(data stored in ACNUC7421 zone)

EMBL: CP000909

ID   CP000909; SV 1; circular; genomic DNA; STD; PRO; 5258541 BP.
XX
AC   CP000909; AAAH02000000-AAAH02000077;
XX
PR   Project:PRJNA59;
XX
DT   21-DEC-2007 (Rel. 94, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Chloroflexus aurantiacus J-10-fl, complete genome.
XX
KW   .
XX
OS   Chloroflexus aurantiacus J-10-fl
OC   Bacteria; Chloroflexi; Chloroflexia; Chloroflexales; Chloroflexineae;
OC   Chloroflexaceae; Chloroflexus.
XX
RN   [1]
RP   1-5258541
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Hammon N.,
RA   Israni S., Dalin E., Tice H., Pitluck S., Chertkov O., Brettin T.,
RA   Bruce D., Detter J.C., Han C., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Pierson B.K., Blankenship R.E., Richardson P.;
RT   "Complete sequence of Chloroflexus aurantiacus J-10-fl";
RL   Unpublished.
XX
RN   [2]
RP   1-5258541
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Hammon N.,
RA   Israni S., Dalin E., Tice H., Pitluck S., Chertkov O., Brettin T.,
RA   Bruce D., Detter J.C., Han C., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Pierson B.K., Blankenship R.E., Richardson P.;
RT   ;
RL   Submitted (05-DEC-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 17ce937bc12fccabcb5574008ba62d09.
DR   BioSample; SAMN02598539.
DR   EnsemblGenomes-Gn; Caur_R0001.
DR   EnsemblGenomes-Gn; Caur_R0002.
DR   EnsemblGenomes-Gn; Caur_R0003.
DR   EnsemblGenomes-Gn; Caur_R0004.
DR   EnsemblGenomes-Gn; Caur_R0005.
DR   EnsemblGenomes-Gn; Caur_R0006.
DR   EnsemblGenomes-Gn; Caur_R0007.
DR   EnsemblGenomes-Gn; Caur_R0008.
DR   EnsemblGenomes-Gn; Caur_R0009.
DR   EnsemblGenomes-Gn; Caur_R0010.
DR   EnsemblGenomes-Gn; Caur_R0011.
DR   EnsemblGenomes-Gn; Caur_R0012.
DR   EnsemblGenomes-Gn; Caur_R0013.
DR   EnsemblGenomes-Gn; Caur_R0014.
DR   EnsemblGenomes-Gn; Caur_R0015.
DR   EnsemblGenomes-Gn; Caur_R0016.
DR   EnsemblGenomes-Gn; Caur_R0017.
DR   EnsemblGenomes-Gn; Caur_R0018.
DR   EnsemblGenomes-Gn; Caur_R0019.
DR   EnsemblGenomes-Gn; Caur_R0020.
DR   EnsemblGenomes-Gn; Caur_R0021.
DR   EnsemblGenomes-Gn; Caur_R0022.
DR   EnsemblGenomes-Gn; Caur_R0023.
DR   EnsemblGenomes-Gn; Caur_R0024.
DR   EnsemblGenomes-Gn; Caur_R0025.
DR   EnsemblGenomes-Gn; Caur_R0026.
DR   EnsemblGenomes-Gn; Caur_R0027.
DR   EnsemblGenomes-Gn; Caur_R0028.
DR   EnsemblGenomes-Gn; Caur_R0029.
DR   EnsemblGenomes-Gn; Caur_R0030.
DR   EnsemblGenomes-Gn; Caur_R0031.
DR   EnsemblGenomes-Gn; Caur_R0032.
DR   EnsemblGenomes-Gn; Caur_R0033.
DR   EnsemblGenomes-Gn; Caur_R0034.
DR   EnsemblGenomes-Gn; Caur_R0035.
DR   EnsemblGenomes-Gn; Caur_R0036.
DR   EnsemblGenomes-Gn; Caur_R0037.
DR   EnsemblGenomes-Gn; Caur_R0038.
DR   EnsemblGenomes-Gn; Caur_R0039.
DR   EnsemblGenomes-Gn; Caur_R0040.
DR   EnsemblGenomes-Gn; Caur_R0041.
DR   EnsemblGenomes-Gn; Caur_R0042.
DR   EnsemblGenomes-Gn; Caur_R0043.
DR   EnsemblGenomes-Gn; Caur_R0044.
DR   EnsemblGenomes-Gn; Caur_R0045.
DR   EnsemblGenomes-Gn; Caur_R0046.
DR   EnsemblGenomes-Gn; Caur_R0047.
DR   EnsemblGenomes-Gn; Caur_R0048.
DR   EnsemblGenomes-Gn; Caur_R0049.
DR   EnsemblGenomes-Gn; Caur_R0050.
DR   EnsemblGenomes-Gn; Caur_R0051.
DR   EnsemblGenomes-Gn; Caur_R0052.
DR   EnsemblGenomes-Gn; Caur_R0053.
DR   EnsemblGenomes-Gn; Caur_R0054.
DR   EnsemblGenomes-Gn; Caur_R0055.
DR   EnsemblGenomes-Gn; Caur_R0056.
DR   EnsemblGenomes-Gn; Caur_R0057.
DR   EnsemblGenomes-Gn; Caur_R0058.
DR   EnsemblGenomes-Gn; Caur_R0059.
DR   EnsemblGenomes-Gn; Caur_R0060.
DR   EnsemblGenomes-Gn; Caur_R0061.
DR   EnsemblGenomes-Gn; EBG00001176442.
DR   EnsemblGenomes-Gn; EBG00001176443.
DR   EnsemblGenomes-Gn; EBG00001176444.
DR   EnsemblGenomes-Gn; EBG00001176445.
DR   EnsemblGenomes-Gn; EBG00001176446.
DR   EnsemblGenomes-Gn; EBG00001176447.
DR   EnsemblGenomes-Gn; EBG00001176448.
DR   EnsemblGenomes-Gn; EBG00001176449.
DR   EnsemblGenomes-Gn; EBG00001176450.
DR   EnsemblGenomes-Gn; EBG00001176451.
DR   EnsemblGenomes-Gn; EBG00001176452.
DR   EnsemblGenomes-Gn; EBG00001176453.
DR   EnsemblGenomes-Gn; EBG00001176454.
DR   EnsemblGenomes-Gn; EBG00001176455.
DR   EnsemblGenomes-Gn; EBG00001176456.
DR   EnsemblGenomes-Gn; EBG00001176457.
DR   EnsemblGenomes-Gn; EBG00001176458.
DR   EnsemblGenomes-Gn; EBG00001176459.
DR   EnsemblGenomes-Gn; EBG00001176460.
DR   EnsemblGenomes-Gn; EBG00001176461.
DR   EnsemblGenomes-Gn; EBG00001176462.
DR   EnsemblGenomes-Gn; EBG00001176463.
DR   EnsemblGenomes-Gn; EBG00001176464.
DR   EnsemblGenomes-Gn; EBG00001176465.
DR   EnsemblGenomes-Gn; EBG00001176466.
DR   EnsemblGenomes-Gn; EBG00001176467.
DR   EnsemblGenomes-Gn; EBG00001176468.
DR   EnsemblGenomes-Gn; EBG00001176469.
DR   EnsemblGenomes-Gn; EBG00001176470.
DR   EnsemblGenomes-Gn; EBG00001176471.
DR   EnsemblGenomes-Gn; EBG00001176472.
DR   EnsemblGenomes-Gn; EBG00001176473.
DR   EnsemblGenomes-Gn; EBG00001176474.
DR   EnsemblGenomes-Gn; EBG00001176475.
DR   EnsemblGenomes-Gn; EBG00001176477.
DR   EnsemblGenomes-Gn; EBG00001176478.
DR   EnsemblGenomes-Gn; EBG00001176479.
DR   EnsemblGenomes-Gn; EBG00001176480.
DR   EnsemblGenomes-Gn; EBG00001176481.
DR   EnsemblGenomes-Gn; EBG00001176482.
DR   EnsemblGenomes-Gn; EBG00001176483.
DR   EnsemblGenomes-Gn; EBG00001176484.
DR   EnsemblGenomes-Gn; EBG00001176485.
DR   EnsemblGenomes-Gn; EBG00001176486.
DR   EnsemblGenomes-Gn; EBG00001176487.
DR   EnsemblGenomes-Gn; EBG00001176488.
DR   EnsemblGenomes-Gn; EBG00001176489.
DR   EnsemblGenomes-Gn; EBG00001176490.
DR   EnsemblGenomes-Gn; EBG00001176491.
DR   EnsemblGenomes-Gn; EBG00001176492.
DR   EnsemblGenomes-Gn; EBG00001176493.
DR   EnsemblGenomes-Gn; EBG00001176494.
DR   EnsemblGenomes-Gn; EBG00001176495.
DR   EnsemblGenomes-Gn; EBG00001176496.
DR   EnsemblGenomes-Gn; EBG00001176497.
DR   EnsemblGenomes-Gn; EBG00001176498.
DR   EnsemblGenomes-Gn; EBG00001176499.
DR   EnsemblGenomes-Gn; EBG00001176500.
DR   EnsemblGenomes-Gn; EBG00001176501.
DR   EnsemblGenomes-Gn; EBG00001176502.
DR   EnsemblGenomes-Gn; EBG00001176503.
DR   EnsemblGenomes-Gn; EBG00001176505.
DR   EnsemblGenomes-Gn; EBG00001176506.
DR   EnsemblGenomes-Gn; EBG00001176507.
DR   EnsemblGenomes-Gn; EBG00001176508.
DR   EnsemblGenomes-Gn; EBG00001176509.
DR   EnsemblGenomes-Gn; EBG00001176510.
DR   EnsemblGenomes-Gn; EBG00001176511.
DR   EnsemblGenomes-Gn; EBG00001176512.
DR   EnsemblGenomes-Gn; EBG00001176513.
DR   EnsemblGenomes-Gn; EBG00001176514.
DR   EnsemblGenomes-Gn; EBG00001176515.
DR   EnsemblGenomes-Gn; EBG00001176516.
DR   EnsemblGenomes-Gn; EBG00001176517.
DR   EnsemblGenomes-Gn; EBG00001176518.
DR   EnsemblGenomes-Gn; EBG00001176519.
DR   EnsemblGenomes-Gn; EBG00001176520.
DR   EnsemblGenomes-Gn; EBG00001176521.
DR   EnsemblGenomes-Gn; EBG00001176522.
DR   EnsemblGenomes-Gn; EBG00001176523.
DR   EnsemblGenomes-Gn; EBG00001176524.
DR   EnsemblGenomes-Gn; EBG00001176525.
DR   EnsemblGenomes-Gn; EBG00001176526.
DR   EnsemblGenomes-Gn; EBG00001176527.
DR   EnsemblGenomes-Gn; EBG00001176528.
DR   EnsemblGenomes-Gn; EBG00001176529.
DR   EnsemblGenomes-Gn; EBG00001176530.
DR   EnsemblGenomes-Gn; EBG00001176531.
DR   EnsemblGenomes-Gn; EBG00001176532.
DR   EnsemblGenomes-Gn; EBG00001176533.
DR   EnsemblGenomes-Gn; EBG00001176534.
DR   EnsemblGenomes-Gn; EBG00001176535.
DR   EnsemblGenomes-Gn; EBG00001176536.
DR   EnsemblGenomes-Gn; EBG00001176537.
DR   EnsemblGenomes-Gn; EBG00001176538.
DR   EnsemblGenomes-Gn; EBG00001176539.
DR   EnsemblGenomes-Gn; EBG00001176540.
DR   EnsemblGenomes-Gn; EBG00001176541.
DR   EnsemblGenomes-Gn; EBG00001176542.
DR   EnsemblGenomes-Gn; EBG00001176543.
DR   EnsemblGenomes-Gn; EBG00001176544.
DR   EnsemblGenomes-Gn; EBG00001176545.
DR   EnsemblGenomes-Gn; EBG00001176546.
DR   EnsemblGenomes-Gn; EBG00001176547.
DR   EnsemblGenomes-Gn; EBG00001176548.
DR   EnsemblGenomes-Gn; EBG00001176549.
DR   EnsemblGenomes-Gn; EBG00001176550.
DR   EnsemblGenomes-Gn; EBG00001176551.
DR   EnsemblGenomes-Gn; EBG00001176552.
DR   EnsemblGenomes-Gn; EBG00001176553.
DR   EnsemblGenomes-Gn; EBG00001176554.
DR   EnsemblGenomes-Gn; EBG00001176555.
DR   EnsemblGenomes-Gn; EBG00001176556.
DR   EnsemblGenomes-Gn; EBG00001176557.
DR   EnsemblGenomes-Gn; EBG00001176558.
DR   EnsemblGenomes-Gn; EBG00001176559.
DR   EnsemblGenomes-Gn; EBG00001176560.
DR   EnsemblGenomes-Gn; EBG00001176561.
DR   EnsemblGenomes-Gn; EBG00001176562.
DR   EnsemblGenomes-Gn; EBG00001176563.
DR   EnsemblGenomes-Gn; EBG00001176564.
DR   EnsemblGenomes-Gn; EBG00001176565.
DR   EnsemblGenomes-Gn; EBG00001176566.
DR   EnsemblGenomes-Gn; EBG00001176567.
DR   EnsemblGenomes-Gn; EBG00001176568.
DR   EnsemblGenomes-Gn; EBG00001176569.
DR   EnsemblGenomes-Gn; EBG00001176570.
DR   EnsemblGenomes-Gn; EBG00001176571.
DR   EnsemblGenomes-Gn; EBG00001176572.
DR   EnsemblGenomes-Gn; EBG00001176573.
DR   EnsemblGenomes-Gn; EBG00001176574.
DR   EnsemblGenomes-Gn; EBG00001176575.
DR   EnsemblGenomes-Gn; EBG00001176576.
DR   EnsemblGenomes-Gn; EBG00001176577.
DR   EnsemblGenomes-Gn; EBG00001176578.
DR   EnsemblGenomes-Gn; EBG00001176579.
DR   EnsemblGenomes-Gn; EBG00001176580.
DR   EnsemblGenomes-Gn; EBG00001176581.
DR   EnsemblGenomes-Gn; EBG00001176582.
DR   EnsemblGenomes-Gn; EBG00001176583.
DR   EnsemblGenomes-Gn; EBG00001176584.
DR   EnsemblGenomes-Gn; EBG00001176585.
DR   EnsemblGenomes-Gn; EBG00001176586.
DR   EnsemblGenomes-Gn; EBG00001176587.
DR   EnsemblGenomes-Gn; EBG00001176588.
DR   EnsemblGenomes-Gn; EBG00001176589.
DR   EnsemblGenomes-Gn; EBG00001176590.
DR   EnsemblGenomes-Gn; EBG00001176591.
DR   EnsemblGenomes-Gn; EBG00001176592.
DR   EnsemblGenomes-Gn; EBG00001176593.
DR   EnsemblGenomes-Gn; EBG00001176594.
DR   EnsemblGenomes-Gn; EBG00001176595.
DR   EnsemblGenomes-Gn; EBG00001176596.
DR   EnsemblGenomes-Gn; EBG00001176597.
DR   EnsemblGenomes-Gn; EBG00001176598.
DR   EnsemblGenomes-Gn; EBG00001176599.
DR   EnsemblGenomes-Gn; EBG00001176600.
DR   EnsemblGenomes-Gn; EBG00001176601.
DR   EnsemblGenomes-Gn; EBG00001176602.
DR   EnsemblGenomes-Gn; EBG00001176603.
DR   EnsemblGenomes-Gn; EBG00001176604.
DR   EnsemblGenomes-Gn; EBG00001176605.
DR   EnsemblGenomes-Gn; EBG00001176606.
DR   EnsemblGenomes-Gn; EBG00001176607.
DR   EnsemblGenomes-Gn; EBG00001176608.
DR   EnsemblGenomes-Gn; EBG00001176609.
DR   EnsemblGenomes-Gn; EBG00001176610.
DR   EnsemblGenomes-Gn; EBG00001176611.
DR   EnsemblGenomes-Gn; EBG00001176612.
DR   EnsemblGenomes-Gn; EBG00001176613.
DR   EnsemblGenomes-Gn; EBG00001176614.
DR   EnsemblGenomes-Gn; EBG00001176615.
