTNLA
FT                   GAGLGWAPAVGLGTGAALVIAYTLRFLTIPVGATEAGLARIPSTLPDAARMLGRGRFGT
FT                   LLAVQLPLAWPAVLSGALLAFVDMAKELPVTLLLRPLNVETLSTHLYGEAARGTYEDGA
FT                   ASALLIVMTGLIPVALLLRLNRGAGLRPSRSDA"
FT   sig_peptide     627628..627720
FT                   /locus_tag="Mext_0571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.655 at
FT                   residue 31"
FT   gene            complement(629703..630158)
FT                   /locus_tag="Mext_0572"
FT   CDS_pept        complement(629703..630158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28987"
FT                   /db_xref="UniProtKB/TrEMBL:A9W081"
FT                   /protein_id="ABY28987.1"
FT                   /translation="MRRSPFVAPGNPVPCNGPRGKSRFEFNPGRCVCLGTSCSSSIPYI
FT                   SNTRGRDCAFKRKRRTRESEHHMKTRLAAVVAAVIIGVTAPASSVMAFDRNARPATTSD
FT                   VEVTGSLGVHDSPAHTACPMSSAAEGNANQQNFPVKQYGQTSGGTRC"
FT   gene            complement(630242..630967)
FT                   /locus_tag="Mext_0573"
FT   CDS_pept        complement(630242..630967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0573"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540; KEGG:
FT                   bmb:BruAb1_0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28988"
FT                   /db_xref="GOA:A9W082"
FT                   /db_xref="UniProtKB/TrEMBL:A9W082"
FT                   /protein_id="ABY28988.1"
FT                   /translation="MLIKAAAAAMRQVFSPALRGILFKSLALTIGLLVVVWFGLTRLIQ
FT                   AFQASHHISADYPFLDTLAFFLAGAGLFVALAYIMPAVSILVAGFFLDDVAEVVEHSDF
FT                   PADTPGRALPWGQSLGSAFRFAGLALLVNFVALILVFVPGVNLVAFFGANAYLLGREYF
FT                   ELAAGRFRSLPEARAMREHYGFTVIAAGCLLAGLMIVPIVNLVTPLFGVALMVHLHKGL
FT                   ERRALPGPAETNPRLPNRR"
FT   gene            631127..632092
FT                   /locus_tag="Mext_0574"
FT   CDS_pept        631127..632092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0574"
FT                   /product="Kelch repeat-containing protein"
FT                   /note="PFAM: Kelch repeat-containing protein; Kelch repeat
FT                   protein; KEGG: noc:Noc_0230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28989"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:A9W083"
FT                   /protein_id="ABY28989.1"
FT                   /translation="MAHPALSRLVLLGSLLATVPATLPAAAHEVGAWAGASSAPAERSE
FT                   VAVAALDGKAYVIGDYNGATELLIYDLATDRWSKGAPFPYPVHHTMAAEQGGRVYVFGG
FT                   YVNGWEATDKVWAYDPKAKAWEARAPMPTPRAAGGAAPLGDKIHVVGGSGTGRGNVRSH
FT                   KVYDPANDRWSTAADLPTPRDHLAVQTVEGRIVASGGRIDGDSSKNLAANQVYDPARDA
FT                   WSEAAPLPTARSGVASAVLGREVFVIGGESNRRTYDEVEAFDLPGNLWRALARLPTARH
FT                   GFGAVTYKGRIFTLTGSPRPGGDRSGTVEVLDPNGAAPAR"
FT   sig_peptide     631127..631210
FT                   /locus_tag="Mext_0574"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 28"
FT   gene            632180..633508
FT                   /locus_tag="Mext_0575"
FT   CDS_pept        632180..633508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0575"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: bja:blr0703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28990"
FT                   /db_xref="GOA:A9W084"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9W084"
FT                   /protein_id="ABY28990.1"
FT                   /translation="MRPAPEHARFRPTVGPRVSPIPAAPDVIVIGAGAAGIASARRLIA
FT                   RGLSVAVLEARERVGGRAVTTQLSGHAIDLGAHWMHAGPINPLVALARSRGEPLRRAAQ
FT                   HEHLWIGRRPARADEEAAFSRAFDVADRAITGAASRAQDGPAAGALPRHLGPWRERIAG
FT                   VHALVSGRPLEEVSLHDWPSMEYGDNFFIAGGYGAYLARLSLGLPIRLGCPVAGLEWSG
FT                   PGVRVQLADGGRLAARAVIVTVPMPVLQAAFRFDPPLPERTRAAIDGFLSGIYEHVVLH
FT                   WPSAPFHGRDRLASVVGGRHKPPGMLTRIDGTPFHYFELDTALARALDAAGTGSDGARR
FT                   LARAVLAEHFGRAALADLAIPAVTAWRHDPLSRGSWAVVPPGHAAARATLQEPVGERIW
FT                   FAGEANSRAQWGTAGGAYEEGQRAADRVADTLTDDRAPLRASA"
FT   gene            633617..634252
FT                   /locus_tag="Mext_0576"
FT   CDS_pept        633617..634252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0576"
FT                   /product="cyclic nucleotide-binding"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: rpb:RPB_1692
FT                   cyclic nucleotide-binding domain (cNMP-BD) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28991"
FT                   /db_xref="GOA:A9W085"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:A9W085"
FT                   /protein_id="ABY28991.1"
FT                   /translation="MNWVEAIGYLGTALTVASSAMGTMIPLRIVALCASCAVITYGYLI
FT                   GSVPVMLTEAIQIPFNAWRLYEMVRLVRETERAASGDLSLDWLKSFGTSRRFRAGEVLF
FT                   LKGDPAQEMYLIESGRFRIAEHGLDVRPGQIVGELGMLSPGNRRTGSLACVEAGTARCL
FT                   SYSEVKQLYYQNPEFGLYFLKLTSERLFQSAAEAAGAQRTVPAGSDVL"
FT   gene            complement(634256..634675)
FT                   /locus_tag="Mext_0577"
FT   CDS_pept        complement(634256..634675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0577"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   acr:Acry_2974 cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28992"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9W086"
FT                   /protein_id="ABY28992.1"
FT                   /translation="MDEPGSAGHAVFDVAESVRRLPETAATMVADHRFTDDETASARVF
FT                   RVYRPTPPHYHTTCDEYLYALSGRCRMQFGDAAPIEVGPGMLVFFKRGVVHSVPEILEE
FT                   PVVFLSVDTPRRGPRDIQFVEAGTGTPDSFMRQPD"
FT   gene            634913..635086
FT                   /locus_tag="Mext_0578"
FT   CDS_pept        634913..635086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28993"
FT                   /db_xref="UniProtKB/TrEMBL:A9W087"
FT                   /protein_id="ABY28993.1"
FT                   /translation="MADVATVIEQAQREGRDLATALRIARVTLAYVSGPEPEPDQARAL
FT                   EALDRQLRALSD"
FT   gene            complement(635513..635803)
FT                   /locus_tag="Mext_0579"
FT   CDS_pept        complement(635513..635803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28994"
FT                   /db_xref="UniProtKB/TrEMBL:A9W088"
FT                   /protein_id="ABY28994.1"
FT                   /translation="MSLPNPAKNASDRDVPTILFGLLADGSGEARFGAGTPIEVGPSSE
FT                   AARFSPSRDWYGRWAVQPLHGILKQDATRMDRVVCPEDIVILGPRRHARRV"
FT   gene            636081..636227
FT                   /pseudo
FT                   /locus_tag="Mext_0580"
FT   gene            636438..637505
FT                   /locus_tag="Mext_0581"
FT   CDS_pept        636438..637505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0581"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: smd:Smed_4544 sulfate ABC
FT                   transporter, periplasmic sulfate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28995"
FT                   /db_xref="GOA:A9W089"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="UniProtKB/TrEMBL:A9W089"
FT                   /protein_id="ABY28995.1"
FT                   /translation="MWRRDDVFDGYPIKPGATPYRRAVLLGLAMTVCLASAGSAQAQTE
FT                   ILNVSYDPTRELYREVNAAFAEEWKAKTGETITVRAAHGGSGAQARTVIDGIPADVVTL
FT                   GIPSDIDAIAKISKKIPADWRTKLPNEGLPYTSTVVFLVRKGNPKGVKDWDDLAKPDVK
FT                   VITPNPKTSAGGRWNFLAAWGYAYERDGRDKEKANAFLGSLYKNVPVLDTGARGSTVTF
FT                   AQRGLGDVLPTWENEAFLVLEEFGKDKFDIVVPPTSIYAEPPVALVDANVDKKGTRKQA
FT                   EAYLQFLYGDKAQAIFAKHHYRPIKREAAKPEDLAQLPEIKLFKIEDLQGSWDEIQKAN
FT                   FDNGGLFDQLSKAGR"
FT   sig_peptide     636438..636566
FT                   /locus_tag="Mext_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.985 at
FT                   residue 43"
FT   gene            637510..638364
FT                   /locus_tag="Mext_0582"
FT   CDS_pept        637510..638364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0582"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysT; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00258 probable
FT                   sulfate uptake ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28996"
FT                   /db_xref="GOA:A9W090"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9W090"
FT                   /protein_id="ABY28996.1"
FT                   /translation="MGEPVKPRRRFRQRSVIPGFGLTLGYTLTCLSLIVLLPLATLVVK
FT                   ASGLGLSGIWDVATDPRVASALRVSFGVSLLAALTASVFGGIVAWVLTRYDFPGRKLAD
FT                   AVVDLPFALPTAVAGIALASLYAPNGLVGEQLAKVGIEAAYTPVGIFIAMVFIGLPFAV
FT                   RTVQPLIAEIDKEVEEASAILGASRITTLTRVVLPPLIPAVLTGFALAFARGVGEYGSI
FT                   IFIAGNLPYVSEIAPLLIVIKLSEFDYAGASAIAVIMLAISFVTLLAINLIQAWSRRRF
FT                   GYV"
FT   gene            638357..639259
FT                   /locus_tag="Mext_0583"
FT   CDS_pept        638357..639259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0583"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysW"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysW; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bms:BR0109 sulfate ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28997"
FT                   /db_xref="GOA:A9W091"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9W091"
FT                   /protein_id="ABY28997.1"
FT                   /translation="MSEALAQSPGTRTRHETLRLPASVVTERRVVRWLLIAVALTFLGL
FT                   FLVLPLLTVFAQALAKGWGAYLAAFSEPDAHSAIRLTLIVAAIAVPFNLVFGVAASWAV
FT                   AKFEFAGKNLLVTLIDLPFSVSPVVSGLIYVLVFGSRGLFGPFLVEHDIQIIFAVPGIV
FT                   LATIFVTFPFVARQLIPLMQEQGTAEEEAALTLGASGWHAFRTVTLPNIRWGLLYSVLL
FT                   CNARAMGEFGAVSVVSGHIRGLTNTLPLHVEILYNEYNFVAAFAVASLLAGLALVTLAV
FT                   KSVLEWRYADDIAAGARRH"
FT   gene            639261..640307
FT                   /locus_tag="Mext_0584"
FT   CDS_pept        639261..640307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0584"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="KEGG: mlo:mlr1669 ATP-binding protein of sulfate ABC
FT                   transporter; TIGRFAM: sulfate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28998"
FT                   /db_xref="GOA:A9W092"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9W092"
FT                   /protein_id="ABY28998.1"
FT                   /translation="MLGTATAIRIEDVSKTFETAAVLHDFTLDVRAGELLALLGPSGSG
FT                   KTTLLRIIAGLDFPDRGRIIFGGDDATQVPVQQRAVGFVFQHYALFKHMTVAQNIAYGL
FT                   NARKRSERPDKAEIKRRVGNLLDLIKLSGFADRYPSQLSGGQRQRIALARALAVEPRVL
FT                   LLDEPFGALDAQVRKDLRRWLREIHDRTGQTTIFVTHDQDEALELSDRVAVLDRGRLEQ
FT                   VGTPDEVQENPVSPTVLKFLGDTIEVEAIAQNGQVLVNGRPTPLTAPNGLVGPVKLYAR
FT                   PWQLQFAELDTAHLTGTVRSSYRTQGRQRIEIDRPGAKVVVVEAADTARLAAGREVGLR
FT                   IVGGHVFP"
FT   gene            complement(640726..640802)
FT                   /locus_tag="Mext_R0008"
FT                   /note="tRNA-Met7"
FT   tRNA            complement(640726..640802)
FT                   /locus_tag="Mext_R0008"
FT                   /product="tRNA-Met"
FT   gene            complement(640883..640997)
FT                   /locus_tag="Mext_R0009"
FT   rRNA            complement(640883..640997)
FT                   /locus_tag="Mext_R0009"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(641134..643958)
FT                   /locus_tag="Mext_R0010"
FT   rRNA            complement(641134..643958)
FT                   /locus_tag="Mext_R0010"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(644271..644346)
FT                   /locus_tag="Mext_R0011"
FT                   /note="tRNA-Ala8"
FT   tRNA            complement(644271..644346)
FT                   /locus_tag="Mext_R0011"
FT                   /product="tRNA-Ala"
FT   gene            complement(644353..644429)
FT                   /locus_tag="Mext_R0012"
FT                   /note="tRNA-Ile5"
FT   tRNA            complement(644353..644429)
FT                   /locus_tag="Mext_R0012"
FT                   /product="tRNA-Ile"
FT   gene            complement(644635..646112)
FT                   /locus_tag="Mext_R0013"
FT   rRNA            complement(644635..646112)
FT                   /locus_tag="Mext_R0013"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(646766..647287)
FT                   /locus_tag="Mext_0585"
FT   CDS_pept        complement(646766..647287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0585"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="KEGG: bbt:BBta_0200 putative membrane protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABY28999"
FT                   /db_xref="GOA:A9W093"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:A9W093"
FT                   /protein_id="ABY28999.1"
FT                   /translation="MASGNFSAHPDGLDPATMDRPVYSAVIRPHQSLSQDGFRIVMGLC
FT                   CLVSLVTSIACWRAGFWPIAGFFGLDMLALYVALKVSFRRGRSFEEVAISPLEVFLARI
FT                   DPRGVRREWRFNPLWTKLSRIDDDEFGLRTLTLTSRREHVVVARDASPDERAIVADGLT
FT                   RALAQVKRGF"
FT   gene            647308..648120
FT                   /locus_tag="Mext_0586"
FT   CDS_pept        647308..648120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0586"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: rru:Rru_A0153 endonuclease III/Nth; TIGRFAM:
FT                   endonuclease III; PFAM: HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29000"
FT                   /db_xref="GOA:A9W094"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A9W094"
FT                   /protein_id="ABY29000.1"
FT                   /translation="MSAKKPSSRPSAPGAVKSQSAKSVERTAKPAKLKAKLMPALAAGV
FT                   ETSPEPVDDATLVEIFSRLRAADPEPRSELEYLNPYTLLVAVVLSAQATDKSVNLATAP
FT                   LFTIADTPQKMLDLGEERVRHFIRTIGLFNTKAKNVIALSRILLERHGGAVPCEAEALE
FT                   VLPGVGTKTASVVLNVAFGVPRIAVDTHIFRVSNRIPLFSAATTDKVQAGLEARVPEPF
FT                   RLNAHHWLILHGRYICKARRPECPRCSIADLCRYPSKTTALTPISAGD"
FT   gene            648314..649108
FT                   /locus_tag="Mext_0587"
FT   CDS_pept        648314..649108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0587"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: rpb:RPB_3719
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29001"
FT                   /db_xref="GOA:A9W095"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:A9W095"
FT                   /protein_id="ABY29001.1"
FT                   /translation="MDFLKPRYTPMNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAF
FT                   NAKKHEVIDGKGVLNNRISEFVFQHLNDIGVPTHFIRRLNMREQLIREVEIIPLEVVVR
FT                   NVAAGSLATRLGLEEGTQLPRSIIEFYYKNDQLNDPMVSEEHITAFGWATPQEIDDIMA
FT                   LAIRVNDFLSGLFLGVGIRLVDFKMETGRLWEGDLMRIVVADEISPDSCRLWDIKSSDK
FT                   LDKDRFRKDLGGLIEAYTEVAKRLGIMSENEKVQAGGPRLVQ"
FT   gene            complement(649115..650770)
FT                   /locus_tag="Mext_0588"
FT   CDS_pept        complement(649115..650770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0588"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mca:MCA0620 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29002"
FT                   /db_xref="GOA:A9W096"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9W096"
FT                   /protein_id="ABY29002.1"
FT                   /translation="MSADGLPPAWPDALLFAAEPVPGRLALLARALRQPKRTLPILSAR
FT                   LSGRRLRAAQAFVALVGAHHHLDRPRIVPPPSEPQAALAAAGIERVVTDATGAIRITAD
FT                   GPPIVLLTSEGQHIAAGAGAAIAAAFADPDRHAIYGDALFRHVAHGSWLPLLRPAFDRD
FT                   YLRTVDYLGPVIALRRASVIGIDTVPGAIALDLALAIAHRFGPGAVRHLPRVLSFGRFD
FT                   ETGEGRAARREAVRRDLDRVGEGGTPVLVGQDGVIRLDRPLPEPRPLVSLIVPTRDRLD
FT                   LLRPCIESLRHRTDWPAKEILICDNDSRDPETLAYFRTLEAEGAARVVACPGPFDFAAI
FT                   NNRVAAQARGRLLAFINNDVEAEAPDWLERMVREALRPEIGAVGARLVDGEGRIQHGGI
FT                   VLGTGGLVTHGHRYFAGDAAGYLGALHATRSVSAVTAACLVIEADKFSRVGGFDASTFA
FT                   IDFNDVDLCLRLNTIGLRTLYVGGARLHHRESASRRPSPAAAARHRAEVEALKKRWGPL
FT                   LAQDPHYHPGFDPDLSTHLRLRRGWTGLEPAEPR"
FT   gene            complement(650767..652821)
FT                   /locus_tag="Mext_0589"
FT   CDS_pept        complement(650767..652821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0589"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gbe:GbCGDNIH1_0744 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29003"