DR   EnsemblGenomes-Gn; EBG00001176616.
DR   EnsemblGenomes-Gn; EBG00001176617.
DR   EnsemblGenomes-Gn; EBG00001176618.
DR   EnsemblGenomes-Gn; EBG00001176619.
DR   EnsemblGenomes-Gn; EBG00001176620.
DR   EnsemblGenomes-Gn; EBG00001176621.
DR   EnsemblGenomes-Gn; EBG00001176622.
DR   EnsemblGenomes-Gn; EBG00001176623.
DR   EnsemblGenomes-Gn; EBG00001176624.
DR   EnsemblGenomes-Gn; EBG00001176625.
DR   EnsemblGenomes-Gn; EBG00001176626.
DR   EnsemblGenomes-Gn; EBG00001176627.
DR   EnsemblGenomes-Gn; EBG00001176628.
DR   EnsemblGenomes-Gn; EBG00001176630.
DR   EnsemblGenomes-Gn; EBG00001176631.
DR   EnsemblGenomes-Gn; EBG00001176632.
DR   EnsemblGenomes-Gn; EBG00001176633.
DR   EnsemblGenomes-Gn; EBG00001176634.
DR   EnsemblGenomes-Gn; EBG00001176635.
DR   EnsemblGenomes-Gn; EBG00001176636.
DR   EnsemblGenomes-Gn; EBG00001176637.
DR   EnsemblGenomes-Gn; EBG00001176638.
DR   EnsemblGenomes-Gn; EBG00001176639.
DR   EnsemblGenomes-Gn; EBG00001176640.
DR   EnsemblGenomes-Gn; EBG00001176641.
DR   EnsemblGenomes-Gn; EBG00001176642.
DR   EnsemblGenomes-Gn; EBG00001176643.
DR   EnsemblGenomes-Gn; EBG00001176644.
DR   EnsemblGenomes-Gn; EBG00001176645.
DR   EnsemblGenomes-Gn; EBG00001176646.
DR   EnsemblGenomes-Gn; EBG00001176647.
DR   EnsemblGenomes-Gn; EBG00001176648.
DR   EnsemblGenomes-Gn; EBG00001176649.
DR   EnsemblGenomes-Gn; EBG00001176650.
DR   EnsemblGenomes-Gn; EBG00001176651.
DR   EnsemblGenomes-Gn; EBG00001176652.
DR   EnsemblGenomes-Gn; EBG00001176653.
DR   EnsemblGenomes-Gn; EBG00001176654.
DR   EnsemblGenomes-Gn; EBG00001176655.
DR   EnsemblGenomes-Gn; EBG00001176656.
DR   EnsemblGenomes-Gn; EBG00001176657.
DR   EnsemblGenomes-Gn; EBG00001176658.
DR   EnsemblGenomes-Gn; EBG00001176659.
DR   EnsemblGenomes-Gn; EBG00001176660.
DR   EnsemblGenomes-Gn; EBG00001176661.
DR   EnsemblGenomes-Gn; EBG00001176662.
DR   EnsemblGenomes-Gn; EBG00001176663.
DR   EnsemblGenomes-Gn; EBG00001176664.
DR   EnsemblGenomes-Gn; EBG00001176665.
DR   EnsemblGenomes-Gn; EBG00001176666.
DR   EnsemblGenomes-Gn; EBG00001176667.
DR   EnsemblGenomes-Gn; EBG00001176668.
DR   EnsemblGenomes-Gn; EBG00001176669.
DR   EnsemblGenomes-Gn; EBG00001176670.
DR   EnsemblGenomes-Gn; EBG00001176671.
DR   EnsemblGenomes-Gn; EBG00001176672.
DR   EnsemblGenomes-Gn; EBG00001176673.
DR   EnsemblGenomes-Gn; EBG00001176674.
DR   EnsemblGenomes-Gn; EBG00001176675.
DR   EnsemblGenomes-Gn; EBG00001176676.
DR   EnsemblGenomes-Gn; EBG00001176677.
DR   EnsemblGenomes-Gn; EBG00001176678.
DR   EnsemblGenomes-Gn; EBG00001176679.
DR   EnsemblGenomes-Gn; EBG00001176680.
DR   EnsemblGenomes-Gn; EBG00001176681.
DR   EnsemblGenomes-Gn; EBG00001176682.
DR   EnsemblGenomes-Gn; EBG00001176683.
DR   EnsemblGenomes-Gn; EBG00001176684.
DR   EnsemblGenomes-Gn; EBG00001176685.
DR   EnsemblGenomes-Gn; EBG00001176686.
DR   EnsemblGenomes-Gn; EBG00001176687.
DR   EnsemblGenomes-Gn; EBG00001176688.
DR   EnsemblGenomes-Gn; EBG00001176689.
DR   EnsemblGenomes-Gn; EBG00001176690.
DR   EnsemblGenomes-Gn; EBG00001176691.
DR   EnsemblGenomes-Gn; EBG00001176692.
DR   EnsemblGenomes-Gn; EBG00001176693.
DR   EnsemblGenomes-Gn; EBG00001176694.
DR   EnsemblGenomes-Gn; EBG00001176695.
DR   EnsemblGenomes-Gn; EBG00001176696.
DR   EnsemblGenomes-Gn; EBG00001176697.
DR   EnsemblGenomes-Gn; EBG00001176698.
DR   EnsemblGenomes-Gn; EBG00001176699.
DR   EnsemblGenomes-Gn; EBG00001176700.
DR   EnsemblGenomes-Gn; EBG00001176701.
DR   EnsemblGenomes-Gn; EBG00001176702.
DR   EnsemblGenomes-Gn; EBG00001176703.
DR   EnsemblGenomes-Gn; EBG00001176704.
DR   EnsemblGenomes-Gn; EBG00001176705.
DR   EnsemblGenomes-Gn; EBG00001176706.
DR   EnsemblGenomes-Gn; EBG00001176707.
DR   EnsemblGenomes-Gn; EBG00001176708.
DR   EnsemblGenomes-Gn; EBG00001176709.
DR   EnsemblGenomes-Gn; EBG00001176710.
DR   EnsemblGenomes-Gn; EBG00001176711.
DR   EnsemblGenomes-Gn; EBG00001176712.
DR   EnsemblGenomes-Gn; EBG00001176713.
DR   EnsemblGenomes-Gn; EBG00001176714.
DR   EnsemblGenomes-Gn; EBG00001176715.
DR   EnsemblGenomes-Gn; EBG00001176716.
DR   EnsemblGenomes-Gn; EBG00001176717.
DR   EnsemblGenomes-Gn; EBG00001176718.
DR   EnsemblGenomes-Gn; EBG00001176719.
DR   EnsemblGenomes-Gn; EBG00001176720.
DR   EnsemblGenomes-Gn; EBG00001176721.
DR   EnsemblGenomes-Gn; EBG00001176722.
DR   EnsemblGenomes-Gn; EBG00001176723.
DR   EnsemblGenomes-Gn; EBG00001176724.
DR   EnsemblGenomes-Gn; EBG00001176725.
DR   EnsemblGenomes-Gn; EBG00001176726.
DR   EnsemblGenomes-Gn; EBG00001176727.
DR   EnsemblGenomes-Gn; EBG00001176728.
DR   EnsemblGenomes-Gn; EBG00001176729.
DR   EnsemblGenomes-Gn; EBG00001176730.
DR   EnsemblGenomes-Gn; EBG00001176731.
DR   EnsemblGenomes-Gn; EBG00001176732.
DR   EnsemblGenomes-Gn; EBG00001176733.
DR   EnsemblGenomes-Gn; EBG00001176734.
DR   EnsemblGenomes-Gn; EBG00001176735.
DR   EnsemblGenomes-Gn; EBG00001176736.
DR   EnsemblGenomes-Gn; EBG00001176737.
DR   EnsemblGenomes-Gn; EBG00001176738.
DR   EnsemblGenomes-Gn; EBG00001176739.
DR   EnsemblGenomes-Gn; EBG00001176740.
DR   EnsemblGenomes-Gn; EBG00001176741.
DR   EnsemblGenomes-Gn; EBG00001176742.
DR   EnsemblGenomes-Gn; EBG00001176743.
DR   EnsemblGenomes-Gn; EBG00001176744.
DR   EnsemblGenomes-Gn; EBG00001176745.
DR   EnsemblGenomes-Gn; EBG00001176746.
DR   EnsemblGenomes-Gn; EBG00001176747.
DR   EnsemblGenomes-Gn; EBG00001176748.
DR   EnsemblGenomes-Gn; EBG00001176749.
DR   EnsemblGenomes-Gn; EBG00001176750.
DR   EnsemblGenomes-Gn; EBG00001176751.
DR   EnsemblGenomes-Gn; EBG00001176752.
DR   EnsemblGenomes-Gn; EBG00001176753.
DR   EnsemblGenomes-Gn; EBG00001176754.
DR   EnsemblGenomes-Gn; EBG00001176755.
DR   EnsemblGenomes-Gn; EBG00001176756.
DR   EnsemblGenomes-Gn; EBG00001176757.
DR   EnsemblGenomes-Gn; EBG00001176758.
DR   EnsemblGenomes-Gn; EBG00001176759.
DR   EnsemblGenomes-Gn; EBG00001176760.
DR   EnsemblGenomes-Gn; EBG00001176761.
DR   EnsemblGenomes-Gn; EBG00001176762.
DR   EnsemblGenomes-Gn; EBG00001176763.
DR   EnsemblGenomes-Gn; EBG00001176764.
DR   EnsemblGenomes-Gn; EBG00001176765.
DR   EnsemblGenomes-Gn; EBG00001176766.
DR   EnsemblGenomes-Gn; EBG00001176767.
DR   EnsemblGenomes-Gn; EBG00001176768.
DR   EnsemblGenomes-Gn; EBG00001176769.
DR   EnsemblGenomes-Gn; EBG00001176770.
DR   EnsemblGenomes-Gn; EBG00001176771.
DR   EnsemblGenomes-Gn; EBG00001176772.
DR   EnsemblGenomes-Gn; EBG00001176773.
DR   EnsemblGenomes-Gn; EBG00001176774.
DR   EnsemblGenomes-Gn; EBG00001176775.
DR   EnsemblGenomes-Gn; EBG00001176776.
DR   EnsemblGenomes-Gn; EBG00001176777.
DR   EnsemblGenomes-Gn; EBG00001176778.
DR   EnsemblGenomes-Gn; EBG00001176779.
DR   EnsemblGenomes-Gn; EBG00001176780.
DR   EnsemblGenomes-Gn; EBG00001176781.
DR   EnsemblGenomes-Gn; EBG00001176782.
DR   EnsemblGenomes-Gn; EBG00001176783.
DR   EnsemblGenomes-Gn; EBG00001176784.
DR   EnsemblGenomes-Gn; EBG00001176785.
DR   EnsemblGenomes-Gn; EBG00001176786.
DR   EnsemblGenomes-Gn; EBG00001176787.
DR   EnsemblGenomes-Gn; EBG00001176788.
DR   EnsemblGenomes-Gn; EBG00001176789.
DR   EnsemblGenomes-Gn; EBG00001176790.
DR   EnsemblGenomes-Gn; EBG00001176791.
DR   EnsemblGenomes-Gn; EBG00001176792.
DR   EnsemblGenomes-Gn; EBG00001176793.
DR   EnsemblGenomes-Gn; EBG00001176794.
DR   EnsemblGenomes-Gn; EBG00001176795.
DR   EnsemblGenomes-Gn; EBG00001176796.
DR   EnsemblGenomes-Gn; EBG00001176797.
DR   EnsemblGenomes-Gn; EBG00001176798.
DR   EnsemblGenomes-Gn; EBG00001176799.
DR   EnsemblGenomes-Gn; EBG00001176800.
DR   EnsemblGenomes-Gn; EBG00001176801.
DR   EnsemblGenomes-Gn; EBG00001176802.
DR   EnsemblGenomes-Gn; EBG00001176803.
DR   EnsemblGenomes-Gn; EBG00001176804.
DR   EnsemblGenomes-Gn; EBG00001176805.
DR   EnsemblGenomes-Gn; EBG00001176806.
DR   EnsemblGenomes-Gn; EBG00001176807.
DR   EnsemblGenomes-Gn; EBG00001176808.
DR   EnsemblGenomes-Gn; EBG00001176809.
DR   EnsemblGenomes-Gn; EBG00001176810.
DR   EnsemblGenomes-Gn; EBG00001176811.
DR   EnsemblGenomes-Gn; EBG00001176812.
DR   EnsemblGenomes-Gn; EBG00001176813.
DR   EnsemblGenomes-Gn; EBG00001176814.
DR   EnsemblGenomes-Gn; EBG00001176815.
DR   EnsemblGenomes-Gn; EBG00001176816.
DR   EnsemblGenomes-Gn; EBG00001176817.
DR   EnsemblGenomes-Gn; EBG00001176818.
DR   EnsemblGenomes-Gn; EBG00001176819.
DR   EnsemblGenomes-Gn; EBG00001176820.
DR   EnsemblGenomes-Gn; EBG00001176821.
DR   EnsemblGenomes-Gn; EBG00001176822.
DR   EnsemblGenomes-Gn; EBG00001176823.
DR   EnsemblGenomes-Gn; EBG00001176824.
DR   EnsemblGenomes-Gn; EBG00001176825.
DR   EnsemblGenomes-Gn; EBG00001176826.
DR   EnsemblGenomes-Gn; EBG00001176827.
DR   EnsemblGenomes-Gn; EBG00001176828.
DR   EnsemblGenomes-Gn; EBG00001176829.
DR   EnsemblGenomes-Gn; EBG00001176830.
DR   EnsemblGenomes-Gn; EBG00001176831.
DR   EnsemblGenomes-Gn; EBG00001176832.
DR   EnsemblGenomes-Gn; EBG00001176833.
DR   EnsemblGenomes-Gn; EBG00001176834.
DR   EnsemblGenomes-Gn; EBG00001176835.
DR   EnsemblGenomes-Gn; EBG00001176836.
DR   EnsemblGenomes-Gn; EBG00001176837.
DR   EnsemblGenomes-Gn; EBG00001176838.
DR   EnsemblGenomes-Gn; EBG00001176839.
DR   EnsemblGenomes-Gn; EBG00001176840.
DR   EnsemblGenomes-Gn; EBG00001176841.
DR   EnsemblGenomes-Gn; EBG00001176842.
DR   EnsemblGenomes-Gn; EBG00001176843.
DR   EnsemblGenomes-Gn; EBG00001176844.
DR   EnsemblGenomes-Gn; EBG00001176845.
DR   EnsemblGenomes-Gn; EBG00001176846.
DR   EnsemblGenomes-Gn; EBG00001176847.
DR   EnsemblGenomes-Gn; EBG00001176848.
DR   EnsemblGenomes-Gn; EBG00001176849.
DR   EnsemblGenomes-Gn; EBG00001176850.
DR   EnsemblGenomes-Gn; EBG00001176851.
DR   EnsemblGenomes-Gn; EBG00001176852.
DR   EnsemblGenomes-Gn; EBG00001176853.
DR   EnsemblGenomes-Gn; EBG00001176854.
DR   EnsemblGenomes-Gn; EBG00001176855.
DR   EnsemblGenomes-Gn; EBG00001176856.
DR   EnsemblGenomes-Gn; EBG00001176857.
DR   EnsemblGenomes-Gn; EBG00001176858.
DR   EnsemblGenomes-Gn; EBG00001176859.
DR   EnsemblGenomes-Gn; EBG00001176860.
DR   EnsemblGenomes-Gn; EBG00001176861.
DR   EnsemblGenomes-Gn; EBG00001176862.
DR   EnsemblGenomes-Gn; EBG00001176863.
DR   EnsemblGenomes-Gn; EBG00001176864.
DR   EnsemblGenomes-Gn; EBG00001176865.
DR   EnsemblGenomes-Gn; EBG00001176866.
DR   EnsemblGenomes-Gn; EBG00001176867.
DR   EnsemblGenomes-Gn; EBG00001176868.
DR   EnsemblGenomes-Gn; EBG00001176869.
DR   EnsemblGenomes-Gn; EBG00001176870.
DR   EnsemblGenomes-Gn; EBG00001176871.
DR   EnsemblGenomes-Gn; EBG00001176872.