FT                   /db_xref="GOA:A9W097"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9W097"
FT                   /protein_id="ABY29003.1"
FT                   /translation="MAKPDARRGDGWDLWRGRETSFSLVSIDDPLFDRRLLLSPPDRRP
FT                   WQDRWIVLTYTLAVRAWPQRPLLRLLRSAGRRDSFVLPGVALGAARWLGYLPGDCEGIE
FT                   IAAEPGFVLERVGLRSSASVFAEALLKRPGRAVAALRAGLARDERRWRDSLRGACAVSP
FT                   LARYPAWKASRLFRAASTEPRSGAQIRLVLPAPFAQADAVARSVASLRAQTHQDWSLLI
FT                   AWTDGAPPTNPGIDRRVLNISWNPAATLRELAGGADLFGLLRPGDVLAPEALHLLAKSR
FT                   EAEASEMVYADEETGGRTLRPRLKPDWSPDLALAMGYVGAPALIAGDFLARLPAEPVDT
FT                   PDALAVTLDLAASSATRVAHIPRILCRREPVTADPAARAPHLDQHLRSTGSSARAALRD
FT                   GRLDLQWPLPDPAPLVSIIIPSRDRFDLIARVTEDVLEKTPYPALELVIVDNGSKEPAV
FT                   LDLYERLRLDPRVRIEPYPHPFNFSALVNAGARKARGGVLVLLNNDVAVLRPDWLDVLV
FT                   AQAVRPEVGAVGAKLLYEDGRLQHAGVVVGLGGEAGHILRRRPADTPGHLDRLSVAHEV
FT                   SGVTAACLAVTRDKYQAVGGFDEETFAVDFNDIDFCLRLGVRGWKTVWTPHAVLSHLES
FT                   VSRGRPVGEARARFEREAAAFTERWRDVIRHDPFYHPALSLTTFGEELE"
FT   gene            complement(652880..653512)
FT                   /locus_tag="Mext_0590"
FT   CDS_pept        complement(652880..653512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_2202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29004"
FT                   /db_xref="UniProtKB/TrEMBL:A9W098"
FT                   /protein_id="ABY29004.1"
FT                   /translation="MRRALIIFGGLVLAVPGTARAEPGSFFKNMFGGREGDAPAVTAPR
FT                   AQDPDDVYCPPVFVPDGGAAVQAFAGAAGDNRRLRHQIVLGRLSRECKARPDGSVAVRV
FT                   GVELRALLGPAGAAGRFEVPVSIGVKFNEQPVMMRSHRVAVAVPAGAAQGEATVIENDL
FT                   TVPADKAMGYDIEVTLAGASARPKPAVRRRKPAPAAAAEQGEAPAAQ"
FT   sig_peptide     complement(653447..653512)
FT                   /locus_tag="Mext_0590"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(653573..654115)
FT                   /locus_tag="Mext_0591"
FT   CDS_pept        complement(653573..654115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0591"
FT                   /product="Invasion associated locus B family protein"
FT                   /note="PFAM: Invasion associated locus B family protein;
FT                   KEGG: xau:Xaut_4649 invasion associated locus B family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29005"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A9W099"
FT                   /protein_id="ABY29005.1"
FT                   /translation="MSLFAGVVRALRPGTGRRLALVAATAATVLVAGGAAQAQGTVRKT
FT                   FDDWQLRCETPAGAKAEQCALVQYVAAEDRPNLNLVVIVLKIADNRGYLLRVQAPLGIL
FT                   LTSGLGLKIDQTDIGRASFVRCLTMGCVAEVVMDDGLIKSMRNGSQSTFIVFQTPEEGV
FT                   GIPVSMKGFGPGFDALK"
FT   sig_peptide     complement(653999..654115)
FT                   /locus_tag="Mext_0591"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.978 at
FT                   residue 39"
FT   gene            654274..654771
FT                   /locus_tag="Mext_0592"
FT   CDS_pept        654274..654771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29006"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0A0"
FT                   /protein_id="ABY29006.1"
FT                   /translation="MGQSGYPSRPACPKVRSSSRSSEETAMRRLASPLALATLLVAAGC
FT                   GGASALSLPFEESDYLPPEATTTYVERSLNHQAPLTIEHPPVERNPRGRRRGDAAAIAG
FT                   FCRDGGTVMRRDAMGRPTYLRQREICDNVAPRTLWPGHVNPRPTWPAEAAPARSRAIVT
FT                   KY"
FT   sig_peptide     654274..654426
FT                   /locus_tag="Mext_0592"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.782 at
FT                   residue 51"
FT   gene            complement(654858..655640)
FT                   /locus_tag="Mext_0593"
FT   CDS_pept        complement(654858..655640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0593"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   nwi:Nwi_0131 protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29007"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0A1"
FT                   /protein_id="ABY29007.1"
FT                   /translation="MREGLLGWLRRPAAARLAGMTRALLRRPDPDHIEIAHDGQTFRIA
FT                   ILRRPTARRLTLRVSSATGTVVLTLPTRSSLATAQKFAQSHGGWIATRLAKLPERVPFA
FT                   EDAVIPLRGVPHRIVAREGRGMAEADPASATLGVPGDPAHMPRRVREFLMREARRDLSQ
FT                   SVAVYATRLGQRPARVTLRDTRSRWGSCTARGELNFSWRLILAPPVVLDYLVAHEMAHL
FT                   REMNHSPRFWALTNELCPHVDEAERWLKRHGSELHRYG"
FT   gene            complement(655679..656923)
FT                   /locus_tag="Mext_0594"
FT   CDS_pept        complement(655679..656923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0594"
FT                   /product="polyhydroxyalkanoate depolymerase, intracellular"
FT                   /note="TIGRFAM: polyhydroxyalkanoate depolymerase,
FT                   intracellular; PFAM: PHB de-polymerase domain protein;
FT                   KEGG: mlo:mll4552 intracellular PHB depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29008"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0A2"
FT                   /protein_id="ABY29008.1"
FT                   /translation="MDLAYIWYETARAMLTPARLAADAARHSLANPGNPFAYGPYARSA
FT                   AAALEMFERVTRRYGKPAFGLPTTVIDGQVVPVSERVVWERPFGRVIAFDRALPAGHSE
FT                   PQPKLLIVAPMSGHYATLLRGTVEAMLPNHRVFITDWSDARMVPLLDGRFDLGTYIDYL
FT                   QAMFRDLGPDLHVMAVCQPAVPVFAAVALMEAADSAHVPVSMTLMGGPIDTRRSPTAVN
FT                   CLAQERGMAWFEKNCITVVPPLYPGAMRRVYPGFLQLSGFMAMNLDRHVTAHTDMFHHL
FT                   VTGDGDSAEKHRDFYDEYLAVMDLTAEFYLQTVQTVFVDHALPRGRMRHDGRLVDLSAI
FT                   RRCAILAVEGENDDISGVGQTKAALDLTPNLPDARKAYHMQEKVGHYGVFNGSRFRSVI
FT                   APRIARFVREMEGSA"
FT   gene            657069..658463
FT                   /locus_tag="Mext_0595"
FT   CDS_pept        657069..658463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0595"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: mlo:mlr5307
FT                   two-component, sensor histidine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29009"
FT                   /db_xref="GOA:A9W0A3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0A3"
FT                   /protein_id="ABY29009.1"
FT                   /translation="MMEAAHKTLTPTGRHLRLDTFVRLRWLALTGQSAAVVGAQFGLGL
FT                   NLPFGWCFLVIATSCWLNLALRIRFPASYRLSDDSAALLLAFDIVQLAGLLFLTGGLQN
FT                   PFSLLFLAPVLISATALPPERTLALGLLAVGLATLLALVHRPLPWFADGRIELPFLYVS
FT                   GVWTAILLGTAFTGVYAWRVAEETRQLARALAATELVLAREQHLSQLDGLAAAAAHELG
FT                   TPLGTIMLVAKELDRQLGPTASPAIAEDLSLLRDQVDRCRGILSKLTSMGEENEEGETF
FT                   LQTVTFGHLVEELVAPQRALGIAVEVVRQGDGPEPVCRRNPGVMFGLANILDNAVDFAE
FT                   SRVVLEAGWDTERVTLTVRDDGPGFPSEVLLRAGEPYVTTRNRDRSQNPDEVGGGLGLG
FT                   LFIAKTLIERSGAQLLLSNITEVGQHGALVRVTWARHIFEREVIVPHRVAHNSLRPLTE
FT                   RDAAPI"
FT   gene            658473..659102
FT                   /locus_tag="Mext_0596"
FT   CDS_pept        658473..659102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0596"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bov:BOV_0131 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29010"
FT                   /db_xref="GOA:A9W0A4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0A4"
FT                   /protein_id="ABY29010.1"
FT                   /translation="MTRTDEEHRMLTQSGTTVPGSDTAFLSDADPLSAFSDRSLLIVDD
FT                   DKPFSTRLARAMEARGYEVHVAESVSEGVAAVETKAPAFAVIDMRLGDGNGLDVIARLK
FT                   ERRPEARGVILTGYGNIATAVTAVKLGAFDYLAKPADADEIHGTLMAQPGERADPPENP
FT                   MSADRVRWEHIQRVYELCSRNVSETARRLNMHRRTLQRILAKRAPR"
FT   gene            659284..659508
FT                   /locus_tag="Mext_0597"
FT   CDS_pept        659284..659508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0597"
FT                   /product="putative exported protein of unknown function"
FT                   /note="KEGG: xau:Xaut_0190 putative exported protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29011"
FT                   /db_xref="GOA:A9W0A5"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0A5"
FT                   /protein_id="ABY29011.1"
FT                   /translation="MRNLITILGLMVLVGTEVFAAAIAAGWAVAGLLDLGDQVGHVLMA
FT                   LFSLVAAWIMVQLWRRAIEAEPIGSARRR"
FT   sig_peptide     659284..659346
FT                   /locus_tag="Mext_0597"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.771 at
FT                   residue 21"
FT   gene            659700..659939
FT                   /locus_tag="Mext_0598"
FT   CDS_pept        659700..659939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0598"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: nha:Nham_1634 phosphoribosylformylglycinamidine
FT                   synthetase PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29012"
FT                   /db_xref="GOA:A9W0A6"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0A6"
FT                   /protein_id="ABY29012.1"
FT                   /translation="MKARIVVTLKTGVLDPQGKAIEAALKSFGIDEVSGVRQGKVFDLE
FT                   VASENREQAEATLKAACEKLLANTVVENYTVEIA"
FT   gene            659939..660619
FT                   /locus_tag="Mext_0599"
FT   CDS_pept        659939..660619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0599"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: bja:bll5723 phosphoribosylformylglycinamidine
FT                   synthase I; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase I; PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29013"
FT                   /db_xref="GOA:A9W0A7"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0A7"
FT                   /protein_id="ABY29013.1"
FT                   /translation="MRAAVVVFPGSNRDGDVARALRRSGAEVVSVWHADTELPAGTDLA
FT                   VVPGGFSYGDYLRCGAIAGRAAAMDAVRAHAARGGLVLGICNGFQILCESGLLPGVLMR
FT                   NVNRRFICHRQFLRVERADTRFTSAYTEGQVIDVCVAHGEGNYFADSETIGRLEGEGRI
FT                   AFRYCDASGALTEDANRNGSLNSIAGIYSEQRNVLGMMPHPENFVDGLVGGTDGKGLFD
FT                   SLAA"
FT   gene            complement(660745..661290)
FT                   /locus_tag="Mext_0600"
FT   CDS_pept        complement(660745..661290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0600"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="KEGG: rpd:RPD_4212 adenine
FT                   phosphoribosyltransferase; TIGRFAM: adenine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29014"
FT                   /db_xref="GOA:A9W0A8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9W0A8"
FT                   /protein_id="ABY29014.1"
FT                   /translation="MEARRHSALKDSVRSIPDYPKPGIIFRDITTLLSDPRSFRRAVDS
FT                   LVHPYAGGRIDQVAGIEARGFILGGAVAHQLSSGFVPIRKKGKLPHKTVSTAYALEYGT
FT                   DEIEIHVDAIKPGDRVILVDDLIATGGTATAAVNLLRQLGAEVVAACFVIDLPEIGGAQ
FT                   RLRDLGVTVRTLMEFEGH"
FT   gene            complement(661373..662167)
FT                   /locus_tag="Mext_0601"
FT   CDS_pept        complement(661373..662167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0601"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="PFAM: inositol monophosphatase; KEGG: nwi:Nwi_2740
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29015"
FT                   /db_xref="GOA:A9W0A9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0A9"
FT                   /protein_id="ABY29015.1"
FT                   /translation="MINSPLMTVMVDAVRKAARGLKRDFGEIENLQVSRKGPGNFVSAA
FT                   DRKAEEVLRDALMKARPGYGLIMEESGTIEGTDRSHTWHVDPLDGTTNFLHGIPHFAIS
FT                   VGLERDGQIVAGVIYDPAKDELFIAERGKGAFLNNRRLRVSGRQDFADALVAYGTPYLG
FT                   RGSHGRLLKEVAAVMAVSGGTRRLGSAALDLAYVACGRTDLYWERDLQTWDIAAGIILV
FT                   REAGGFVSSADGGAEPLAARSVACGNEVLHRELIGLLRKAAA"
FT   gene            complement(662450..663067)
FT                   /locus_tag="Mext_0602"
FT   CDS_pept        complement(662450..663067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0602"
FT                   /product="thiamine monophosphate synthase"
FT                   /note="PFAM: thiamine monophosphate synthase; KEGG:
FT                   xau:Xaut_2226 thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29016"
FT                   /db_xref="GOA:A9W0B0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0B0"
FT                   /protein_id="ABY29016.1"
FT                   /translation="MTLPPLLVVTDRHGAARPLTETVRAAVAGGAPFVWLRDRDLDRDA
FT                   RRDLARDLIGLLQPVGGRLVVGGDADMAAETGAQGVHLPGSAGIDGIRAARMALGAAAL
FT                   IGFSAHSVAEIAAAAAAGAGYATLSPIFPTASKPGYGPALGLDSLRAAAAHGLPVFALG
FT                   GIDMGNARACREAGAAGVAVMGGVMRGSDPRDATARFVAALT"
FT   gene            complement(663074..663895)
FT                   /locus_tag="Mext_0603"
FT   CDS_pept        complement(663074..663895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0603"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   xau:Xaut_2225 thiazole biosynthesis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29017"
FT                   /db_xref="GOA:A9W0B1"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0B1"
FT                   /protein_id="ABY29017.1"
FT                   /translation="MNHHDTTLAQTSAVGDASGDDALEIAGIRLASRLFIGTAGYPSQE
FT                   IMAQSVRASGAEVVTASIRRVSLQGHGSDTFQKLKGARFLPNTAGCETARDAIMTAELA
FT                   REALGTSWIKVEVIGDRETLYPDVTELLEACRHLVDDGFTVLPYCNDDPVICERLADLG
FT                   CAAVMPMGSLIGSGMGIANPANIELICRRAKVPVIVDAGIGTASDAVIAMELGAAACLV
FT                   NTAVAKADDPVRMAGAMRHAVEAGRLAHLAGRIPRRGRAEPSSPQLGLVGS"
FT   gene            complement(663898..664110)
FT                   /locus_tag="Mext_0604"
FT   CDS_pept        complement(663898..664110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0604"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: xau:Xaut_2224 thiamine
FT                   biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29018"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0B2"
FT                   /protein_id="ABY29018.1"
FT                   /translation="MRLTVNGETCEREAADLAALFAAEAEERGIESDQGIAIAVNGRVV
FT                   RKSAWAETSLNEGDRIEIVRAMQGG"
FT   gene            complement(664107..665429)
FT                   /locus_tag="Mext_0605"
FT   CDS_pept        complement(664107..665429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0605"
FT                   /product="glycine oxidase ThiO"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: xau:Xaut_2223 glycine oxidase ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29019"
FT                   /db_xref="GOA:A9W0B3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0B3"
FT                   /protein_id="ABY29019.1"
FT                   /translation="MGRSYERTRFYRSTWCQFLRADPWKARFSMSDLLTSPIGQRRSLA
FT                   IRPRAAELPQRADVAVVGAGLIGLSIAWRLAQAGRSVAVVERGSVGSGASLAATGMLAP
FT                   AAEHEPGSDLLLPLALESLRRWPAFRDALQAASGREIDYREDGTLVIAIGRDEVERLRF
FT                   RHDLQRRSGVAAEWLSGPEVRAREPLLRPNVTAGILCPLDAQVDPRLVMEALLCACEAA
FT                   GVVISEGVAVDGLERRGGRVTGLHAAGRTLTADTVILAAGAWSGDASLLPSDLDVPDLS
FT                   VPVRPLKGQSLALRTTKRTGTLSRMVWTDAVHMAPKGDGHLIVGATVEDCGFTSGVTAG
FT                   GMFALLEGARRVLPGIEEMEIDAVWSGFRPTSDDDAPIIEEAAPGLVLATGHHRNGYLL
FT                   APATADAVATLLTEGALPDFARGFGRARFSSSHQTGGRAVA"
FT   misc_binding    complement(665421..665543)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 53.62"
FT   gene            complement(665667..667067)
FT                   /locus_tag="Mext_0606"
FT   CDS_pept        complement(665667..667067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0606"
FT                   /product="adenylyl cyclase class-3/4/guanylyl cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: smd:Smed_4273 putative adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29020"
FT                   /db_xref="GOA:A9W0B4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0B4"
FT                   /protein_id="ABY29020.1"
FT                   /translation="MRPSSFVKAGACRAFVVHHGLKAPAVSRAKPCFEHPRTHLPAMRD
FT                   ADAPKPTPTALADGSEAEDVPFGALQRCVGIRDWLLGEGARLPRADDLLAGLAERLNAI