DR   EnsemblGenomes-Gn; EBG00001176873.
DR   EnsemblGenomes-Gn; EBG00001176874.
DR   EnsemblGenomes-Gn; EBG00001176875.
DR   EnsemblGenomes-Gn; EBG00001176876.
DR   EnsemblGenomes-Gn; EBG00001176877.
DR   EnsemblGenomes-Gn; EBG00001176878.
DR   EnsemblGenomes-Gn; EBG00001176879.
DR   EnsemblGenomes-Gn; EBG00001176880.
DR   EnsemblGenomes-Gn; EBG00001176881.
DR   EnsemblGenomes-Gn; EBG00001176882.
DR   EnsemblGenomes-Gn; EBG00001176883.
DR   EnsemblGenomes-Gn; EBG00001176884.
DR   EnsemblGenomes-Gn; EBG00001176885.
DR   EnsemblGenomes-Gn; EBG00001176886.
DR   EnsemblGenomes-Gn; EBG00001176887.
DR   EnsemblGenomes-Gn; EBG00001176888.
DR   EnsemblGenomes-Gn; EBG00001176889.
DR   EnsemblGenomes-Gn; EBG00001176890.
DR   EnsemblGenomes-Gn; EBG00001176891.
DR   EnsemblGenomes-Gn; EBG00001176892.
DR   EnsemblGenomes-Gn; EBG00001176893.
DR   EnsemblGenomes-Gn; EBG00001176894.
DR   EnsemblGenomes-Gn; EBG00001176895.
DR   EnsemblGenomes-Gn; EBG00001176896.
DR   EnsemblGenomes-Gn; EBG00001176897.
DR   EnsemblGenomes-Gn; EBG00001176898.
DR   EnsemblGenomes-Gn; EBG00001176899.
DR   EnsemblGenomes-Gn; EBG00001176900.
DR   EnsemblGenomes-Gn; EBG00001176901.
DR   EnsemblGenomes-Gn; EBG00001176902.
DR   EnsemblGenomes-Gn; EBG00001176903.
DR   EnsemblGenomes-Gn; EBG00001176904.
DR   EnsemblGenomes-Gn; EBG00001176905.
DR   EnsemblGenomes-Gn; EBG00001176906.
DR   EnsemblGenomes-Gn; EBG00001176907.
DR   EnsemblGenomes-Gn; EBG00001176908.
DR   EnsemblGenomes-Gn; EBG00001176909.
DR   EnsemblGenomes-Gn; EBG00001176910.
DR   EnsemblGenomes-Gn; EBG00001176911.
DR   EnsemblGenomes-Gn; EBG00001176912.
DR   EnsemblGenomes-Gn; EBG00001176913.
DR   EnsemblGenomes-Gn; EBG00001176914.
DR   EnsemblGenomes-Gn; EBG00001176915.
DR   EnsemblGenomes-Gn; EBG00001176916.
DR   EnsemblGenomes-Gn; EBG00001176917.
DR   EnsemblGenomes-Gn; EBG00001176918.
DR   EnsemblGenomes-Gn; EBG00001176919.
DR   EnsemblGenomes-Gn; EBG00001176920.
DR   EnsemblGenomes-Gn; EBG00001176921.
DR   EnsemblGenomes-Gn; EBG00001176922.
DR   EnsemblGenomes-Gn; EBG00001176923.
DR   EnsemblGenomes-Gn; EBG00001176924.
DR   EnsemblGenomes-Gn; EBG00001176925.
DR   EnsemblGenomes-Gn; EBG00001176926.
DR   EnsemblGenomes-Gn; EBG00001176927.
DR   EnsemblGenomes-Gn; EBG00001176928.
DR   EnsemblGenomes-Gn; EBG00001176929.
DR   EnsemblGenomes-Gn; EBG00001176930.
DR   EnsemblGenomes-Gn; EBG00001176931.
DR   EnsemblGenomes-Gn; EBG00001176932.
DR   EnsemblGenomes-Gn; EBG00001176933.
DR   EnsemblGenomes-Gn; EBG00001176934.
DR   EnsemblGenomes-Gn; EBG00001176935.
DR   EnsemblGenomes-Gn; EBG00001176936.
DR   EnsemblGenomes-Gn; EBG00001176937.
DR   EnsemblGenomes-Gn; EBG00001176938.
DR   EnsemblGenomes-Gn; EBG00001176939.
DR   EnsemblGenomes-Gn; EBG00001176940.
DR   EnsemblGenomes-Gn; EBG00001176941.
DR   EnsemblGenomes-Gn; EBG00001176942.
DR   EnsemblGenomes-Gn; EBG00001176943.
DR   EnsemblGenomes-Gn; EBG00001176944.
DR   EnsemblGenomes-Gn; EBG00001176945.
DR   EnsemblGenomes-Gn; EBG00001176946.
DR   EnsemblGenomes-Gn; EBG00001176947.
DR   EnsemblGenomes-Gn; EBG00001176948.
DR   EnsemblGenomes-Gn; EBG00001176949.
DR   EnsemblGenomes-Gn; EBG00001176950.
DR   EnsemblGenomes-Gn; EBG00001176951.
DR   EnsemblGenomes-Gn; EBG00001176952.
DR   EnsemblGenomes-Gn; EBG00001176953.
DR   EnsemblGenomes-Gn; EBG00001176954.
DR   EnsemblGenomes-Gn; EBG00001176955.
DR   EnsemblGenomes-Gn; EBG00001176956.
DR   EnsemblGenomes-Gn; EBG00001176957.
DR   EnsemblGenomes-Gn; EBG00001176958.
DR   EnsemblGenomes-Gn; EBG00001176959.
DR   EnsemblGenomes-Gn; EBG00001176960.
DR   EnsemblGenomes-Gn; EBG00001176961.
DR   EnsemblGenomes-Gn; EBG00001176962.
DR   EnsemblGenomes-Gn; EBG00001176963.
DR   EnsemblGenomes-Gn; EBG00001176964.
DR   EnsemblGenomes-Gn; EBG00001176965.
DR   EnsemblGenomes-Gn; EBG00001176966.
DR   EnsemblGenomes-Gn; EBG00001176967.
DR   EnsemblGenomes-Gn; EBG00001176968.
DR   EnsemblGenomes-Gn; EBG00001176969.
DR   EnsemblGenomes-Gn; EBG00001176970.
DR   EnsemblGenomes-Gn; EBG00001176971.
DR   EnsemblGenomes-Gn; EBG00001176972.
DR   EnsemblGenomes-Gn; EBG00001176973.
DR   EnsemblGenomes-Gn; EBG00001176974.
DR   EnsemblGenomes-Gn; EBG00001176975.
DR   EnsemblGenomes-Gn; EBG00001176976.
DR   EnsemblGenomes-Gn; EBG00001176977.
DR   EnsemblGenomes-Gn; EBG00001176978.
DR   EnsemblGenomes-Gn; EBG00001176979.
DR   EnsemblGenomes-Gn; EBG00001176980.
DR   EnsemblGenomes-Gn; EBG00001176981.
DR   EnsemblGenomes-Gn; EBG00001176982.
DR   EnsemblGenomes-Gn; EBG00001176983.
DR   EnsemblGenomes-Gn; EBG00001176984.
DR   EnsemblGenomes-Gn; EBG00001176985.
DR   EnsemblGenomes-Gn; EBG00001176986.
DR   EnsemblGenomes-Gn; EBG00001176987.
DR   EnsemblGenomes-Gn; EBG00001176988.
DR   EnsemblGenomes-Gn; EBG00001176989.
DR   EnsemblGenomes-Gn; EBG00001176990.
DR   EnsemblGenomes-Gn; EBG00001176991.
DR   EnsemblGenomes-Gn; EBG00001176992.
DR   EnsemblGenomes-Gn; EBG00001176993.
DR   EnsemblGenomes-Gn; EBG00001176994.
DR   EnsemblGenomes-Gn; EBG00001176995.
DR   EnsemblGenomes-Gn; EBG00001176996.
DR   EnsemblGenomes-Gn; EBG00001176997.
DR   EnsemblGenomes-Gn; EBG00001176998.
DR   EnsemblGenomes-Gn; EBG00001176999.
DR   EnsemblGenomes-Gn; EBG00001177000.
DR   EnsemblGenomes-Gn; EBG00001177001.
DR   EnsemblGenomes-Gn; EBG00001177002.
DR   EnsemblGenomes-Gn; EBG00001177003.
DR   EnsemblGenomes-Gn; EBG00001177004.
DR   EnsemblGenomes-Gn; EBG00001177005.
DR   EnsemblGenomes-Gn; EBG00001177006.
DR   EnsemblGenomes-Gn; EBG00001177007.
DR   EnsemblGenomes-Gn; EBG00001177008.
DR   EnsemblGenomes-Gn; EBG00001177009.
DR   EnsemblGenomes-Gn; EBG00001177010.
DR   EnsemblGenomes-Gn; EBG00001177011.
DR   EnsemblGenomes-Gn; EBG00001177012.
DR   EnsemblGenomes-Gn; EBG00001177013.
DR   EnsemblGenomes-Gn; EBG00001177014.
DR   EnsemblGenomes-Gn; EBG00001177015.
DR   EnsemblGenomes-Gn; EBG00001177016.
DR   EnsemblGenomes-Gn; EBG00001177017.
DR   EnsemblGenomes-Gn; EBG00001177018.
DR   EnsemblGenomes-Gn; EBG00001177019.
DR   EnsemblGenomes-Gn; EBG00001177020.
DR   EnsemblGenomes-Gn; EBG00001177021.
DR   EnsemblGenomes-Gn; EBG00001177022.
DR   EnsemblGenomes-Gn; EBG00001177023.
DR   EnsemblGenomes-Gn; EBG00001177024.
DR   EnsemblGenomes-Gn; EBG00001177025.
DR   EnsemblGenomes-Gn; EBG00001177026.
DR   EnsemblGenomes-Gn; EBG00001177027.
DR   EnsemblGenomes-Gn; EBG00001177028.
DR   EnsemblGenomes-Gn; EBG00001177029.
DR   EnsemblGenomes-Gn; EBG00001177030.
DR   EnsemblGenomes-Gn; EBG00001177031.
DR   EnsemblGenomes-Gn; EBG00001177032.
DR   EnsemblGenomes-Gn; EBG00001177033.
DR   EnsemblGenomes-Gn; EBG00001177034.
DR   EnsemblGenomes-Gn; EBG00001177035.
DR   EnsemblGenomes-Gn; EBG00001177036.
DR   EnsemblGenomes-Gn; EBG00001177037.
DR   EnsemblGenomes-Gn; EBG00001177038.
DR   EnsemblGenomes-Gn; EBG00001177039.
DR   EnsemblGenomes-Gn; EBG00001177040.
DR   EnsemblGenomes-Gn; EBG00001177041.
DR   EnsemblGenomes-Gn; EBG00001177042.
DR   EnsemblGenomes-Gn; EBG00001177043.
DR   EnsemblGenomes-Gn; EBG00001177044.
DR   EnsemblGenomes-Gn; EBG00001177045.
DR   EnsemblGenomes-Gn; EBG00001177046.
DR   EnsemblGenomes-Gn; EBG00001177047.
DR   EnsemblGenomes-Gn; EBG00001177048.
DR   EnsemblGenomes-Gn; EBG00001177049.
DR   EnsemblGenomes-Gn; EBG00001177050.
DR   EnsemblGenomes-Gn; EBG00001177051.
DR   EnsemblGenomes-Tr; Caur_R0001-1.
DR   EnsemblGenomes-Tr; Caur_R0002-1.
DR   EnsemblGenomes-Tr; Caur_R0003-1.
DR   EnsemblGenomes-Tr; Caur_R0004-1.
DR   EnsemblGenomes-Tr; Caur_R0005-1.
DR   EnsemblGenomes-Tr; Caur_R0006-1.
DR   EnsemblGenomes-Tr; Caur_R0007-1.
DR   EnsemblGenomes-Tr; Caur_R0008-1.
DR   EnsemblGenomes-Tr; Caur_R0009-1.
DR   EnsemblGenomes-Tr; Caur_R0010-1.
DR   EnsemblGenomes-Tr; Caur_R0011-1.
DR   EnsemblGenomes-Tr; Caur_R0012-1.
DR   EnsemblGenomes-Tr; Caur_R0013-1.
DR   EnsemblGenomes-Tr; Caur_R0014-1.
DR   EnsemblGenomes-Tr; Caur_R0015-1.
DR   EnsemblGenomes-Tr; Caur_R0016-1.
DR   EnsemblGenomes-Tr; Caur_R0017-1.
DR   EnsemblGenomes-Tr; Caur_R0018-1.
DR   EnsemblGenomes-Tr; Caur_R0019-1.
DR   EnsemblGenomes-Tr; Caur_R0020-1.
DR   EnsemblGenomes-Tr; Caur_R0021-1.
DR   EnsemblGenomes-Tr; Caur_R0022-1.
DR   EnsemblGenomes-Tr; Caur_R0023-1.
DR   EnsemblGenomes-Tr; Caur_R0024-1.
DR   EnsemblGenomes-Tr; Caur_R0025-1.
DR   EnsemblGenomes-Tr; Caur_R0026-1.
DR   EnsemblGenomes-Tr; Caur_R0027-1.
DR   EnsemblGenomes-Tr; Caur_R0028-1.
DR   EnsemblGenomes-Tr; Caur_R0029-1.
DR   EnsemblGenomes-Tr; Caur_R0030-1.
DR   EnsemblGenomes-Tr; Caur_R0031-1.
DR   EnsemblGenomes-Tr; Caur_R0032-1.
DR   EnsemblGenomes-Tr; Caur_R0033-1.
DR   EnsemblGenomes-Tr; Caur_R0034-1.
DR   EnsemblGenomes-Tr; Caur_R0035-1.
DR   EnsemblGenomes-Tr; Caur_R0036-1.
DR   EnsemblGenomes-Tr; Caur_R0037-1.
DR   EnsemblGenomes-Tr; Caur_R0038-1.
DR   EnsemblGenomes-Tr; Caur_R0039-1.
DR   EnsemblGenomes-Tr; Caur_R0040-1.
DR   EnsemblGenomes-Tr; Caur_R0041-1.
DR   EnsemblGenomes-Tr; Caur_R0042-1.
DR   EnsemblGenomes-Tr; Caur_R0043-1.
DR   EnsemblGenomes-Tr; Caur_R0044-1.
DR   EnsemblGenomes-Tr; Caur_R0045-1.
DR   EnsemblGenomes-Tr; Caur_R0046-1.
DR   EnsemblGenomes-Tr; Caur_R0047-1.
DR   EnsemblGenomes-Tr; Caur_R0048-1.
DR   EnsemblGenomes-Tr; Caur_R0049-1.
DR   EnsemblGenomes-Tr; Caur_R0050-1.
DR   EnsemblGenomes-Tr; Caur_R0051-1.
DR   EnsemblGenomes-Tr; Caur_R0052-1.
DR   EnsemblGenomes-Tr; Caur_R0053-1.
DR   EnsemblGenomes-Tr; Caur_R0054-1.
DR   EnsemblGenomes-Tr; Caur_R0055-1.
DR   EnsemblGenomes-Tr; Caur_R0056-1.
DR   EnsemblGenomes-Tr; Caur_R0057-1.
DR   EnsemblGenomes-Tr; Caur_R0058-1.
DR   EnsemblGenomes-Tr; Caur_R0059-1.
DR   EnsemblGenomes-Tr; Caur_R0060-1.
DR   EnsemblGenomes-Tr; Caur_R0061-1.
DR   EnsemblGenomes-Tr; EBT00001754718.
DR   EnsemblGenomes-Tr; EBT00001754719.
DR   EnsemblGenomes-Tr; EBT00001754720.
DR   EnsemblGenomes-Tr; EBT00001754721.
DR   EnsemblGenomes-Tr; EBT00001754722.
DR   EnsemblGenomes-Tr; EBT00001754723.
DR   EnsemblGenomes-Tr; EBT00001754724.
DR   EnsemblGenomes-Tr; EBT00001754725.
DR   EnsemblGenomes-Tr; EBT00001754726.
DR   EnsemblGenomes-Tr; EBT00001754727.
DR   EnsemblGenomes-Tr; EBT00001754728.