FT                   GVPIDRASTAIDTLHSEYSGVGRVWTRGAGSTVRLFPHGEVSAKAYQVSPFSTVHETGE
FT                   WLSLDLAETAEDAYAIIPELKADGYTHYLVAPLIFTNGNKNGITFATRAKDGFRDEDIA
FT                   ILRFVMPALAAVMEMRILNKQLDTVLRIYVGDEPHRAILSGDIRRGQVRRIRSAILFAD
FT                   MRDYTRLSANRTPEGAVDLLNAFFDCLVPPIEREGGEVLKYLGDGLLAIFRESGDDLGG
FT                   AAKSALTAAEAALAALAEANAVGRFGQGERVVDAGIALHHGEAAYGNVGSGTRLDFTVI
FT                   GRDVNLASRLARLNRTLQEPLLMSKPFVDFLWGDPDPLGSHVLDGFDEPMAVYRPGRRR
FT                   AAEAAAAE"
FT   gene            667238..667606
FT                   /locus_tag="Mext_0607"
FT   CDS_pept        667238..667606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mag:amb3555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29021"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0B5"
FT                   /protein_id="ABY29021.1"
FT                   /translation="MLRTAFSLTLLATAALAPSLTLAQGKQDFTLVNRTGYQIDEVYVG
FT                   PVNQSHWGQDVMGKDAIANGDKADISFNGGSNACKWDIKVVYNDGDESEFRGVNLCDVS
FT                   KVTLFWNRSAGETRFVVE"
FT   sig_peptide     667238..667309
FT                   /locus_tag="Mext_0607"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 24"
FT   gene            667898..668902
FT                   /locus_tag="Mext_0608"
FT   CDS_pept        667898..668902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0608"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: sme:SMc00479 putative transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29022"
FT                   /db_xref="GOA:A9W0B6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0B6"
FT                   /protein_id="ABY29022.1"
FT                   /translation="MSNQSFTFTSEADGFEGYHALYSVGTDVAATDGSFRARVEAHRFG
FT                   PINVFERTLSGVRHWRDGARVRRDDFDHFVIQYLRSGTYYGGSIDAERRLAPGDVILFD
FT                   MSRPQRSRVETASTVTVSLSRKLVEAAAPEASRYHGHILPEAVSGLLGDLMGSLARRAA
FT                   ATEPSTAESTARALTELLAGALGQVRPDDEASSALIADLRRRRAEAFIEARLNDPSLDV
FT                   SMVARGAGLSRSALYRLFEPTGGVAYHILTRRLERLSAALRNPVEARSITTLTFDHGFA
FT                   SESHCSRAFRGTFGLPPGRYRAEMRHPRAGTLGQPLPGESAANLMSAWSRALA"
FT   gene            668911..670254
FT                   /locus_tag="Mext_0609"
FT   CDS_pept        668911..670254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0609"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   swi:Swit_3077 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29023"
FT                   /db_xref="GOA:A9W0B7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0B7"
FT                   /protein_id="ABY29023.1"
FT                   /translation="MSSPSANPQPGTAVARAGLAGWPLVALLAMIQFAAFSDRFLLTLV
FT                   ATPLKKALALSDTQLGLLQGSAFALPYALTLPLLGMVADRGRQRGLLLAGLSLWSAATF
FT                   ASGVASGFGALLAARVALGVGQAGFGPAALSLMTRHLRRDRLGRGISALTAGATLGRSF
FT                   ALLAGGAVLAWLTTRGGLTLPGLEPLAPWQALLVLAALPNLVLVILVLRIRPPPRAAAP
FT                   AQASRGLPGVSLRSALAWIGRRRKAYLPHVAAATAAVLMTQTLTAWAPTFYVRSFGLTP
FT                   AESGLRLGLLVLIAAPLGHFAGGLVLDRLRGAGRGDAAPLLLALGLILAVPMTAFASLS
FT                   PDLSFSRLGFAGLVALLGFTGPPGLAGIQILTPQRLRGRVNALFLATVNLAGFGLGPLL
FT                   VGLLSDHLFGEAGLGLALLAVYAPVGAVGTLAALLARSAWRPARRRRA"
FT   gene            complement(670299..672455)
FT                   /locus_tag="Mext_0610"
FT   CDS_pept        complement(670299..672455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0610"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   1.1 domain protein; sigma-70 region 3 domain protein;
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; sigma-70 non-essential domain protein; sigma-70
FT                   region 1.2; KEGG: xau:Xaut_1238 RNA polymerase, sigma 70
FT                   subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29024"
FT                   /db_xref="GOA:A9W0B8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0B8"
FT                   /protein_id="ABY29024.1"
FT                   /translation="MVNGRSTHGKLERMQRESARALDKRAIPRHCDGSFAERGLSLRRR
FT                   HENNRLSMATKATERDDADAAQDQPTDGPLLDLTDAAVKRMVKLAKKRGYVTYEEINEV
FT                   LPDGQVDGDQIEDVLAQLDDMGIRVVEAEESEEAAPEAKANGEASEEEESTEGGEVAET
FT                   SGTRAVAVATPTTREPTDRTDDPVRMYLREMGSVELLSREGEIAIAKRIEAGREAMIAG
FT                   LCESPLTFQAIIIWRDELVDGKVLLRDIIDLEATYAGPDARGAPQEAEAEGEESEEAEG
FT                   AVPPEGGDDEDDMENNVSLAAMEAEIKPRVLETFDNIASNYRKLRKLQNEETELKTGGG
FT                   TVTSAQTKKQAELKDIVVTDVKSLSLNANRIEALVEQLYDINKRLISHEGRLMRAAEHH
FT                   GVARDEFLRHYQGYELDPNWMDRVATLGGKGWKNFVERGGRQVADLREQILTLASETGL
FT                   QIGEYRKIVAMVQKGEREARQAKKEMIEANLRLVISIAKKYTNRGLQFLDLIQEGNIGL
FT                   MKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKIVRTSRQML
FT                   HEIGREPTPEELAEKLAMPLEKVRKVLKIAKEPISLETPIGDEEDSHLGDFIEDKNVVL
FT                   PIDAAIQSNLRETTTRVLASLTPREERVLRMRFGIGMNTDHTLEEVGQQFSVTRERIRQ
FT                   IEAKALRKLKHPSRSRKLRSFLDN"
FT   gene            complement(672501..674426)
FT                   /locus_tag="Mext_0611"
FT   CDS_pept        complement(672501..674426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0611"
FT                   /product="DNA primase"
FT                   /note="KEGG: rpb:RPB_4132 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase catalytic core domain; SMART:
FT                   Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29025"
FT                   /db_xref="GOA:A9W0B9"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0B9"
FT                   /protein_id="ABY29025.1"
FT                   /translation="MRYPPHILEEIRARVPTSEVVGRRVRLKKAGREWRGLSPFNSEKT
FT                   PSFYVNDQKQFYHCFSSGKHGDIFKFVMETEGLSFPEAVERLAGEAGVTLPKMTVENEQ
FT                   AEERRKGALEVMELAAAYFEEQLRGQAGGEARAYLDRRALGETTRKTFRLGYSLPGRYA
FT                   LRDFLASKGVDRDLMLELGLLAAPEGVNVPYDKFRDRIMFPILDIRGRVVAFGGRAMQA
FT                   EAKAKYMNSPETPLFHKGRMLYNLHAARKSAHDRSRIIAVEGYVDVIAMTLAGYPETVA
FT                   PLGTALTEDQLALLWRHADEPILCFDGDGAGQRAAFRALDVALPMLEPGKSLRIAMLPQ
FT                   GQDPDDLMRSGGPSAIEAVLSAARPLVEMLWAREAEAATLETPERRAGLARTLREAVAG
FT                   IRDETVRRFYRDDIEGRLRGLSGGPASFSGGRPERAAGGRPAAPRGAPFQRRPRPGDPP
FT                   PSPRITTGFNPLLKTAAPVPAAGGRAAKREAMIVMSLLAHPELLGIEEEALAALELVNP
FT                   DARALRTLLLDRAAEAGTPEAELMEARLRRAGLEEAHARLLALVSSGDRWTLDPNADPQ
FT                   RLEQTLHQAVILHRQTGALHSELHQAERALAEDGSEANFAWLCDVQQQLAVIAAAEAEA
FT                   EVSHEE"
FT   gene            674561..675547
FT                   /locus_tag="Mext_0612"
FT   CDS_pept        674561..675547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0612"
FT                   /product="Gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: atc:AGR_L_1647 possible gluconolactonase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29026"
FT                   /db_xref="GOA:A9W0C0"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0C0"
FT                   /protein_id="ABY29026.1"
FT                   /translation="MTESRSPPRCGIARRPLLGLALLGALTPRARAADDLSAVLDPSAK
FT                   AETLYDEGEWCEGPVWAPSLGGLIFSDVRRNRMMLIREGSRAEVFREPSNNSNGNTVDT
FT                   QGRLVTCEHRTSRVVRRETDGAITVLADRYDGGRLNAPNDVVVTRDGAIWFSDPTYGID
FT                   QAEEGVPRPSEQKGRFVFRLAPDGTLAVATDRFVQPNGLAFSPNERALYICESGTREGA
FT                   MGEIRAFDVADGQLSNERVFATVPKGVPDGVKVDTDGRVYAGTGDGVRIWSPDGRPVGH
FT                   IPTEGPCANLAFGGPNGRRLFLCAGKRVLAIETKVRGAAIESGGSRP"
FT   sig_peptide     674561..674659
FT                   /locus_tag="Mext_0612"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.947 at
FT                   residue 33"
FT   gene            675544..676710
FT                   /locus_tag="Mext_0613"
FT   CDS_pept        675544..676710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0613"
FT                   /product="major royal jelly protein"
FT                   /note="KEGG: psb:Psyr_2718 major royal jelly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29027"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR017996"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0C1"
FT                   /protein_id="ABY29027.1"
FT                   /translation="MTVRLARRTLLAGTAALAAARTMATRPAQAEAATAPVGTLERVVA
FT                   VRAPTTPTGLTLSADGRMFLFMPRFDERTVFTAGEVFPDGRVVPYPSEAANRPDPARPA
FT                   ETLFHVPNGVFDAKNRLWLLDAGLMASSGEPVPGAAKLVCIDPATNGILRTIPLQSVVT
FT                   KTSSLNDLRVDVRPGREAAYITDQGQTGAGALIAVDLASGRAVRRLADHASTQSVPGIL
FT                   KIVDGRVLLKREADGTTSPIKGGANGIALSPDGARLYYTPLMSRRLYAVETAALLDAGK
FT                   DDAAVAETVTDLGEKGLTGGLAADSRDRIYLSLQEFNGIGRRDPDGRVEVIATDPRLIW
FT                   PDTFWITADGWLYLSSAQANRRPEHNGGVDRQEPPYAIFRMRIDAGPA"
FT   sig_peptide     675544..675636
FT                   /locus_tag="Mext_0613"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 31"
FT   gene            complement(676898..677356)
FT                   /locus_tag="Mext_0614"
FT   CDS_pept        complement(676898..677356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0614"
FT                   /product="GatB/YqeY"
FT                   /note="KEGG: rpa:RPA1278 GatB/YqeY"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29028"
FT                   /db_xref="GOA:A9W0C2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0C2"
FT                   /protein_id="ABY29028.1"
FT                   /translation="MLRERITAEMKAAMKAGEKQKLSTVRMIQAALKDRDIAARGEGKG
FT                   ETGEDEILALLQKMIKQRQEAAGVYEQGGRPELAESERAEAEIIQTFLPQQLDEAEMRT
FT                   AIADAIAETGAESPKDMGKVIGALKGKYTGRMDFGRASALVKDALAGK"
FT   gene            677546..678796
FT                   /locus_tag="Mext_0615"
FT   CDS_pept        677546..678796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0615"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase small chain; KEGG:
FT                   xau:Xaut_1243 carbamoyl-phosphate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29029"
FT                   /db_xref="GOA:A9W0C3"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0C3"
FT                   /protein_id="ABY29029.1"
FT                   /translation="MLQDEPATLRADPARTNLEPKAPEPWSEPLVTALLVLADGTVLEG
FT                   FGIGQTGAADGEVCFNTAMTGYQEILTDPSYAGQIVTFTFPHIGNVGTNDEDLESLEAA
FT                   PASGVRGAVIASAVTKPSNWRSSSHLDGWLKARGIVGITGIDTRALTALIRDRGMPNAV
FT                   IANDPEGKFDREALKARAAALAPMEGLDLVPPVTSRETTAWTETVWAVKGGYGSRAPGQ
FT                   GLKVVAIDYGVKRNILRLLAEAGCDVTVVPATTTAEDIMALKPDGVFLSNGPGDPAATG
FT                   EYAVPVIRKLLDERVPTFGICLGHQLMGLALGGRTVKMGQGHHGANHPVKDHTTGKVEI
FT                   VSMNHGFAVDPTSLPKTAVETHVSLFDGSNCGLSLTDRPAFSVQHHPEASPGPRDSHYL
FT                   FERFVKLMRENRPETAA"
FT   gene            678935..679309
FT                   /locus_tag="Mext_0616"
FT   CDS_pept        678935..679309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29030"
FT                   /db_xref="GOA:A9W0C4"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0C4"
FT                   /protein_id="ABY29030.1"
FT                   /translation="MTLDDARDDFSRLHRLFTFHLGVAVGLAWLTTLYAAVSAPWVRNI
FT                   RALIDPTDPMRIESTLSYLFVMPAVLTLAWASAYFGRETMRRFQTLPNQTLEFAAAAMV
FT                   AFGVFYLSIDRAVAVIGAGF"
FT   gene            complement(679350..682025)
FT                   /locus_tag="Mext_0617"
FT   CDS_pept        complement(679350..682025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29031"
FT                   /db_xref="GOA:A9W0C5"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0C5"
FT                   /protein_id="ABY29031.1"
FT                   /translation="MDQIDEQAAAAVSDGEGAAPLLPAASRYAGGAGPGGREGLHRIAP
FT                   NNRFARVGLSFSDLSPGTWACLRFGLAFDADEAAALAVDAVAVGFDFLTADGSSLDLDH
FT                   VPGLARSLLDPHVAWIPGPALLGAEPFRIAFRVPDQARGVSVTLRSWRNTGDVAVADPV
FT                   LRLGAPDPAPAPRRRPLSGEGLRFDYALAEDIALVLRGQIYAARADEHAARVRLVYRDA
FT                   AGAEIAPPYANAVSVPGLGAVINLSAQPQARRFTLTLRPPPGAAAVALDFGAWEDAQTA
FT                   SESELIGQPELALEDDFRLESLCDDDVLDAPAFLARLADRLGLPEGVPASWRAGSETGA
FT                   APILARARDLRNGPDRSARIEGESVVLALAGLPDWTLPQTPDWREDPFRSVAWRLAYQS
FT                   LAWLLPLAALPDGAARARTIAAAWSRANPWSQPADGLSLHPAALAPRGDVLASLLTGGD
FT                   EPTRDEPARAEIAAEAARQGFALAEIVGQNTLARALHGIQAAAALLAVARALPGFAFAP
FT                   YWDSLARDSLTHGFDSLLSEAGAFTDAAPVRRLDLLSHGQAIAEALGETEPGPTIRRRV
FT                   EAALLGLAGLIDRGGRLPPFGDAPAGLDHSAWIGRLSSRGHSQGHDFVAERDAAPVAEG
FT                   RTAGMLALRYDGMEQGWGHFALTHAAQSPHGHRDCTSFTFATGSRRWIVEGGGAEGVEV
FT                   GPARHYLLSPRAHNVAIPDGCEPVAGSGTLSARVTLDDAEALTLATTVHGPDYAHARLF
FT                   LVLDDLSGMAVIDRFVRVGPSLSFEGLLHLPPDTLVALSSPRRALAQQEGRRLEFFAIP
FT                   LKGQAAGLEVAIGRSDRPHAMQGFCATGSGGLRPAPVLRYAFTGRDTVCGGVVIAADAG
FT                   AEQRLVRLLADDAVRRWVEG"
FT   gene            682183..682572
FT                   /locus_tag="Mext_0618"
FT   CDS_pept        682183..682572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0618"
FT                   /product="flagellar basal body rod protein"
FT                   /note="PFAM: flagellar basal body rod protein; KEGG:
FT                   bms:BRA0151 flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29032"
FT                   /db_xref="GOA:A9W0C6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0C6"
FT                   /protein_id="ABY29032.1"
FT                   /translation="MTTGVYLFDLASQHARFLATRQATIAGNVANANTPGYKARDVMPF
FT                   AQVLARTGLDMASTATSHLGTQGTGIPVREAKPTETWEVLQSSSAVSLEQEMLKAGDVS
FT                   RQHNLDTAVVKSFHRMLMAAVKGGA"
FT   gene            682569..682985
FT                   /locus_tag="Mext_0619"
FT   CDS_pept        682569..682985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0619"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgC;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   KEGG: rpc:RPC_1095 flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29033"
FT                   /db_xref="GOA:A9W0C7"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0C7"
FT                   /protein_id="ABY29033.1"
FT                   /translation="MIDPLLSASRLASAGLEAQSLRMRVVSENLANAQSTGATPGADPY
FT                   ARKTVTFRAELDRAAGVASVRLREIGTDNAPFRTEHDPANAAADANGNVKLPNVNMLVE
FT                   MADMREANRSYEANLQVIKQARAMVASVIDLLKS"
FT   gene            682999..683352
FT                   /locus_tag="Mext_0620"
FT   CDS_pept        682999..683352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0620"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="PFAM: flagellar hook-basal body complex protein
FT                   FliE; KEGG: sme:SMc03029 flagellar hook-basal body complex
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29034"
FT                   /db_xref="GOA:A9W0C8"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0C8"
FT                   /protein_id="ABY29034.1"
FT                   /translation="MIEALNSLAAFDKVAGTSFAGAAPTQKAMFSPAALSGIAGTAPTA
FT                   PTDFGEVMAQVASSARDALRTGEATAISGIQGKATAQQVVEAVMSAEQSLQTVVAIRDK
FT                   VVAAYLELSRMPI"
FT   gene            683445..684233
FT                   /locus_tag="Mext_0621"
FT   CDS_pept        683445..684233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0621"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgG;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: rpc:RPC_1097
FT                   flagellar basal-body rod FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29035"
FT                   /db_xref="GOA:A9W0C9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0C9"
FT                   /protein_id="ABY29035.1"
FT                   /translation="MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLY
FT                   QAERQQGVPNQAGQEAVPEGAMLGLGVRAAAIRNLHRQGSLANTGNQLDLAVNGRGYFQ
FT                   ITSPAGEIQYTRAGSFNKNNAGQLVTMEGYAVDPAILIPQNTTQVTINESGQVFAKIDG
FT                   QVALQNVGQLTLANFANDSGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGS
FT                   NVDPVKEITSLITAQRAFEMNSKVIQAADEMAGTVSKGIR"
FT   gene            684299..684793
FT                   /locus_tag="Mext_0622"
FT   CDS_pept        684299..684793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0622"