DR   EnsemblGenomes-Tr; EBT00001754729.
DR   EnsemblGenomes-Tr; EBT00001754730.
DR   EnsemblGenomes-Tr; EBT00001754731.
DR   EnsemblGenomes-Tr; EBT00001754732.
DR   EnsemblGenomes-Tr; EBT00001754733.
DR   EnsemblGenomes-Tr; EBT00001754734.
DR   EnsemblGenomes-Tr; EBT00001754735.
DR   EnsemblGenomes-Tr; EBT00001754736.
DR   EnsemblGenomes-Tr; EBT00001754737.
DR   EnsemblGenomes-Tr; EBT00001754738.
DR   EnsemblGenomes-Tr; EBT00001754739.
DR   EnsemblGenomes-Tr; EBT00001754740.
DR   EnsemblGenomes-Tr; EBT00001754741.
DR   EnsemblGenomes-Tr; EBT00001754742.
DR   EnsemblGenomes-Tr; EBT00001754743.
DR   EnsemblGenomes-Tr; EBT00001754744.
DR   EnsemblGenomes-Tr; EBT00001754745.
DR   EnsemblGenomes-Tr; EBT00001754746.
DR   EnsemblGenomes-Tr; EBT00001754747.
DR   EnsemblGenomes-Tr; EBT00001754748.
DR   EnsemblGenomes-Tr; EBT00001754749.
DR   EnsemblGenomes-Tr; EBT00001754750.
DR   EnsemblGenomes-Tr; EBT00001754751.
DR   EnsemblGenomes-Tr; EBT00001754752.
DR   EnsemblGenomes-Tr; EBT00001754753.
DR   EnsemblGenomes-Tr; EBT00001754754.
DR   EnsemblGenomes-Tr; EBT00001754755.
DR   EnsemblGenomes-Tr; EBT00001754756.
DR   EnsemblGenomes-Tr; EBT00001754757.
DR   EnsemblGenomes-Tr; EBT00001754758.
DR   EnsemblGenomes-Tr; EBT00001754759.
DR   EnsemblGenomes-Tr; EBT00001754760.
DR   EnsemblGenomes-Tr; EBT00001754761.
DR   EnsemblGenomes-Tr; EBT00001754762.
DR   EnsemblGenomes-Tr; EBT00001754763.
DR   EnsemblGenomes-Tr; EBT00001754764.
DR   EnsemblGenomes-Tr; EBT00001754765.
DR   EnsemblGenomes-Tr; EBT00001754766.
DR   EnsemblGenomes-Tr; EBT00001754767.
DR   EnsemblGenomes-Tr; EBT00001754768.
DR   EnsemblGenomes-Tr; EBT00001754769.
DR   EnsemblGenomes-Tr; EBT00001754770.
DR   EnsemblGenomes-Tr; EBT00001754771.
DR   EnsemblGenomes-Tr; EBT00001754772.
DR   EnsemblGenomes-Tr; EBT00001754773.
DR   EnsemblGenomes-Tr; EBT00001754774.
DR   EnsemblGenomes-Tr; EBT00001754775.
DR   EnsemblGenomes-Tr; EBT00001754776.
DR   EnsemblGenomes-Tr; EBT00001754777.
DR   EnsemblGenomes-Tr; EBT00001754778.
DR   EnsemblGenomes-Tr; EBT00001754779.
DR   EnsemblGenomes-Tr; EBT00001754780.
DR   EnsemblGenomes-Tr; EBT00001754781.
DR   EnsemblGenomes-Tr; EBT00001754782.
DR   EnsemblGenomes-Tr; EBT00001754783.
DR   EnsemblGenomes-Tr; EBT00001754784.
DR   EnsemblGenomes-Tr; EBT00001754785.
DR   EnsemblGenomes-Tr; EBT00001754786.
DR   EnsemblGenomes-Tr; EBT00001754787.
DR   EnsemblGenomes-Tr; EBT00001754788.
DR   EnsemblGenomes-Tr; EBT00001754789.
DR   EnsemblGenomes-Tr; EBT00001754790.
DR   EnsemblGenomes-Tr; EBT00001754791.
DR   EnsemblGenomes-Tr; EBT00001754792.
DR   EnsemblGenomes-Tr; EBT00001754793.
DR   EnsemblGenomes-Tr; EBT00001754794.
DR   EnsemblGenomes-Tr; EBT00001754795.
DR   EnsemblGenomes-Tr; EBT00001754796.
DR   EnsemblGenomes-Tr; EBT00001754797.
DR   EnsemblGenomes-Tr; EBT00001754798.
DR   EnsemblGenomes-Tr; EBT00001754799.
DR   EnsemblGenomes-Tr; EBT00001754800.
DR   EnsemblGenomes-Tr; EBT00001754801.
DR   EnsemblGenomes-Tr; EBT00001754802.
DR   EnsemblGenomes-Tr; EBT00001754803.
DR   EnsemblGenomes-Tr; EBT00001754804.
DR   EnsemblGenomes-Tr; EBT00001754805.
DR   EnsemblGenomes-Tr; EBT00001754806.
DR   EnsemblGenomes-Tr; EBT00001754807.
DR   EnsemblGenomes-Tr; EBT00001754808.
DR   EnsemblGenomes-Tr; EBT00001754809.
DR   EnsemblGenomes-Tr; EBT00001754810.
DR   EnsemblGenomes-Tr; EBT00001754811.
DR   EnsemblGenomes-Tr; EBT00001754812.
DR   EnsemblGenomes-Tr; EBT00001754813.
DR   EnsemblGenomes-Tr; EBT00001754814.
DR   EnsemblGenomes-Tr; EBT00001754815.
DR   EnsemblGenomes-Tr; EBT00001754816.
DR   EnsemblGenomes-Tr; EBT00001754817.
DR   EnsemblGenomes-Tr; EBT00001754818.
DR   EnsemblGenomes-Tr; EBT00001754819.
DR   EnsemblGenomes-Tr; EBT00001754820.
DR   EnsemblGenomes-Tr; EBT00001754821.
DR   EnsemblGenomes-Tr; EBT00001754822.
DR   EnsemblGenomes-Tr; EBT00001754823.
DR   EnsemblGenomes-Tr; EBT00001754824.
DR   EnsemblGenomes-Tr; EBT00001754825.
DR   EnsemblGenomes-Tr; EBT00001754826.
DR   EnsemblGenomes-Tr; EBT00001754827.
DR   EnsemblGenomes-Tr; EBT00001754828.
DR   EnsemblGenomes-Tr; EBT00001754829.
DR   EnsemblGenomes-Tr; EBT00001754830.
DR   EnsemblGenomes-Tr; EBT00001754831.
DR   EnsemblGenomes-Tr; EBT00001754832.
DR   EnsemblGenomes-Tr; EBT00001754833.
DR   EnsemblGenomes-Tr; EBT00001754834.
DR   EnsemblGenomes-Tr; EBT00001754835.
DR   EnsemblGenomes-Tr; EBT00001754836.
DR   EnsemblGenomes-Tr; EBT00001754837.
DR   EnsemblGenomes-Tr; EBT00001754838.
DR   EnsemblGenomes-Tr; EBT00001754839.
DR   EnsemblGenomes-Tr; EBT00001754840.
DR   EnsemblGenomes-Tr; EBT00001754841.
DR   EnsemblGenomes-Tr; EBT00001754842.
DR   EnsemblGenomes-Tr; EBT00001754843.
DR   EnsemblGenomes-Tr; EBT00001754844.
DR   EnsemblGenomes-Tr; EBT00001754845.
DR   EnsemblGenomes-Tr; EBT00001754846.
DR   EnsemblGenomes-Tr; EBT00001754847.
DR   EnsemblGenomes-Tr; EBT00001754848.
DR   EnsemblGenomes-Tr; EBT00001754849.
DR   EnsemblGenomes-Tr; EBT00001754850.
DR   EnsemblGenomes-Tr; EBT00001754851.
DR   EnsemblGenomes-Tr; EBT00001754852.
DR   EnsemblGenomes-Tr; EBT00001754853.
DR   EnsemblGenomes-Tr; EBT00001754854.
DR   EnsemblGenomes-Tr; EBT00001754855.
DR   EnsemblGenomes-Tr; EBT00001754856.
DR   EnsemblGenomes-Tr; EBT00001754857.
DR   EnsemblGenomes-Tr; EBT00001754858.
DR   EnsemblGenomes-Tr; EBT00001754859.
DR   EnsemblGenomes-Tr; EBT00001754860.
DR   EnsemblGenomes-Tr; EBT00001754861.
DR   EnsemblGenomes-Tr; EBT00001754862.
DR   EnsemblGenomes-Tr; EBT00001754863.
DR   EnsemblGenomes-Tr; EBT00001754864.
DR   EnsemblGenomes-Tr; EBT00001754865.
DR   EnsemblGenomes-Tr; EBT00001754866.
DR   EnsemblGenomes-Tr; EBT00001754867.
DR   EnsemblGenomes-Tr; EBT00001754868.
DR   EnsemblGenomes-Tr; EBT00001754869.
DR   EnsemblGenomes-Tr; EBT00001754870.
DR   EnsemblGenomes-Tr; EBT00001754871.
DR   EnsemblGenomes-Tr; EBT00001754872.
DR   EnsemblGenomes-Tr; EBT00001754873.
DR   EnsemblGenomes-Tr; EBT00001754874.
DR   EnsemblGenomes-Tr; EBT00001754875.
DR   EnsemblGenomes-Tr; EBT00001754876.
DR   EnsemblGenomes-Tr; EBT00001754877.
DR   EnsemblGenomes-Tr; EBT00001754878.
DR   EnsemblGenomes-Tr; EBT00001754879.
DR   EnsemblGenomes-Tr; EBT00001754880.
DR   EnsemblGenomes-Tr; EBT00001754881.
DR   EnsemblGenomes-Tr; EBT00001754882.
DR   EnsemblGenomes-Tr; EBT00001754883.
DR   EnsemblGenomes-Tr; EBT00001754884.
DR   EnsemblGenomes-Tr; EBT00001754885.
DR   EnsemblGenomes-Tr; EBT00001754886.
DR   EnsemblGenomes-Tr; EBT00001754887.
DR   EnsemblGenomes-Tr; EBT00001754888.
DR   EnsemblGenomes-Tr; EBT00001754889.
DR   EnsemblGenomes-Tr; EBT00001754890.
DR   EnsemblGenomes-Tr; EBT00001754891.
DR   EnsemblGenomes-Tr; EBT00001754892.
DR   EnsemblGenomes-Tr; EBT00001754893.
DR   EnsemblGenomes-Tr; EBT00001754894.
DR   EnsemblGenomes-Tr; EBT00001754895.
DR   EnsemblGenomes-Tr; EBT00001754896.
DR   EnsemblGenomes-Tr; EBT00001754897.
DR   EnsemblGenomes-Tr; EBT00001754898.
DR   EnsemblGenomes-Tr; EBT00001754899.
DR   EnsemblGenomes-Tr; EBT00001754900.
DR   EnsemblGenomes-Tr; EBT00001754901.
DR   EnsemblGenomes-Tr; EBT00001754902.
DR   EnsemblGenomes-Tr; EBT00001754903.
DR   EnsemblGenomes-Tr; EBT00001754904.
DR   EnsemblGenomes-Tr; EBT00001754905.
DR   EnsemblGenomes-Tr; EBT00001754906.
DR   EnsemblGenomes-Tr; EBT00001754907.
DR   EnsemblGenomes-Tr; EBT00001754908.
DR   EnsemblGenomes-Tr; EBT00001754909.
DR   EnsemblGenomes-Tr; EBT00001754910.
DR   EnsemblGenomes-Tr; EBT00001754911.
DR   EnsemblGenomes-Tr; EBT00001754912.
DR   EnsemblGenomes-Tr; EBT00001754913.
DR   EnsemblGenomes-Tr; EBT00001754914.
DR   EnsemblGenomes-Tr; EBT00001754915.
DR   EnsemblGenomes-Tr; EBT00001754916.
DR   EnsemblGenomes-Tr; EBT00001754917.
DR   EnsemblGenomes-Tr; EBT00001754918.
DR   EnsemblGenomes-Tr; EBT00001754919.
DR   EnsemblGenomes-Tr; EBT00001754920.
DR   EnsemblGenomes-Tr; EBT00001754921.
DR   EnsemblGenomes-Tr; EBT00001754922.
DR   EnsemblGenomes-Tr; EBT00001754923.
DR   EnsemblGenomes-Tr; EBT00001754924.
DR   EnsemblGenomes-Tr; EBT00001754925.
DR   EnsemblGenomes-Tr; EBT00001754926.
DR   EnsemblGenomes-Tr; EBT00001754927.
DR   EnsemblGenomes-Tr; EBT00001754928.
DR   EnsemblGenomes-Tr; EBT00001754929.
DR   EnsemblGenomes-Tr; EBT00001754930.
DR   EnsemblGenomes-Tr; EBT00001754931.
DR   EnsemblGenomes-Tr; EBT00001754932.
DR   EnsemblGenomes-Tr; EBT00001754933.
DR   EnsemblGenomes-Tr; EBT00001754934.
DR   EnsemblGenomes-Tr; EBT00001754935.
DR   EnsemblGenomes-Tr; EBT00001754936.
DR   EnsemblGenomes-Tr; EBT00001754937.
DR   EnsemblGenomes-Tr; EBT00001754938.
DR   EnsemblGenomes-Tr; EBT00001754939.
DR   EnsemblGenomes-Tr; EBT00001754940.
DR   EnsemblGenomes-Tr; EBT00001754941.
DR   EnsemblGenomes-Tr; EBT00001754942.
DR   EnsemblGenomes-Tr; EBT00001754943.
DR   EnsemblGenomes-Tr; EBT00001754944.
DR   EnsemblGenomes-Tr; EBT00001754945.
DR   EnsemblGenomes-Tr; EBT00001754946.
DR   EnsemblGenomes-Tr; EBT00001754947.
DR   EnsemblGenomes-Tr; EBT00001754948.
DR   EnsemblGenomes-Tr; EBT00001754949.
DR   EnsemblGenomes-Tr; EBT00001754950.
DR   EnsemblGenomes-Tr; EBT00001754951.
DR   EnsemblGenomes-Tr; EBT00001754952.
DR   EnsemblGenomes-Tr; EBT00001754953.
DR   EnsemblGenomes-Tr; EBT00001754954.
DR   EnsemblGenomes-Tr; EBT00001754955.
DR   EnsemblGenomes-Tr; EBT00001754956.
DR   EnsemblGenomes-Tr; EBT00001754957.
DR   EnsemblGenomes-Tr; EBT00001754958.
DR   EnsemblGenomes-Tr; EBT00001754959.
DR   EnsemblGenomes-Tr; EBT00001754960.
DR   EnsemblGenomes-Tr; EBT00001754961.
DR   EnsemblGenomes-Tr; EBT00001754962.
DR   EnsemblGenomes-Tr; EBT00001754963.
DR   EnsemblGenomes-Tr; EBT00001754964.
DR   EnsemblGenomes-Tr; EBT00001754965.
DR   EnsemblGenomes-Tr; EBT00001754966.
DR   EnsemblGenomes-Tr; EBT00001754967.
DR   EnsemblGenomes-Tr; EBT00001754968.
DR   EnsemblGenomes-Tr; EBT00001754969.
DR   EnsemblGenomes-Tr; EBT00001754970.
DR   EnsemblGenomes-Tr; EBT00001754971.
DR   EnsemblGenomes-Tr; EBT00001754972.
DR   EnsemblGenomes-Tr; EBT00001754973.
DR   EnsemblGenomes-Tr; EBT00001754974.
DR   EnsemblGenomes-Tr; EBT00001754975.
DR   EnsemblGenomes-Tr; EBT00001754976.
DR   EnsemblGenomes-Tr; EBT00001754977.
DR   EnsemblGenomes-Tr; EBT00001754978.
DR   EnsemblGenomes-Tr; EBT00001754979.
DR   EnsemblGenomes-Tr; EBT00001754980.
DR   EnsemblGenomes-Tr; EBT00001754981.
DR   EnsemblGenomes-Tr; EBT00001754982.
DR   EnsemblGenomes-Tr; EBT00001754983.
DR   EnsemblGenomes-Tr; EBT00001754984.