FT                   /product="FlgA, flagellar basal-body P-ring formation
FT                   protein"
FT                   /note="KEGG: oan:Oant_4208 FlgA, flagellar basal-body
FT                   P-ring formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29036"
FT                   /db_xref="GOA:A9W0D0"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0D0"
FT                   /protein_id="ABY29036.1"
FT                   /translation="MPRKTFVRGLVLAALAAGSAQPIAPAQAVEGMANAELMLPVPTVT
FT                   IYPGDTIKESMLRMQAYPATYRARTAVIDASAAIAGRVARRMLLPGEPVPVNAVDDPRL
FT                   VSRGAPTQMIFEENGLVITAVGAPLQNGGLGETIRVRNTDTNRIILGTVMADGRIRIGA
FT                   Q"
FT   sig_peptide     684299..684385
FT                   /locus_tag="Mext_0622"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 29"
FT   gene            684790..685917
FT                   /locus_tag="Mext_0623"
FT   CDS_pept        684790..685917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0623"
FT                   /product="flagellar P-ring protein"
FT                   /note="PFAM: flagellar P-ring protein; KEGG: rpe:RPE_1160
FT                   flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29037"
FT                   /db_xref="GOA:A9W0D1"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0D1"
FT                   /protein_id="ABY29037.1"
FT                   /translation="MIRRLLLAVLLGLLTGLGFAVMTGPVFAAGTRIKDIATLKGVRDN
FT                   QLFGYGLVTGLQGTGDTLRNAQFTEQSLQSLLDRLGINVRDARLRTRNIAAVMVTADLP
FT                   PYTGTGSRIDVTVTSMGDATSLRGGTLLMTSLTGGDGLVYAAAQGPLAVSGFSVQGQAE
FT                   QLTQGVPTAGRIPNGAMIEREVPGTFRDLPELVFELKNPDFKTATQISDAINAWSLGAF
FT                   GRRIASARDQRAVVVMRGRQMAQTRLVAQIGDLTIQPDTPARVVVDQRTGTVVIGRNVT
FT                   ISTVAVTHGNLTVRVTEAPEVSQPEGFSNGQTVVVPRTEVSAREERGKLAILGGSDLQT
FT                   LVRGLNQVGLKPTDIIAILQAVKTAGALQAELVVQ"
FT   sig_peptide     684790..684876
FT                   /locus_tag="Mext_0623"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            685917..686501
FT                   /locus_tag="Mext_0624"
FT   CDS_pept        685917..686501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0624"
FT                   /product="conserved hypothetical proteinn"
FT                   /note="KEGG: rpe:RPE_1161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29038"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0D2"
FT                   /protein_id="ABY29038.1"
FT                   /translation="MNVTLRIALCWLALGGTALAAGGDHADPAKDAAMRALATRDAPKE
FT                   VSAQDFVAKEPAKSGYCANIADAAADARFAWQKEQLAVMERQVEERIKLLEEKRAEYEA
FT                   WLKRRNEFLAKADESVVAVYAKMRPDAAALQLANMPDEAAAALLTKLNARTASAILSEM
FT                   EAARAAGLARAMSESGRKDATAPAVKKNQRS"
FT   sig_peptide     685917..685979
FT                   /locus_tag="Mext_0624"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.605 at
FT                   residue 21"
FT   gene            686501..687208
FT                   /locus_tag="Mext_0625"
FT   CDS_pept        686501..687208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0625"
FT                   /product="flagellar L-ring protein"
FT                   /note="PFAM: flagellar L-ring protein; KEGG: bja:bll6869
FT                   flagellar L-ring protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29039"
FT                   /db_xref="GOA:A9W0D3"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0D3"
FT                   /protein_id="ABY29039.1"
FT                   /translation="MRPSSAAVAVLALSLGACQSDLDRLGRPPLLTPIGTGLNAPREPL
FT                   PTSFGALGPRHSYHSTWSPASAALYQDPRARDVGDVITVSIAINDKAQFDNASERGRSQ
FT                   KSSLGFDFGYGISGLKDTATADTGIRSGTETKGQGSIDRKESLSLSVAAVVTEVLPNGN
FT                   VLISGSQEVRVNNEVRVLEVAGIVRPRDISRKNTIDYDKIAEARISYGGRGRITDVQGP
FT                   SLGQRVFETVAPF"
FT   sig_peptide     686501..686560
FT                   /locus_tag="Mext_0625"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.609 at
FT                   residue 20"
FT   gene            687291..687773
FT                   /locus_tag="Mext_0626"
FT   CDS_pept        687291..687773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0626"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: rpe:RPE_1163 flagellar basal body-associated protein
FT                   FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29040"
FT                   /db_xref="GOA:A9W0D4"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0D4"
FT                   /protein_id="ABY29040.1"
FT                   /translation="MADAKDSKKGGKGWIGALALVTLIAVGTGGGLGVYLLGTVEKSVD
FT                   LKQREEAGKAVKVLNYTGDLSLRSVGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVT
FT                   LAEIRADALAYLRTLSLAQIEGANGLQHLREDLNERVATRTKGAVRELIVESLVVQ"
FT   gene            687770..688552
FT                   /locus_tag="Mext_0627"
FT   CDS_pept        687770..688552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0627"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: bja:bll6867 flagellar biosynthetic protein;
FT                   TIGRFAM: flagellar biosynthetic protein FliP; PFAM: type
FT                   III secretion system inner membrane P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29041"
FT                   /db_xref="GOA:A9W0D5"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0D5"
FT                   /protein_id="ABY29041.1"
FT                   /translation="MKRVRAILVTAGLALAAGLTASAALAQGAAPGGVTGVPGLDALLP
FT                   PGNGAASGRIIQLVALLTVLSLAPGLLVMVTSFTRFAVAFSFLRSGLGLQSTPANLFLV
FT                   SLALFMTFYVMAPTFDRAWNEGVKPLQENRISEEEAFGKIVDPFREFMTQHVRPKDLQT
FT                   FTDLASRTFPKAEAGEKIDLRILIPAFMISELRRGFEIGFLIVLPFLVIDIIVSTIVMS
FT                   MGMMMLPPTVISLPFKVLFFILIDGWNLLVSGLVRSFF"
FT   sig_peptide     687770..687850
FT                   /locus_tag="Mext_0627"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 27"
FT   gene            complement(688714..688944)
FT                   /locus_tag="Mext_0628"
FT   CDS_pept        complement(688714..688944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29042"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0D6"
FT                   /protein_id="ABY29042.1"
FT                   /translation="MIADGSDEARRVGARARPLGPFLCDAAFRIADSFYTGLESDIGPA
FT                   NDLLEAIAQRERGDFASDDEVSAVLSKHRAS"
FT   gene            689058..690737
FT                   /locus_tag="Mext_0629"
FT   CDS_pept        689058..690737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0629"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="TIGRFAM: flagellar M-ring protein FliF; PFAM:
FT                   secretory protein YscJ/FliF family protein; Flagellar
FT                   M-ring domain protein; KEGG: rpc:RPC_1105 flagellar M-ring
FT                   protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29043"
FT                   /db_xref="GOA:A9W0D7"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0D7"
FT                   /protein_id="ABY29043.1"
FT                   /translation="MFGREQAERLWSNIVDLGARRLIALGLVGLLVFLGVGVGAYYLSR
FT                   PAQEMLYTGLSREDVSRIGGVLKDNGIPFDVSSDGTAVLVSFGHTAQARMLLAEKGLPQ
FT                   SSKSGYELFNDLGSLGMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPDRGSF
FT                   RRDQQPASASVVVRTEPADDTSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAGDDA
FT                   GTAPTGKMATLEKSVSREMQDNIRRTLAPYLGVGNFEISVATQLNTDKTSTNETIFNPD
FT                   QRVERSVRSVRESENAQNRNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYEI
FT                   SQKTVQTVSDGYAIRRLSVAVLVNRSRLTALAGPDDKASLDKQIAEIEELVGSAAGFSK
FT                   ERGDTIKVAAVGFVNDGQPMEPVPPLSLTDVMMKQSGTLINAATILVVAGLLIWFGLRP
FT                   ALRAILATPETAQSEVAALAGPEGAPALAADGTMALAAPGAALPGSGEAAKLPAPGIAG
FT                   LLEELEDKMARSPQKRLEQLIDIDEEQVAAVLKRWLMREEAA"
FT   gene            690737..691465
FT                   /locus_tag="Mext_0630"
FT   CDS_pept        690737..691465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0630"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll6863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29044"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0D8"