DR   EnsemblGenomes-Tr; EBT00001754985.
DR   EnsemblGenomes-Tr; EBT00001754986.
DR   EnsemblGenomes-Tr; EBT00001754987.
DR   EnsemblGenomes-Tr; EBT00001754988.
DR   EnsemblGenomes-Tr; EBT00001754989.
DR   EnsemblGenomes-Tr; EBT00001754990.
DR   EnsemblGenomes-Tr; EBT00001754991.
DR   EnsemblGenomes-Tr; EBT00001754992.
DR   EnsemblGenomes-Tr; EBT00001754993.
DR   EnsemblGenomes-Tr; EBT00001754994.
DR   EnsemblGenomes-Tr; EBT00001754995.
DR   EnsemblGenomes-Tr; EBT00001754996.
DR   EnsemblGenomes-Tr; EBT00001754997.
DR   EnsemblGenomes-Tr; EBT00001754998.
DR   EnsemblGenomes-Tr; EBT00001754999.
DR   EnsemblGenomes-Tr; EBT00001755000.
DR   EnsemblGenomes-Tr; EBT00001755001.
DR   EnsemblGenomes-Tr; EBT00001755002.
DR   EnsemblGenomes-Tr; EBT00001755003.
DR   EnsemblGenomes-Tr; EBT00001755004.
DR   EnsemblGenomes-Tr; EBT00001755005.
DR   EnsemblGenomes-Tr; EBT00001755006.
DR   EnsemblGenomes-Tr; EBT00001755007.
DR   EnsemblGenomes-Tr; EBT00001755008.
DR   EnsemblGenomes-Tr; EBT00001755009.
DR   EnsemblGenomes-Tr; EBT00001755010.
DR   EnsemblGenomes-Tr; EBT00001755011.
DR   EnsemblGenomes-Tr; EBT00001755012.
DR   EnsemblGenomes-Tr; EBT00001755013.
DR   EnsemblGenomes-Tr; EBT00001755014.
DR   EnsemblGenomes-Tr; EBT00001755015.
DR   EnsemblGenomes-Tr; EBT00001755016.
DR   EnsemblGenomes-Tr; EBT00001755017.
DR   EnsemblGenomes-Tr; EBT00001755018.
DR   EnsemblGenomes-Tr; EBT00001755019.
DR   EnsemblGenomes-Tr; EBT00001755020.
DR   EnsemblGenomes-Tr; EBT00001755021.
DR   EnsemblGenomes-Tr; EBT00001755022.
DR   EnsemblGenomes-Tr; EBT00001755023.
DR   EnsemblGenomes-Tr; EBT00001755024.
DR   EnsemblGenomes-Tr; EBT00001755025.
DR   EnsemblGenomes-Tr; EBT00001755026.
DR   EnsemblGenomes-Tr; EBT00001755027.
DR   EnsemblGenomes-Tr; EBT00001755028.
DR   EnsemblGenomes-Tr; EBT00001755029.
DR   EnsemblGenomes-Tr; EBT00001755030.
DR   EnsemblGenomes-Tr; EBT00001755031.
DR   EnsemblGenomes-Tr; EBT00001755032.
DR   EnsemblGenomes-Tr; EBT00001755033.
DR   EnsemblGenomes-Tr; EBT00001755034.
DR   EnsemblGenomes-Tr; EBT00001755035.
DR   EnsemblGenomes-Tr; EBT00001755036.
DR   EnsemblGenomes-Tr; EBT00001755037.
DR   EnsemblGenomes-Tr; EBT00001755038.
DR   EnsemblGenomes-Tr; EBT00001755039.
DR   EnsemblGenomes-Tr; EBT00001755040.
DR   EnsemblGenomes-Tr; EBT00001755041.
DR   EnsemblGenomes-Tr; EBT00001755042.
DR   EnsemblGenomes-Tr; EBT00001755043.
DR   EnsemblGenomes-Tr; EBT00001755044.
DR   EnsemblGenomes-Tr; EBT00001755045.
DR   EnsemblGenomes-Tr; EBT00001755046.
DR   EnsemblGenomes-Tr; EBT00001755047.
DR   EnsemblGenomes-Tr; EBT00001755048.
DR   EnsemblGenomes-Tr; EBT00001755049.
DR   EnsemblGenomes-Tr; EBT00001755050.
DR   EnsemblGenomes-Tr; EBT00001755051.
DR   EnsemblGenomes-Tr; EBT00001755052.
DR   EnsemblGenomes-Tr; EBT00001755053.
DR   EnsemblGenomes-Tr; EBT00001755054.
DR   EnsemblGenomes-Tr; EBT00001755055.
DR   EnsemblGenomes-Tr; EBT00001755056.
DR   EnsemblGenomes-Tr; EBT00001755057.
DR   EnsemblGenomes-Tr; EBT00001755058.
DR   EnsemblGenomes-Tr; EBT00001755059.
DR   EnsemblGenomes-Tr; EBT00001755060.
DR   EnsemblGenomes-Tr; EBT00001755061.
DR   EnsemblGenomes-Tr; EBT00001755062.
DR   EnsemblGenomes-Tr; EBT00001755063.
DR   EnsemblGenomes-Tr; EBT00001755064.
DR   EnsemblGenomes-Tr; EBT00001755065.
DR   EnsemblGenomes-Tr; EBT00001755066.
DR   EnsemblGenomes-Tr; EBT00001755067.
DR   EnsemblGenomes-Tr; EBT00001755068.
DR   EnsemblGenomes-Tr; EBT00001755069.
DR   EnsemblGenomes-Tr; EBT00001755070.
DR   EnsemblGenomes-Tr; EBT00001755071.
DR   EnsemblGenomes-Tr; EBT00001755072.
DR   EnsemblGenomes-Tr; EBT00001755073.
DR   EnsemblGenomes-Tr; EBT00001755074.
DR   EnsemblGenomes-Tr; EBT00001755075.
DR   EnsemblGenomes-Tr; EBT00001755076.
DR   EnsemblGenomes-Tr; EBT00001755077.
DR   EnsemblGenomes-Tr; EBT00001755078.
DR   EnsemblGenomes-Tr; EBT00001755079.
DR   EnsemblGenomes-Tr; EBT00001755080.
DR   EnsemblGenomes-Tr; EBT00001755081.
DR   EnsemblGenomes-Tr; EBT00001755082.
DR   EnsemblGenomes-Tr; EBT00001755083.
DR   EnsemblGenomes-Tr; EBT00001755084.
DR   EnsemblGenomes-Tr; EBT00001755085.
DR   EnsemblGenomes-Tr; EBT00001755086.
DR   EnsemblGenomes-Tr; EBT00001755087.
DR   EnsemblGenomes-Tr; EBT00001755088.
DR   EnsemblGenomes-Tr; EBT00001755089.
DR   EnsemblGenomes-Tr; EBT00001755090.
DR   EnsemblGenomes-Tr; EBT00001755091.
DR   EnsemblGenomes-Tr; EBT00001755092.
DR   EnsemblGenomes-Tr; EBT00001755093.
DR   EnsemblGenomes-Tr; EBT00001755094.
DR   EnsemblGenomes-Tr; EBT00001755095.
DR   EnsemblGenomes-Tr; EBT00001755096.
DR   EnsemblGenomes-Tr; EBT00001755097.
DR   EnsemblGenomes-Tr; EBT00001755098.
DR   EnsemblGenomes-Tr; EBT00001755099.
DR   EnsemblGenomes-Tr; EBT00001755100.
DR   EnsemblGenomes-Tr; EBT00001755101.
DR   EnsemblGenomes-Tr; EBT00001755102.
DR   EnsemblGenomes-Tr; EBT00001755103.
DR   EnsemblGenomes-Tr; EBT00001755104.
DR   EnsemblGenomes-Tr; EBT00001755105.
DR   EnsemblGenomes-Tr; EBT00001755106.
DR   EnsemblGenomes-Tr; EBT00001755107.
DR   EnsemblGenomes-Tr; EBT00001755108.
DR   EnsemblGenomes-Tr; EBT00001755109.
DR   EnsemblGenomes-Tr; EBT00001755110.
DR   EnsemblGenomes-Tr; EBT00001755111.
DR   EnsemblGenomes-Tr; EBT00001755112.
DR   EnsemblGenomes-Tr; EBT00001755113.
DR   EnsemblGenomes-Tr; EBT00001755114.
DR   EnsemblGenomes-Tr; EBT00001755115.
DR   EnsemblGenomes-Tr; EBT00001755116.
DR   EnsemblGenomes-Tr; EBT00001755117.
DR   EnsemblGenomes-Tr; EBT00001755118.
DR   EnsemblGenomes-Tr; EBT00001755119.
DR   EnsemblGenomes-Tr; EBT00001755120.
DR   EnsemblGenomes-Tr; EBT00001755121.
DR   EnsemblGenomes-Tr; EBT00001755122.
DR   EnsemblGenomes-Tr; EBT00001755123.
DR   EnsemblGenomes-Tr; EBT00001755124.
DR   EnsemblGenomes-Tr; EBT00001755125.
DR   EnsemblGenomes-Tr; EBT00001755126.
DR   EnsemblGenomes-Tr; EBT00001755127.
DR   EnsemblGenomes-Tr; EBT00001755129.
DR   EnsemblGenomes-Tr; EBT00001755130.
DR   EnsemblGenomes-Tr; EBT00001755131.
DR   EnsemblGenomes-Tr; EBT00001755132.
DR   EnsemblGenomes-Tr; EBT00001755133.
DR   EnsemblGenomes-Tr; EBT00001755134.
DR   EnsemblGenomes-Tr; EBT00001755135.
DR   EnsemblGenomes-Tr; EBT00001755136.
DR   EnsemblGenomes-Tr; EBT00001755137.
DR   EnsemblGenomes-Tr; EBT00001755138.
DR   EnsemblGenomes-Tr; EBT00001755139.
DR   EnsemblGenomes-Tr; EBT00001755140.
DR   EnsemblGenomes-Tr; EBT00001755141.
DR   EnsemblGenomes-Tr; EBT00001755142.
DR   EnsemblGenomes-Tr; EBT00001755143.
DR   EnsemblGenomes-Tr; EBT00001755144.
DR   EnsemblGenomes-Tr; EBT00001755145.
DR   EnsemblGenomes-Tr; EBT00001755146.
DR   EnsemblGenomes-Tr; EBT00001755147.
DR   EnsemblGenomes-Tr; EBT00001755148.
DR   EnsemblGenomes-Tr; EBT00001755149.
DR   EnsemblGenomes-Tr; EBT00001755150.
DR   EnsemblGenomes-Tr; EBT00001755151.
DR   EnsemblGenomes-Tr; EBT00001755152.
DR   EnsemblGenomes-Tr; EBT00001755153.
DR   EnsemblGenomes-Tr; EBT00001755155.
DR   EnsemblGenomes-Tr; EBT00001755156.
DR   EnsemblGenomes-Tr; EBT00001755157.
DR   EnsemblGenomes-Tr; EBT00001755158.
DR   EnsemblGenomes-Tr; EBT00001755159.
DR   EnsemblGenomes-Tr; EBT00001755160.
DR   EnsemblGenomes-Tr; EBT00001755161.
DR   EnsemblGenomes-Tr; EBT00001755162.
DR   EnsemblGenomes-Tr; EBT00001755163.
DR   EnsemblGenomes-Tr; EBT00001755164.
DR   EnsemblGenomes-Tr; EBT00001755165.
DR   EnsemblGenomes-Tr; EBT00001755166.
DR   EnsemblGenomes-Tr; EBT00001755167.
DR   EnsemblGenomes-Tr; EBT00001755168.
DR   EnsemblGenomes-Tr; EBT00001755169.
DR   EnsemblGenomes-Tr; EBT00001755170.
DR   EnsemblGenomes-Tr; EBT00001755171.
DR   EnsemblGenomes-Tr; EBT00001755172.
DR   EnsemblGenomes-Tr; EBT00001755173.
DR   EnsemblGenomes-Tr; EBT00001755174.
DR   EnsemblGenomes-Tr; EBT00001755175.
DR   EnsemblGenomes-Tr; EBT00001755176.
DR   EnsemblGenomes-Tr; EBT00001755177.
DR   EnsemblGenomes-Tr; EBT00001755178.
DR   EnsemblGenomes-Tr; EBT00001755179.
DR   EnsemblGenomes-Tr; EBT00001755180.
DR   EnsemblGenomes-Tr; EBT00001755181.
DR   EnsemblGenomes-Tr; EBT00001755182.
DR   EnsemblGenomes-Tr; EBT00001755183.
DR   EnsemblGenomes-Tr; EBT00001755184.
DR   EnsemblGenomes-Tr; EBT00001755185.
DR   EnsemblGenomes-Tr; EBT00001755186.
DR   EnsemblGenomes-Tr; EBT00001755187.
DR   EnsemblGenomes-Tr; EBT00001755188.
DR   EnsemblGenomes-Tr; EBT00001755189.
DR   EnsemblGenomes-Tr; EBT00001755190.
DR   EnsemblGenomes-Tr; EBT00001755191.
DR   EnsemblGenomes-Tr; EBT00001755192.
DR   EnsemblGenomes-Tr; EBT00001755193.
DR   EnsemblGenomes-Tr; EBT00001755194.
DR   EnsemblGenomes-Tr; EBT00001755195.
DR   EnsemblGenomes-Tr; EBT00001755196.
DR   EnsemblGenomes-Tr; EBT00001755197.
DR   EnsemblGenomes-Tr; EBT00001755198.
DR   EnsemblGenomes-Tr; EBT00001755199.
DR   EnsemblGenomes-Tr; EBT00001755200.
DR   EnsemblGenomes-Tr; EBT00001755201.
DR   EnsemblGenomes-Tr; EBT00001755202.
DR   EnsemblGenomes-Tr; EBT00001755203.
DR   EnsemblGenomes-Tr; EBT00001755204.
DR   EnsemblGenomes-Tr; EBT00001755205.
DR   EnsemblGenomes-Tr; EBT00001755206.
DR   EnsemblGenomes-Tr; EBT00001755207.
DR   EnsemblGenomes-Tr; EBT00001755208.
DR   EnsemblGenomes-Tr; EBT00001755209.
DR   EnsemblGenomes-Tr; EBT00001755210.
DR   EnsemblGenomes-Tr; EBT00001755211.
DR   EnsemblGenomes-Tr; EBT00001755212.
DR   EnsemblGenomes-Tr; EBT00001755213.
DR   EnsemblGenomes-Tr; EBT00001755214.
DR   EnsemblGenomes-Tr; EBT00001755215.
DR   EnsemblGenomes-Tr; EBT00001755216.
DR   EnsemblGenomes-Tr; EBT00001755217.
DR   EnsemblGenomes-Tr; EBT00001755218.
DR   EnsemblGenomes-Tr; EBT00001755219.
DR   EnsemblGenomes-Tr; EBT00001755220.
DR   EnsemblGenomes-Tr; EBT00001755221.
DR   EnsemblGenomes-Tr; EBT00001755222.
DR   EnsemblGenomes-Tr; EBT00001755223.
DR   EnsemblGenomes-Tr; EBT00001755224.
DR   EnsemblGenomes-Tr; EBT00001755225.
DR   EnsemblGenomes-Tr; EBT00001755226.
DR   EnsemblGenomes-Tr; EBT00001755227.
DR   EnsemblGenomes-Tr; EBT00001755228.
DR   EnsemblGenomes-Tr; EBT00001755229.
DR   EnsemblGenomes-Tr; EBT00001755230.
DR   EnsemblGenomes-Tr; EBT00001755231.
DR   EnsemblGenomes-Tr; EBT00001755232.
DR   EnsemblGenomes-Tr; EBT00001755233.
DR   EnsemblGenomes-Tr; EBT00001755234.
DR   EnsemblGenomes-Tr; EBT00001755235.
DR   EnsemblGenomes-Tr; EBT00001755236.
DR   EnsemblGenomes-Tr; EBT00001755237.
DR   EnsemblGenomes-Tr; EBT00001755238.
DR   EnsemblGenomes-Tr; EBT00001755239.
DR   EnsemblGenomes-Tr; EBT00001755240.
DR   EnsemblGenomes-Tr; EBT00001755241.
DR   EnsemblGenomes-Tr; EBT00001755242.
DR   EnsemblGenomes-Tr; EBT00001755243.
DR   EnsemblGenomes-Tr; EBT00001755244.
DR   EnsemblGenomes-Tr; EBT00001755245.
DR   EnsemblGenomes-Tr; EBT00001755246.
DR   EnsemblGenomes-Tr; EBT00001755247.
DR   EnsemblGenomes-Tr; EBT00001755248.
DR   EnsemblGenomes-Tr; EBT00001755249.
DR   EnsemblGenomes-Tr; EBT00001755250.
DR   EnsemblGenomes-Tr; EBT00001755251.
DR   EnsemblGenomes-Tr; EBT00001755252.
DR   EnsemblGenomes-Tr; EBT00001755253.
DR   EnsemblGenomes-Tr; EBT00001755254.
DR   EnsemblGenomes-Tr; EBT00001755255.
DR   EnsemblGenomes-Tr; EBT00001755256.
DR   EnsemblGenomes-Tr; EBT00001755257.
DR   EnsemblGenomes-Tr; EBT00001755258.
DR   EnsemblGenomes-Tr; EBT00001755259.
DR   EnsemblGenomes-Tr; EBT00001755260.
DR   EnsemblGenomes-Tr; EBT00001755261.
DR   EnsemblGenomes-Tr; EBT00001755262.
DR   EnsemblGenomes-Tr; EBT00001755263.
DR   EnsemblGenomes-Tr; EBT00001755264.
DR   EnsemblGenomes-Tr; EBT00001755265.
DR   EnsemblGenomes-Tr; EBT00001755266.
DR   EnsemblGenomes-Tr; EBT00001755267.
DR   EnsemblGenomes-Tr; EBT00001755268.
DR   EnsemblGenomes-Tr; EBT00001755269.
DR   EnsemblGenomes-Tr; EBT00001755270.
DR   EnsemblGenomes-Tr; EBT00001755271.
DR   EnsemblGenomes-Tr; EBT00001755272.
DR   EnsemblGenomes-Tr; EBT00001755273.
DR   EnsemblGenomes-Tr; EBT00001755274.
DR   EnsemblGenomes-Tr; EBT00001755275.
DR   EnsemblGenomes-Tr; EBT00001755276.
DR   EnsemblGenomes-Tr; EBT00001755277.
DR   EnsemblGenomes-Tr; EBT00001755278.
DR   EnsemblGenomes-Tr; EBT00001755279.
DR   EnsemblGenomes-Tr; EBT00001755280.
DR   EnsemblGenomes-Tr; EBT00001755281.
DR   EnsemblGenomes-Tr; EBT00001755282.
DR   EnsemblGenomes-Tr; EBT00001755283.
DR   EnsemblGenomes-Tr; EBT00001755284.
DR   EnsemblGenomes-Tr; EBT00001755285.
DR   EnsemblGenomes-Tr; EBT00001755286.
DR   EnsemblGenomes-Tr; EBT00001755288.
DR   EnsemblGenomes-Tr; EBT00001755289.
DR   EnsemblGenomes-Tr; EBT00001755290.
DR   EnsemblGenomes-Tr; EBT00001755291.
DR   EnsemblGenomes-Tr; EBT00001755292.
DR   EnsemblGenomes-Tr; EBT00001755293.
DR   EnsemblGenomes-Tr; EBT00001755294.
DR   EnsemblGenomes-Tr; EBT00001755295.
DR   EnsemblGenomes-Tr; EBT00001755296.
DR   EnsemblGenomes-Tr; EBT00001755297.
DR   EnsemblGenomes-Tr; EBT00001755298.
DR   EnsemblGenomes-Tr; EBT00001755299.
DR   EnsemblGenomes-Tr; EBT00001755300.
DR   EnsemblGenomes-Tr; EBT00001755301.
DR   EnsemblGenomes-Tr; EBT00001755302.
DR   EnsemblGenomes-Tr; EBT00001755303.
DR   EnsemblGenomes-Tr; EBT00001755304.
DR   EnsemblGenomes-Tr; EBT00001755305.
DR   EnsemblGenomes-Tr; EBT00001755306.
DR   EnsemblGenomes-Tr; EBT00001755307.
DR   EnsemblGenomes-Tr; EBT00001755308.
DR   EnsemblGenomes-Tr; EBT00001755309.
DR   EnsemblGenomes-Tr; EBT00001755310.
DR   EnsemblGenomes-Tr; EBT00001755311.
DR   EnsemblGenomes-Tr; EBT00001755312.
DR   EnsemblGenomes-Tr; EBT00001755313.
DR   EnsemblGenomes-Tr; EBT00001755314.
DR   EnsemblGenomes-Tr; EBT00001755315.
DR   EnsemblGenomes-Tr; EBT00001755316.
DR   EnsemblGenomes-Tr; EBT00001755317.
DR   EnsemblGenomes-Tr; EBT00001755318.
DR   EnsemblGenomes-Tr; EBT00001755319.
DR   EnsemblGenomes-Tr; EBT00001755320.
DR   EnsemblGenomes-Tr; EBT00001755321.
DR   EnsemblGenomes-Tr; EBT00001755322.
DR   EnsemblGenomes-Tr; EBT00001755323.
DR   EnsemblGenomes-Tr; EBT00001755324.
DR   EnsemblGenomes-Tr; EBT00001755325.
DR   EnsemblGenomes-Tr; EBT00001755326.
DR   EnsemblGenomes-Tr; EBT00001755327.
DR   EuropePMC; PMC3035366; 21304745.
DR   EuropePMC; PMC3150298; 21714912.
DR   EuropePMC; PMC3679898; 23705883.
DR   EuropePMC; PMC4911352; 27379049.
DR   EuropePMC; PMC4956463; 27445390.
DR   EuropePMC; PMC5080407; 27822559.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01323; CRISPR-DR10.
DR   RFAM; RF01332; CRISPR-DR19.
DR   RFAM; RF01334; CRISPR-DR21.
DR   RFAM; RF01482; AdoCbl_riboswitch.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000909.
DR   SILVA-SSU; CP000909.
DR   StrainInfo; 106777; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000861
CC   Source DNA and bacteria available from Robert E. Blankenship
CC   (blankenship@wustl.edu)
CC   Contacts: Robert E. Blankenship (blankenship@wustl.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5258541
FT                   /organism="Chloroflexus aurantiacus J-10-fl"
FT                   /strain="J-10-fl"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:324602"
FT   gene            336..1775
FT                   /locus_tag="Caur_0001"
FT   CDS_pept        336..1775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rca:Rcas_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33259"
FT                   /db_xref="GOA:A9WAN1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WAN1"
FT                   /protein_id="ABY33259.1"
FT                   /translation="MNLTQIWKATLSALQTQTSRHDYEALLRPATLLSLDNGAAFIGVS
FT                   SPGQKEGLENRLLMPLRNALARVVGYPVQVQVLIANLNSRTEPSPSLTLSNGSRLMSDP
FT                   EPVVAETPAPALTPGNGTGERVVQLDLASAMRSGMLNPRYTFSSFIVGSSNRLAHAACL
FT                   AVADNPGQAYNPLFLYGGVGLGKTHLLHAIGNRVLDRDPEINVLYVSSEKFTNDLINAI
FT                   RRQQTEEFRMRYRNIDVLLIDDIQFIAGKDATQEEFFHTFNTLHSAAKHIVISSDRPPK
FT                   AILTLEERLRSRFEWGLIVDVQPPDLETRTAILRAKAEQMSVHVPDEVIDFLAHKIQSN
FT                   IRELEGSLNRVAAYAELNRAPITIETATAALADLLGNQRRRRISAEAILQIVSEHYGIE
FT                   VEQLRARNRSRHVVVPRQVAMYLLREETESSLVDIGNLLGGRDHTTVMYGCEKIAEEIN
FT                   SDSRLRSEVMAIRERIQMLRG"
FT   gene            1940..3841
FT                   /locus_tag="Caur_0002"
FT   CDS_pept        1940..3841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0002"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mpt:Mpe_A2513 PrpE protein ligase (putative propionyl-CoA
FT                   synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33260"
FT                   /db_xref="GOA:A9WAN2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAN2"
FT                   /protein_id="ABY33260.1"
FT                   /translation="MGYEAVYRRSIEEPEAYWAEFAAELHWYKPWEKVLDNSNPPFTRW
FT                   FVGGETNLCYNAVDRHALGGRRGQAALIWESAETGQSRTLTYFELYREVNRLAGLFHNL
FT                   GVRKGDRIIIYMPMVPEAIFAMLACVRIGAIHSVVFGGFSVTSLASRIDDAEPVLIVTA
FT                   DAGMRKGQPVPLKEIVDKALAEANTDSVRDVLVLNRGLVPVELKKGRDLDWYEQLAKRG
FT                   ERYVEPVPVASTDPSYILYTSGTTGKPKGVVRDTGGYMVALYASMSTIYNCGDGDVFWS
FT                   TSDIGWVVGHSYIVYAPLLKGVPTVVYEGRPDHPDPGVWWRVIEKYGVTHVFTAPTALR
FT                   ALRKFPEHWMRDADISSLKLLYAAGEPLDAPTYEWASAALGVPVIDHYWQTESGWPMVT
FT                   NPVGVELLPIKPGSPTKPAFGHRLEVVDADGNPVPPGEKGFLVEHGPLPPGTLLTLWND
FT                   DERFVKGYWGHFKDKLLYMTGDYAIKDADGYLFMLGRADEVLNVSGHRLGTREIEEVVS
FT                   AHPAVAEASVIGVRDELKGEDVLVVAVLKQHITPQMQDDIANEIRQLVRERIGPIATPK
FT                   AVHFVSMLPKTRSGKIMRRVIRAVYQGDNLGDLSTIEDDATVDMVREAIELLRGDLS"
FT   gene            4062..5996
FT                   /locus_tag="Caur_0003"
FT   CDS_pept        4062..5996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0003"
FT                   /product="acetate--CoA ligase"
FT                   /note="TIGRFAM: acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: rca:Rcas_3935 acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33261"
FT                   /db_xref="GOA:A9WAN3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAN3"
FT                   /protein_id="ABY33261.1"
FT                   /translation="MTETRDVALPDTSELYYPDPALVEQSNVMAYARSKGFNSYDELYQ
FT                   WTISHREEFWADMASQLEWFKPWDKVLDDSNKPFYQWFVGGKTNIVYNAIDRHLKTWRK
FT                   NKLALIWEGEDGSQRTYSYYQLNYEVSRIANVLKSMGVKKGDIVTIYMPRIPELMFSML
FT                   ACAKIGAAHSVVYGGFSEAALADRLADAKSKVLITADGGYMRGKVVELKKIVNEALSRT
FT                   PTVQTCLVFRHTNHGAPMEQGRDFWMHDLLGLPIANGHCPTEEMDAEDMLFILYTSGTT
FT                   GKPKGVVHTHGGYMVGTYTTLKFVFDIKDEDRYWCAADPGWITGHSFIVYAPLINGATS
FT                   FMYEGAPNYPYPDRWWSMVAKHGITILYTAPTAIRGLMRFGDLWPSRHDLSTLRLLGSV
FT                   GEPINPEAWKWFYEKIGHGRCPIMDTWWQTETGHFMITPTPAVPLKPGSATRPFLGIEA
FT                   DVVHEDGSPCAPDEDGLLVIKNPWPGMMRTILNDPQRYVEGYWQKVPPYYAAGDSARKD
FT                   KDGYIWVIGRLDDVIKVSGYRLGTAEVESALVSHPAVAEAAAIGLPHEVKGNAIHAFVI
FT                   LRAGYEPSHDLEEKLRAHVGHELGPIARPDSITFVTSLPKTRSGKIMRRVLRARALGLP
FT                   EGDVSTLEE"
FT   gene            complement(6173..7702)
FT                   /locus_tag="Caur_0004"
FT   CDS_pept        complement(6173..7702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0004"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   rrs:RoseRS_3893 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33262"
FT                   /db_xref="GOA:A9WAN4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAN4"
FT                   /protein_id="ABY33262.1"
FT                   /translation="MAEVTEILCPICHKPNLRRAKFCQHCGHDVVLNNDRPTDRRRYVI
FT                   TRIVKRGGQGAVYEGIDQDGQVYAIKEMLDRFADPNERAEAVERFNAEAELLQRLRHPR
FT                   IPRVYSHFTDEGRHYLTMDFIRGEDLEQIIEREGRIDEQRVLRWADEICDVLGYLHGKG
FT                   FIYRDMKPSNVMIEPSGDVKLIDFGIAKLFKPTERGTQIGTPGYAPPEQYQGLATPQSD
FT                   VYALAATLHHLLTGRDPTQEMPFSFPPARTLVPTISERTSAALERALQKVPADRFATMD
FT                   EFRAALIPARQPQPVQVQVSRPASPRAPAAPAAARPAGQTPSAASVSPPRPRPPIFADP
FT                   PISIQGGGAASSASTRRSAPPATVSPVQPPPSPTTSSRSRLGGQIVLSLILLGLIALTL
FT                   FSGYVIVTRPAWAAPVIELILGNSGSLSGELQTIEYELEATVPVGTSNRELLEVFRTMY
FT                   QERVQRELGNQAQINPNVPISYVGTPTEIARDGDQITYRARLTGTVWVTAP"
FT   gene            complement(7817..9226)
FT                   /locus_tag="Caur_0005"
FT   CDS_pept        complement(7817..9226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0005"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein HSR1-related; KH
FT                   type 2 domain protein; Miro domain protein; KEGG:
FT                   rrs:RoseRS_2181 GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33263"
FT                   /db_xref="GOA:A9WAN5"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAN5"
FT                   /protein_id="ABY33263.1"
FT                   /translation="MKYCSLDPDVGTLYLYFTDIEEGQATAVMEYPVSLLLDAQGAIFG
FT                   CRLDLDDEVILSQLELVLEGSYNWLDGEYGHLYIRIADEDPVETITLSETAILDLDDDD
FT                   LVLGIELALPEEWRTPERLQRLTPLMVTFDDEPVDGEGPVVFTPPAISADDLPDSDEEP
FT                   ATPVAEEPLQWRSGFVALVGKPNVGKSTLLNALLGEKVAIVSPRPQTTRVPVRGILSRP
FT                   GEQIIFIDTPGIHEPSHRLGKLMVELAERTLPNADVICFMVDISQPPTRLDRMIAQQVQ
FT                   RARGHKLLVLNKVDQKPKRPGENYLPAYRELGQWEMEIAISARRRLGLTALLSEISARL
FT                   PEGPPLYPLDQMTDQTEQQLAAEFVREKALFYLQQEVPHAIAIEVEEWQEKETATYIRM
FT                   TINVEKESQKGILIGAGGGMLKKIGSAARASIERMLGRPVYLDLWVKVRPNWRDDPSAL
FT                   GWLGYRAKNFL"
FT   gene            complement(9231..10391)
FT                   /locus_tag="Caur_0006"
FT   CDS_pept        complement(9231..10391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0006"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   rrs:RoseRS_1556 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33264"
FT                   /db_xref="GOA:A9WAN6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAN6"
FT                   /protein_id="ABY33264.1"
FT                   /translation="MGQEERPIRFSYQAKWISSALIVVLTIWLLFAVTHILPPFIGAII
FT                   TAYLFNPLIGWLHRRTRIGRAIWIIVLYIVAFFVLYSLFTALWPRIVQQSRDLAANAPV
FT                   IIRELTIFFEQNQTIEVGDFVISLAPLEAQVIGLIRDVAGWLSGNVPKIVFSALESVIY
FT                   LLVYLIITFYLLLQAPQLKAWSRSLIPAPYRREIGHLGYQIDRVFSAYIRGQLILIVIM
FT                   SVLLYIPLSILQVPYALVIAVASGVLEILPIIGPWSAAGIAMTVALFQPVTPFGLSNVA
FT                   LAVLLGIIYFVLRQIEDHFIIPNVMGPLVRLHPGVVIFAILAGGALAGAFGLFISIPIA
FT                   AVIRILLSYIYRKLTDQPETPSDTDQPHTAAQQETVTGEVALGSQG"
FT   gene            complement(10490..10765)
FT                   /locus_tag="Caur_0007"
FT   CDS_pept        complement(10490..10765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0007"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: rrs:RoseRS_1557 cell division
FT                   topological specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33265"
FT                   /db_xref="GOA:A9WAN7"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WAN7"
FT                   /protein_id="ABY33265.1"
FT                   /translation="MSFLNGLFGRKRDSSAELAKQRLLTVLIDDRYKLTPEMMAQMKAD
FT                   LAEVLKRYLPAIDAEQIEVTLSRGEAHDLLKADVPLRRATDHPPNR"
FT   gene            complement(10781..11581)
FT                   /locus_tag="Caur_0008"
FT   CDS_pept        complement(10781..11581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0008"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: rca:Rcas_3409
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33266"
FT                   /db_xref="GOA:A9WAN8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAN8"
FT                   /protein_id="ABY33266.1"
FT                   /translation="MGRVITVTSGKGGVGKTTTTANLGTALAMRGARVAVVDADIGLRN
FT                   LDVVMGLENRIVYDLVDVVEGRARLRQALIKDKRLPELCLLPAAQTRDKDAVSAQQMID
FT                   LTRQLRAEFDFVLIDSPAGIEAGFRNAIAGADEVIIVTTPEVSAVRDADRIVGLIEAAE
FT                   KGPASLIINRIKPRLVSRGEMLSVEDVLELLAISLLGIVPEDETIVIATNRGEAAVYDP
FT                   NSLAGRAYINIAQRLAGEDVPVMAIPDQQGMLDRLLSLFGRRRT"
FT   gene            complement(11591..12259)
FT                   /locus_tag="Caur_0009"
FT   CDS_pept        complement(11591..12259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0009"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG: rrs:RoseRS_1559