FT                   /protein_id="ABY29044.1"
FT                   /translation="MDAVLARYLPDFSASPPPPAALSGEPDFSGAWFRAPAAAEPAAPA
FT                   PIEIQAELEPFLPRAAAATLRPAEDREALIAAAEARGREQGRAEAMEEWSAQAALERAA
FT                   QQALFEEGVAQARRDWTEAQGEILAQGFVAAMQALDATLSDRVARLIAPVLGQALQRQA
FT                   LDELGAALKRILAEPQRAAVQVRGPDDLIAALAARLGGSTGIAFEAAEGPEVTVRAGET
FT                   VIETELAAWSRLITAAIAEA"
FT   gene            691467..692873
FT                   /locus_tag="Mext_0631"
FT   CDS_pept        691467..692873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0631"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bja:bll6862
FT                   probable flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29045"
FT                   /db_xref="GOA:A9W0D9"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0D9"
FT                   /protein_id="ABY29045.1"
FT                   /translation="MSDRPHEIIIIKRHGDHEEGHHGGAWKIALADFMTAMMALFLVMW
FT                   LINSTSKEQKQTIAEYFNPVKLAEVTHDRKGVNDPQDTPNDPAPSGKGKGDGGNAEGKG
FT                   DAAGAPGSRARESALFQDPYAVLAKLAAEAEAAGPEAASADASALEAGQPGVAGGETGR
FT                   DPFDPLYWQVAALPRRRTDNPGALDSAATAPADSRLDARAQTAGSKPREPQKESAKDIA
FT                   RQSLSDAMRQAGIKLASAEPMPLTIPSAEPTKPSAEAAPLASPAEAKPAPPEPTLLAKA
FT                   EAPPAKDLAPAKDLAPAKELAAPADQAAKAAERAALSALKAEIARAVPSLPNGAPAPQV
FT                   EVRRTGEGVLISITDEINYSMFGIGSAEPTPKVVKALERIAKILNSRPGRVVVRGHTDG
FT                   RPFRSETYDNWRLSSARAQMASYMLVRGGLDEARIDRIEGYADRQPRIANNPKAAENRR
FT                   IEILLRGLPE"
FT   gene            692870..694252
FT                   /locus_tag="Mext_0632"
FT   CDS_pept        692870..694252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0632"
FT                   /product="putative chemotaxis protein precursor"
FT                   /note="KEGG: rpc:RPC_1108 putative chemotaxis protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29046"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0E0"
FT                   /protein_id="ABY29046.1"
FT                   /translation="MMLRTLPRRPLARFSRRAVIASRPAKPSRYVTAMEGASRTALTAL
FT                   ALALCLVIAPAKAAEHGDTHAPPAEAHAADDHGGHGAAAKPIEPLPVKAHGLPVELTRT
FT                   LQLLQDRIARGSTQAHLAQRQLLGHIEQRLIALDPESWAEAENVRAAVTFALAGGGPGA
FT                   LRVILRSGKVPEAEQPLALGALAYLEGREREARAKLAGIDPRTMPAGLAGQLALTQSAL
FT                   MVRDAPVKSLELLDLARLLAPGTLVEEGALRRQIFVVAQGGDARRFEALAIQYLRRFRR
FT                   SVYAGNFRQRFAGALTRLDFDSDRTRIASLERMLDEIEPEGRRDLYLLVARAGLEQGRR
FT                   ETALFSAERAMGLAAPDSQPAAQARLYRGAALIVADGRFEEGYEALRGLDRTDFVPTDA
FT                   ELLDAALSTARQIRTPSAVAEAAATPPPSSSRPIPESGSLLRAQEALARAERAMDAPAR
FT                   TP"
FT   sig_peptide     692870..693046
FT                   /locus_tag="Mext_0632"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.988 at
FT                   residue 59"
FT   gene            694709..696145
FT                   /locus_tag="Mext_0633"
FT   CDS_pept        694709..696145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0633"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lma:LmjF35.0290 hypothetical protein,
FT                   conserved"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29047"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0E1"
FT                   /protein_id="ABY29047.1"
FT                   /translation="MSMVGLETHFAPVRPHGAAAPAQTAMEPGLNELSAPPTLPTSGSI
FT                   GAAPIAPVSAGKAPLPGAPRTAPAPDATVPSALPAVGPDGPLAPGPVALQPPASRSDAR
FT                   EPAVPSDRQAPEAPANALTAPAATTPARPASPAPGSDHPAESTAVSPAPTPDEAVRQTA
FT                   GAPPAQAAGTEAPRSPASRGRAAPRSDHAGPVGAADNSALLDQPESTSLPEPTTITQPG
FT                   TPGQTRRDPESRQDRPTAIARPDMMPEHAAVAVPRPQAEGGARAERAGSDAVTIEAPRP
FT                   DMPLAPSGPQETAGQPTPAPASPLRQIVDAVATQLPAAPAAMAAPSARLAPASAEAGPL
FT                   KILTLQLHPADLGSVLVRMRLQDGRLEMSLRTSREETAERLRKEGDLLAGLLREAGYEP
FT                   EAVTIQSGGPGAGESGPRGQGFASFAGSQGGQHDRQPGAATPDQSGRRPSPRADAAATP
FT                   TEEQDHETDSRGRDRSSLYL"
FT   gene            696228..696767
FT                   /locus_tag="Mext_0634"
FT   CDS_pept        696228..696767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0634"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   sme:SMc03045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29048"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0E2"
FT                   /protein_id="ABY29048.1"
FT                   /translation="MGGDTRGGSKRPLMAGASRVCERQMAQAAAKHGVPLGMLYAVGLT
FT                   ESGNRGSLQPYAMNIGGKAYFGSGAADVMQRLAQAQQEGVRLVDLGCMQINHHYHRAKF
FT                   ASLEAMIDPAQNVEYATRFLKELKEREGSWTLAVARYHAGPNNNPAQKVYVCRVITNMV
FT                   ATGFGNWTPGAKSFCQ"
FT   gene            complement(696775..697476)
FT                   /locus_tag="Mext_0635"
FT   CDS_pept        complement(696775..697476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0635"
FT                   /product="transcriptional regulator domain protein"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: mlo:mlr2935 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29049"
FT                   /db_xref="GOA:A9W0E3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0E3"
FT                   /protein_id="ABY29049.1"
FT                   /translation="MYFLVDPRDTVNAGYKASFEREGISSFALMPDEFLSWLRAASPAD
FT                   LEAIQGFLLGDFAERAKCAGVIRKQSRAPIIALADLRSLEQTVELLEAGIDDVLPKPVH
FT                   VREILARSEAIWRRVNGAVQPSEAEGETEGEARGPDRLKVFHDGRDPEIDGVPLSLPRR
FT                   ERHILEYLVRNRGRRLTKTQVFNVVYGVYSNGVEESVIEGHVSKLRKKLAERLGYDPIE
FT                   AKRYMGYTYVG"
FT   gene            complement(697698..698144)
FT                   /locus_tag="Mext_0636"
FT   CDS_pept        complement(697698..698144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29050"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0E4"
FT                   /protein_id="ABY29050.1"
FT                   /translation="MTPQVQRFAPGPSAVPHSHAAAEQIFAEALRDFIAELCLLDGGVL
FT                   IGWIRGERHGNIADIVSSSAELFFKESVLTYADAADVCLDWGRSMQVVLDLEFAAEAVT
FT                   VFFKLVLDEVFAGVAIQRIVAEEKAALSLESFAHALRQARVGHA"
FT   gene            complement(698141..699202)
FT                   /locus_tag="Mext_0637"
FT   CDS_pept        complement(698141..699202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0637"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: bja:bll6877 flagellar
FT                   biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29051"
FT                   /db_xref="GOA:A9W0E5"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0E5"
FT                   /protein_id="ABY29051.1"
FT                   /translation="MADDDKESKTEAATERRVRDAIEKGDIPFSREAPVFASTLGLLIA
FT                   LALFARGQAAQLAGDFAPLLDDPRGFSLESGGDAMLLLSRVALAAGRFLLPILLILAVC
FT                   SLSASLLQNLPRFVLDRITPKWSRVSPMAGFTRIFGTSGQVEFLKSLVKFLSVSVVALL
FT                   LLRSERTRAVNAMFVDPSQLPELILTVAIRLVSAVAIATIVIVAGDLVWARLRWQRSLR
FT                   MSHQDIKDEHKQTEGDPSVKARLRSLAQDRARNRMLANVDRATVVIANPTHFAVALRYE
FT                   PSENPAPLVIAKGQDLIALRIRAIAEEKGIAVIEDKPLARSLYDAVQVDQTIPAEFYRA
FT                   VAQILFFLFARAR"
FT   gene            complement(699246..700325)
FT                   /locus_tag="Mext_0638"
FT   CDS_pept        complement(699246..700325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mext_0638"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="PFAM: flagellar motor switch protein FliG; KEGG:
FT                   rpe:RPE_1153 flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Mext_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABY29052"
FT                   /db_xref="GOA:A9W0E6"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A9W0E6"
FT                   /protein_id="ABY29052.1"
FT                   /translation="MSSSPLASSPVPSDAVSSGAVAPRAVATRRLEPVDQVAALLLAMG
FT                   KPAAGRLIKYFEPDELKRITRSASNLGAVSPEQLDTVVEHFSAEFSAGNSLIGTASEVE
FT                   KLLSGLLPADQIADILA