FT                   septum site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33267"
FT                   /db_xref="GOA:A9WAN9"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAN9"
FT                   /protein_id="ABY33267.1"
FT                   /translation="MTMSDLISIKGSRDGLRLRLDANVAWSELLHRLDLHLGERQSFFH
FT                   GANLVIDLGEREVSSAQLDEMLALIRQHGVQATAIDSTERSTRAAARSVGLTARPLSRS
FT                   PEATPMPEAEALLVMRTLRSGQVLRHTGHITLIGDVNPGGEIIAGGSVVVWGRLRGLVH
FT                   AGALGDRSAIICALELRPTQLRIADLIARAPDQQALSRPEFARVIAGEIIVDGWEAFKR
FT                   "
FT   gene            12961..13968
FT                   /locus_tag="Caur_0010"
FT   CDS_pept        12961..13968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0010"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: rca:Rcas_2314 glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33268"
FT                   /db_xref="GOA:A9WAP0"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAP0"
FT                   /protein_id="ABY33268.1"
FT                   /translation="MAVRVGINGFGRIGRLALRAAWAWPELDIVHINEVGGDAATAAHL
FT                   LSFDSTQGRWSVEVHGEGNQLLIDDKTVGYSQIRDPGAVPWADAGVDIVLEATGKFRTA
FT                   EQLAAYFSAGVKKVIVAAPVKGEALNVVMGVNDHWYEPDRHHLLTAASCTTNCLAPIVK
FT                   VIHEGIGIRHGMITTIHSSTNTQTVHDRPHKDLRRARAASLSLIPTTTGSATAIGLIFP
FT                   ELQGKLDGQAVRVPLLNASLTDCVFEVRRPTTVAEVNGLLQAAAEGALKGILAYETRPL
FT                   VSIDFLGNPHSAIVDSLCTMVTNETQVKIYAWYDNEWGYANRYVELARKVALLL"
FT   gene            13965..15263
FT                   /locus_tag="Caur_0011"
FT   CDS_pept        13965..15263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0011"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rrs:RoseRS_1225 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33269"
FT                   /db_xref="GOA:A9WAP1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAP1"
FT                   /protein_id="ABY33269.1"
FT                   /translation="MKTTPSTEASATMTQQRADRRNYVLVTIAYWADTLTDGAIRMLVL
FT                   FYFAQLGYSPFAVASLFLFYEIFGVITNLFGGYIGARFGLKLTLFLGLATQLVALSMLA
FT                   FAPPSLLVVPYVMAAQALSGIAKDLTKMSSKSAVKLVAGTGEGQLYRWVSVLTGSKNAI
FT                   KGLGFFVGALLLSLFGFQTALIMLAVLVLTALVGAVSTISGDLGVANKKAKFKQIFSPN
FT                   RAVNLLAAARIFLFGARDVWFVVGLPVFFITVLGWDFWLAGGFMAAWTIGYGFVQASTP
FT                   ALIRRRIANAQAPDGRTAMWLAFALAAFPAGIAITLHAGLIPTLSVVGGLLAFGIIFAL
FT                   NSAVHSYLILAYADDAKVAMNVGFYYMANALGRLTGTVLSGALYQWGMQSNPFGGLIAC
FT                   LWASAGFILIAGLLSIRLPTPTRTVVGTWKVEE"
FT   gene            complement(15276..15677)
FT                   /pseudo
FT                   /locus_tag="Caur_0012"
FT   gene            16693..17049
FT                   /locus_tag="Caur_0013"
FT   CDS_pept        16693..17049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0013"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: rca:Rcas_3618
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33270"
FT                   /db_xref="GOA:A9WAP2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAP2"
FT                   /protein_id="ABY33270.1"
FT                   /translation="MIRAMKTTTTVKQARLFKALMHPVRIQILDILREGEACVCHIEAV
FT                   LGLRQAYVSQQLAVLRKAGLIRDRREGPNIYYRIGHRDVFTILDVARTLVGEDELVTPT
FT                   TVRCSCPRCTAPTA"
FT   gene            17072..17305
FT                   /locus_tag="Caur_0014"
FT   CDS_pept        17072..17305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0014"
FT                   /product="redox-active disulfide protein 2"
FT                   /note="TIGRFAM: redox-active disulfide protein 2; KEGG:
FT                   rca:Rcas_3619 redox-active disulfide protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33271"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAP3"
FT                   /protein_id="ABY33271.1"
FT                   /translation="MVSVKVLGPGCANCRKLEERVRHVIRQHQLEAEIEKVTDYAQIMR
FT                   WNVMRTPGLVVNDVLVAAGRIPSEEEIAGWLR"
FT   gene            17362..18450
FT                   /locus_tag="Caur_0015"
FT   CDS_pept        17362..18450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0015"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: rca:Rcas_3620 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33272"
FT                   /db_xref="GOA:A9WAP4"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAP4"
FT                   /protein_id="ABY33272.1"
FT                   /translation="MQKLAYLMENSIMAQTISPTADRRPAWRIWLLVVGGAAVWLIAYN
FT                   LIQPLANWLTFQVIGLQEGSHLGEAVAFFLYDVPKILLLLSGMIFLISTIRSFFSPERT
FT                   RELLGGKREGVGNILAAGLGVLTPFCSCSAVPLFIGFVEAGIPLGVTFSFLIAAPMVNE
FT                   VALVMLFGLFGWQVALLYLVAGMSVAILAGIVIGRLHLERYVEDFVWQIKGGNGTVALA
FT                   TPTWPDRFAIAWANTREIVGKVWLFVVLGIAVGAGIHGYVPEDALAGILGREAWWSVPM
FT                   GVLLGVPLYSNAAGVIPVVQALMAKGAALGTVLAFMMSVVALSLPELIILRRVLKLPLI
FT                   ATFVGVVASGIILVGYLFNLMM"
FT   gene            complement(18495..18875)
FT                   /locus_tag="Caur_0016"
FT   CDS_pept        complement(18495..18875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33273"
FT                   /db_xref="GOA:A9WAP5"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAP5"
FT                   /protein_id="ABY33273.1"
FT                   /translation="MSGSQFGRRQILSIIAGGYGGLLCAFGALLIFFGLVNYSEVGLGG
FT                   LAAFLAIIFSVPIILFAVVLIVAAIGLWNNRPWARILLMVLAAIHLAIAVSMIPLGDLW
FT                   PISLLGIALSVGIFWFVRGLQE"
FT   gene            complement(19929..20099)
FT                   /pseudo
FT                   /locus_tag="Caur_0017"
FT   gene            20916..21719
FT                   /locus_tag="Caur_0018"
FT   CDS_pept        20916..21719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0018"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   rrs:RoseRS_1762 protein of unknown function DUF574"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33274"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAP6"
FT                   /protein_id="ABY33274.1"
FT                   /translation="MEPSGAVELSPSETPNAARIYSYTLGGSYYLPVDRAAAEYMFSLV
FT                   PSTPKWVRMLRSFLQHAARRLWAEGLTHFIDFASGLPTDDHIHHVLPDARVVYSDLDPE
FT                   TYNLARQLVEHLPNVLYLRHDVREARVLLDSPEVQNFLGGERRVAFGLNGITVFLSPDE
FT                   ISHLFHDLYEWAAPGSRLYITYETKMPGLMTPRMEQFIDMFRQAGSPFWLYSLEECIAL
FT                   SRPWQIPPTGLMPLHEFLGLPADYITESDQEGVGLQFYAAILTKP"
FT   gene            22044..23089
FT                   /pseudo
FT                   /locus_tag="Caur_0019"
FT   gene            23546..24463
FT                   /locus_tag="Caur_0020"
FT   CDS_pept        23546..24463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0020"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: gur:Gura_0350
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33275"
FT                   /db_xref="GOA:A9WAP7"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAP7"
FT                   /protein_id="ABY33275.1"
FT                   /translation="MKYYLFIIFIILLGISGCQRTTTSLIQLDDLQPLPMPTPVTSPPL
FT                   RVSVASVISAQGTVQSYQPLLDYLSARLGREVTLIQRRTYTETNELIGRNEVDVAFVCT
FT                   SAYIDGRDRYGMSLLVAPQVNGETTYHSLLIVPTDSPARSMADLRGKVFAFTDPTSFSG
FT                   RVYPTALVQELGDSPESFFQDTFFTYSHDAAIEAVANGLADGAAVDSLVFHFALSRHPE
FT                   LREQVKVIHTSPPFGIPPVVVGPGVRPQLRAELQNILLGMADDPSPLAQTALESLGIDR
FT                   FVMIDDAAYASARLLRSQVGPVSP"
FT   gene            24460..25935
FT                   /locus_tag="Caur_0021"
FT   CDS_pept        24460..25935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0021"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase dimerisation and phosphoacceptor region; KEGG:
FT                   dsy:DSY4128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33276"
FT                   /db_xref="GOA:A9WAP8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017204"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAP8"
FT                   /protein_id="ABY33276.1"
FT                   /translation="MNAGFLPHQVVRWATTLWQIVGSVNIRAKILGIVLGLVVLMGVAA
FT                   TIEVRTLLEHTLTVQTHERSIAIARDVAARSTDLVLMRDYYRLFRLLQDTQENNPDLRY
FT                   AFIIDSEGTIVAHTFGSGFPVGLRDANTVTAQEHHRSVLLATNEGDIWDTAVPMFDGRA
FT                   GIARVGLSLAAREQTVAAVTGQLLITTIMAAAIGITAAAFLTWLLTRPILQLVALTKAV
FT                   ALGDFSQRARRWANDEIGQLTDAFNAMSEALAQAERERAEREHLRAQYVTQIITAQEEE
FT                   RKRIARELHDSTSQALTSLLVGLRSLADRHRSPEIAQQVDDLRSIVGQILNDLHALARQ
FT                   LRPSVLDDLGLAAALQRYVAECRARSGLIIDLALPGLDDFRLDPVVETALYRIVQEGLT
FT                   NIIRHAHASTASVVIERRADRVRAIIEDDGCGFDPNALHGDGHLGLNGIRERAALLNGQ
FT                   LIIESSPGSGTTLYVEIPLTTRHEECYEQHSLS"
FT   gene            25913..26554
FT                   /locus_tag="Caur_0022"
FT   CDS_pept        25913..26554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0022"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: sth:STH3220
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33277"
FT                   /db_xref="GOA:A9WAP9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAP9"
FT                   /protein_id="ABY33277.1"
FT                   /translation="MSSILLVDDHAVLRAGLRLLLDGQPDLRVIGEAEDVRTAVVQATT
FT                   LQPDLILLDLSLTGSSGLAAIPALRAVAPHSRILVLTMHDDEGYVRQALAAGANGYVLK
FT                   RAADAELIAAIRAVLRGELYIHPALTRQLLEDLLPQTPALNPWESLSEREREVLLLVAR
FT                   GYTAAEIAEQLSLSPKTVETYRTRGMEKLGLRSRAALVQYALNHNLLTPT"
FT   gene            26713..27669
FT                   /locus_tag="Caur_0023"
FT   CDS_pept        26713..27669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0023"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: deb:DehaBAV1_0265 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33278"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAQ0"
FT                   /protein_id="ABY33278.1"
FT                   /translation="MTRQPTIPLTPVSRRGLLGALVAGAGALAAASVQAGLPASTGKSA
FT                   DTIDVLSPEEALAAYEAEIARLRATKVSGTPLDHLERMRAELLRALAKPVAERRWVMVI
FT                   DLRACVGCHGCTIACVAENKLPPGVVYRPVIDEEIGRYPNVTRRFIPRPCMQCDNPPCT
FT                   GVCPVSATFTNEHGVVEVDYEQCIGCRACIAACPYGARTFDFGYTYTADTTDPGVMFGA
FT                   DQAATYETVTTFEYGKAHARRNLHDSPVGNVRKCHFCMHRVLNGQLPACVTTCIGRATF
FT                   FGDANDPDSLVSELIAKPNVMRLKEDLGTEPRVYYLQ"
FT   sig_peptide     26713..26820
FT                   /locus_tag="Caur_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.898 at
FT                   residue 36"
FT   gene            27681..28826
FT                   /locus_tag="Caur_0024"
FT   CDS_pept        27681..28826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0024"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG: det:DET0102
FT                   molybdopterin oxidoreductase, membrane subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33279"
FT                   /db_xref="GOA:A9WAQ1"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAQ1"
FT                   /protein_id="ABY33279.1"
FT                   /translation="MLKRLLYLAGTLGLLVGLWGLYDRLVYGHMHANYGSYVVWGLWVA
FT                   LYMFFAGVATGAFMLATLDLLFELPIFRGSGRMALWGSLVAMPAGLVAIGLDLGHMTRI
FT                   WKVYLQPNFGSVMAQLVWGYTIFLGIVVISLWLSLRPQPSRWLKPVMAIGLILAIFLSG
FT                   GIGALLGVNQNRISWHVSNLPAQFPVFNLTSGVALMLIAIGWFGPLRDPRRSQQLRILS
FT                   LAMVVLLLVKGYYLWSDVSQALYQNSSHGAAAINLVLFGPYGWAFWLLQLGLGMLIPLI
FT                   VLTMPVGQRGFAAGLMGVCVLIGLAVARANIIFPALSLPELQGLGEAFHGPHLSFTYSP
FT                   SLMEWAVTAGIVGAATIGFLLGTDRLPLFNRLPTEASSAAD"
FT   gene            28879..32139
FT                   /locus_tag="Caur_0025"
FT   CDS_pept        28879..32139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0025"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: deh:cbdb_A118 molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33280"
FT                   /db_xref="GOA:A9WAQ2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR037946"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAQ2"
FT                   /protein_id="ABY33280.1"
FT                   /translation="MKRQPETSTRTDQSMSRRDFLKTSALLGGGAALLGFGPLAGLARG
FT                   EAPALELPLVDAANSIQTVCLQCNTGCGLKVKLIDGVAAKLEGNPYSPWTMEPPLPFST
FT                   PISASGSIDGALCPKGHAGIQTAYDPYRLMRVLKRKPGTPRGGGQWITIDFDQAITEIV
FT                   EGGDLFGEGPVEGLRALYALKDAKLAKEMANAVNAILAARPEEKPALVEQFKRDFADHL
FT                   DVLIDPDHPDLGPKNNQFAFVWGRLKNGRGDLVQRFVKKGFGSVNANGHTTVCQGSLYF
FT                   TGKAMSEQFDPKTGKFSGGQKFYWQADLGNAEFVIFVGTNHFEANYGPTPQSPRITQGV
FT                   INSRLRYVVLDPRLSKLASKAWKWLPIKPGTDAAFAMAMIRWIIEQQRYNTRFLAAANK
FT                   AAAAANGEPSWTNATWLVKVKDGVPGKFLRASEIGLTTVVEETDAEGKKTKAYVTADGT
FT                   RFSFDPFVALVNGVPTPIDPNDPEAAPVIGDLLVDTELNGIAVKSSLQVIYEAASTHTI
FT                   EEWAAIADVKAEDIIEIAYEFTSHGTRAVADIHRGPSQHTNGFYTNFAFYTLNALIGNF
FT                   DHRGGLIKPTTYDRLGTKAKGPFEVEKMTNGANVPFGIDLLRTNTAYEKSTLFNGYPAR
FT                   RPWFPLATDVYQEDIPSMGDAYPYQIKVAMFYMSAINYALPAAQTTIEILADPKKIPLI
FT                   ITSDVMVGETSTYADYIFPDLSFLERWEFHGSHPSVPWKVENIRQPAISLPNWPTVKVF
FT                   GEEIPLSFEALVLAIAERLELPGFGPNGFGEGIPFTRPEHLYLKLAANIAFGEKEDGSD
FT                   GVPPADYAELEVFRRARRFLPPSVFDEAKWRAAIGNDEQLWRQTVYVLNRGGRYQAYEK
FT                   GWKGDLAGNPYAKQINLYQEKTATTINSMTGDHLIGYPTYIPAGLAADGTPIVDEGYDL
FT                   HLVTYKEAMMAKARGIADYWLLALMPENAILINRLDAERLGLRNGDRVRISSASNPDGV
FT                   WDLQNGTRKPMIGKVKVIEGIRPGVISFPLGWGHFASGASDIVIDGVTIPADPRRAAGI
FT                   HANAAMRVDPVLGNVTLSDLVGGSAVFYDTKVKLERVG"
FT   sig_peptide     28879..29016
FT                   /locus_tag="Caur_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.492 at
FT                   residue 46"
FT   gene            32700..33029
FT                   /locus_tag="Caur_0026"
FT   CDS_pept        32700..33029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0026"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mca:MCA0351 carboxymuconolactone decarboxylase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33281"
FT                   /db_xref="GOA:A9WAQ3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAQ3"
FT                   /protein_id="ABY33281.1"
FT                   /translation="MSQLPEAYRTFLQDYPTVAGVYEQLGAAAAEAGPLDAKTRELVKL
FT                   AMAAALGSEGAVHSHVHRALAAGATAAEIEHTLILGVTTLGFPTMMMALRWARTALHQA
FT                   TSPQS"
FT   gene            33043..33672
FT                   /locus_tag="Caur_0027"
FT   CDS_pept        33043..33672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0027"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="KEGG: rca:Rcas_2175 formylmethanofuran dehydrogenase
FT                   subunit E region"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33282"
FT                   /db_xref="GOA:A9WAQ4"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAQ4"
FT                   /protein_id="ABY33282.1"
FT                   /translation="MSVDDLIDTTSLELLVAPAPLADFLRQSSAMHRHLCPRQVLGARM
FT                   GMYAGELLGLTLPQKNKRLYTFVETDGCFADGVSVTTGCWLGRRTMRLMDEGKVAATFV
FT                   DTQTGQAFRIAPRPNVRDLARQYAPNARSRWHAYLIAYQLMPLTDLLIAQPITLTVDLK
FT                   AIISRNGLRTTCDHCGEEIINAREVIRDGQTLCRTCGGEGYYTITG"
FT   gene            complement(34058..34501)
FT                   /locus_tag="Caur_0028"
FT   CDS_pept        complement(34058..34501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0028"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   rrs:RoseRS_2111 iron-sulfur cluster assembly accessory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33283"
FT                   /db_xref="GOA:A9WAQ5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAQ5"
FT                   /protein_id="ABY33283.1"
FT                   /translation="MTTVDLNQITFQPATPQPLLTISEAASSRLLKMMQEKELEGYALR
FT                   VFVAGGGCSGLQYGMTFDDEVREGDNEFYAGNLRVLVDPISAQYLFGASIDFVDTLMGG
FT                   GFKIDNPNAVSSCGCGHSFRARDTDYSEDDEDAPVGGCSACGM"
FT   gene            complement(34623..36386)
FT                   /locus_tag="Caur_0029"
FT   CDS_pept        complement(34623..36386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0029"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: rca:Rcas_4304 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33284"
FT                   /db_xref="GOA:A9WAQ6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WAQ6"
FT                   /protein_id="ABY33284.1"
FT                   /translation="MAARSLMRILLVGLGLTLATIISGALVTISASATVCSSWPLCLEE
FT                   LVQSQNPLVWISLLHRLFVALALLAVFAGLVAVWRSSDTAGLPRITAGIAAAFFLLQAL
FT                   AGALLVWGVPAMVADVWHLSGALLAFGAQSLTIALIAVPTPATPERLAGRAAQMQRRLR
FT                   SLAWWSAAAAGVAALAIGARSVVPGFGMMTAVPTNSVSAVGFAALLSVWMALEARRRLR
FT                   PVAETPALALALPRYSLFLPALALLALLGAFIPVAGHLISLTAIALLWAATIIAAVILQ
FT                   RVPFSFATATAGVRSQPAWRTVVADYISLTKPKVISLLLVTTLTTMFITEAGLPSWWLV
FT                   IWTMIGGYLAAGGAGAINCAFDSDIDINMGRTSRRPVPSGRISRRAAFIFGLILSVLSI
FT                   IVLWVFTTPLAAFFALLGIIYYAWFYTGWLKRSTWQNIIIGGGAGAIPPLVGWTAVTGS
FT                   VSLMAVVLFAIIFYWTPPHFWALALVKQKDYARAGVPMLPVVAGEAETRWQILVYSAIM
FT                   VAVSLLPVAIGAMSWIYLIGAVVLGLRFMRDAWAVWRVGDQAAIWGLYKYSLLYLALVF
FT                   AAMVADRLIIG"
FT   sig_peptide     complement(36279..36386)
FT                   /locus_tag="Caur_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.354 at
FT                   residue 36"
FT   gene            complement(36402..36617)
FT                   /locus_tag="Caur_0030"
FT   CDS_pept        complement(36402..36617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33285"
FT                   /db_xref="GOA:A9WAQ7"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAQ7"
FT                   /protein_id="ABY33285.1"
FT                   /translation="MIAWLIFWLAAIVAIGGQIPLILAAWRLYRQPFQQAPANVPRSDG
FT                   RADLGWTILTALATLALFGAAYLALP"
FT   gene            complement(36999..37940)
FT                   /locus_tag="Caur_0031"
FT   CDS_pept        complement(36999..37940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0031"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; response regulator receiver; KEGG:
FT                   rca:Rcas_3221 response regulator receiver modulated
FT                   diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33286"
FT                   /db_xref="GOA:A9WAQ8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAQ8"
FT                   /protein_id="ABY33286.1"
FT                   /translation="MSEEVHLPTVLFADDDPHIRTLLSDTLTQAGFAVLAAEDGLSLIR
FT                   IAQEQLPDIILVDLMLPGVDGYEAIRQLRNDTRTAHLPIIIVTARANPSDVVIGFDTGA
FT                   DDYITKPFNEAELVARIRSLLRRITKRPVRNPLTGLPGNVLIGEEIRYRLQRGEPFTLL
FT                   YTDINEFKAFNDKYGFARGDQVIRLVAELCEQAQQFFAPHAIFVGHIGGDDFVLLCPST
FT                   VAADLARWLVDQFEQAALSLYDEEDRQRGYLVGYDRAGNLRHIPLATMAVGGVSSRLDA
FT                   TVDELSREAAAMKHAAKVFGTSAVIIDHVRLR"
FT   gene            complement(37933..38877)
FT                   /locus_tag="Caur_0032"
FT   CDS_pept        complement(37933..38877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0032"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rca:Rcas_3224 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33287"
FT                   /db_xref="GOA:A9WAQ9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAQ9"
FT                   /protein_id="ABY33287.1"
FT                   /translation="MRAIFFNGDLQYTTDYPDPVRQPGEALIRPHLVGICNTDLEITRG
FT                   YMNFRGVLGHEFVGTVVASDDPSWQGKRVVGEINAACRRCPTCLRGDVSHCPQRTTLGI
FT                   YRRDGAMADLFTLPEACLHEVPASVSDEAAVFTEPLAAALEIVEQSHIRPTERVAVVGD
FT                   GKLGAMIVQVLRLTGCELTLIGRHPERWDVYRQQGITCVRSTDLPGTLFDVVVDCTGNP
FT                   SGLNIARQIIRPRGRLILKSTFAAETQLNLSMVVVDEIQLIGSRCGPFAPALRLLERGL
FT                   IATTPLISARYPLAEGLQAFAAAPGQLKVLLSV"
FT   gene            39515..40447
FT                   /locus_tag="Caur_0033"
FT   CDS_pept        39515..40447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0033"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: rrs:RoseRS_3920
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33288"
FT                   /db_xref="GOA:A9WAR0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WAR0"
FT                   /protein_id="ABY33288.1"
FT                   /translation="MRILFLGSPSFAVHALEALVAAGHEIVGVVTQPDRPAGRDRRLTP
FT                   PPVKIAAMAHNLPVLQPETLRDPTVVETLSALQPEVGVVAAYGEILRRAVLSIPPLGYL
FT                   NIHPSLLPLYRGPTPVAGAILAGETVTGVTIMLLDPSMDSGPILAQAVVDLPPTARAGQ
FT                   LTDELFRIGADLLVQVLPRYARGEIEPRPQDHSRATVTKMLKKEDGRIDWSLPAIVIER
FT                   MTRAYDPWPGAYTFWRGQPLRIIKAAVASADGTNVPGTVIGRSGSGHPLVQTGSDALEL
FT                   IEVQPASRRPMSGSAWLAGVHADNIRLGE"
FT   sig_peptide     39515..39562
FT                   /locus_tag="Caur_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.667 at
FT                   residue 16"
FT   gene            41293..41727
FT                   /locus_tag="Caur_0034"
FT   CDS_pept        41293..41727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33289"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAR1"
FT                   /protein_id="ABY33289.1"
FT                   /translation="MPFFKDEAELRQILGELYDRVKCDAQIAPRICEGRIVIQFRYEEP
FT                   HGVVTIDAAHPPTQPGAFCDVFWGEVDLKPDVEMSMKADIAHQFWHGKINLMTALARRQ
FT                   IIAKGPIPKILKLLPAVEPMYTLYPRMLREMGREDLVLTR"
FT   gene            41762..42337
FT                   /locus_tag="Caur_0035"
FT   CDS_pept        41762..42337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33290"
FT                   /db_xref="GOA:A9WAR2"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAR2"
FT                   /protein_id="ABY33290.1"
FT                   /translation="MYERGAADAERGEFNPFYYQHYYYYRQGYDSVRRRNRPGINRVGI
FT                   LLISGIGVVGLVALVWLIGRIGPAVVAQPVASPTTVATTPQPSPIPPTPTPLPSPTPIP
FT                   TEAPPTLQVGGRAVVVNVGEAALRLRASPGLTARVIARIPAGREVVLLEGPIEVDGYTW
FT                   WRVEVGSQSGWCAVATPDGLTFLEPVAP"
FT   gene            complement(42729..43412)
FT                   /locus_tag="Caur_0036"
FT   CDS_pept        complement(42729..43412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0036"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   rca:Rcas_2771 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33291"
FT                   /db_xref="GOA:A9WAR3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAR3"
FT                   /protein_id="ABY33291.1"
FT                   /translation="MFAYVVYGILYLIINFFRLIGWWRWSISGIERLPPREQGGMILVM
FT                   NHINWVDIPAVGAMLPFRYRLSWLAKIEIFSHPLAGWFFRNMDVIPIRRGKRDLAALDA
FT                   AAQALRNGAVLLIFPEGHRSRNGILQPGRGGAVRLAMQAGVPLVPMAITGTEHGFRGTL
FT                   LRKPVHITIGEPYRVEPLPDNKIPADVMEQLTNEMMLKIAAMLPPAQRGPYAALLEAAA
FT                   VKEQV"
FT   gene            complement(43420..43860)
FT                   /locus_tag="Caur_0037"
FT   CDS_pept        complement(43420..43860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33292"
FT                   /db_xref="GOA:A9WAR4"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAR4"
FT                   /protein_id="ABY33292.1"
FT                   /translation="MYALHPATVHIPIGLLLASSLFTFIALRTGRMQWEQSSFHCLIFG
FT                   LLGAVIAMVSGLIDAARQVTSPQIAPDDPVIMWINGHAAASLAATLCYGRVWLMRRRQP
FT                   GLLTDSTQRNAYLGWHVAGIVLLVLGGWLGGRLVFEFNLGRL"
FT   gene            complement(43869..44489)
FT                   /locus_tag="Caur_0038"
FT   CDS_pept        complement(43869..44489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0038"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: mxa:MXAN_2845 conserved
FT                   hypothetical protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33293"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAR5"
FT                   /protein_id="ABY33293.1"
FT                   /translation="MTSPHYPVPAGTARTELIVRGSRFIAQLFPTPTVDAAREAIAMVR
FT                   AAMPDATHHCYAYLVGYGQSTIAGMSDDGEPAGSAGRPMMAVLRGADLGDVTVVVTRYF
FT                   GGTLLGIGGLVRAYSDATRAVLEIVPRTQRVIYQRIIVHLQYSDYTAIRRLLEAHAAVI
FT                   VEEVFAVDVVITADLPTDHVAVVNHQIGEISAGRARLETAPMV"
FT   gene            complement(44486..45361)
FT                   /locus_tag="Caur_0039"
FT   CDS_pept        complement(44486..45361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33294"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAR6"
FT                   /protein_id="ABY33294.1"
FT                   /translation="MRTFISGIPTPKPALFFSRAARDQAVIFDPACAPLLRPVVDRESL
FT                   QPWYTPTGERWLLTLPHGYSQRLGINSFADLVRHHPGLQRHLREYADDPEPYWWELPAA
FT                   ATAVLTAPTPRICIGDGDQVCLSWDAGQAVVLAPVRMVAPADHLTLALLASTKGKQMIR
FT                   QAHDTFTLPPVPTAIGGRLAELAAQAVTMAHERHTLSREFARRLLADFGPPGSTLSPLL
FT                   ERWWELEFRDLLAEVARALRNPIPEPFQPFWLARHTEGRARYYTLTAEIAALEAAIDEI
FT                   VHPLWPEELP"
FT   gene            45522..49011
FT                   /pseudo
FT                   /locus_tag="Caur_0040"
FT   gene            49439..50515
FT                   /locus_tag="Caur_0041"
FT   CDS_pept        49439..50515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0041"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase; KEGG:
FT                   rca:Rcas_1546 3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33295"
FT                   /db_xref="GOA:A9WAR7"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAR7"
FT                   /protein_id="ABY33295.1"
FT                   /translation="MQAVIAVLPGDGIGPEVVAEGVKVLQAIARRFGHQFTFHEALIGG
FT                   CAIDATGEPLPAATITLCQSADAVLLGAVGGPKWDDPQARVRPEQGLLGIRKALGLFAN
FT                   LRPVRIYPQLINASPIRPERLQGVDLIVVRELTGGIYFGEKRRERTADGEWASDLCIYT
FT                   EEEIVRVVRVAARLARQRRGKVTLVDKANVLETSRLWRSITTRLMQTEFPDLQFETMLV
FT                   DACAMHLIRRPADFDVIVTENMFGDILTDEASMLAGSMGMLPSASLADGRLGLYEPIHG
FT                   SAPDIAGQGKANPLATILSVAMLLRYSLDLPAEADCVEAAVASVIERGIVTADIAVPGQ
FT                   AAYSTAAVGDAVVAAIAA"
FT   gene            50585..50992
FT                   /locus_tag="Caur_0042"
FT   CDS_pept        50585..50992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0042"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; KEGG:
FT                   rca:Rcas_2998 cobalamin B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33296"
FT                   /db_xref="GOA:A9WAR8"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAR8"
FT                   /protein_id="ABY33296.1"
FT                   /translation="MERKIRVLVAKPGLDGHDRGAKVIARALRDAGMEVIYTGLQQTPQ
FT                   MIVEAALQEDVDVIGLSILSGAHMTLLPKVMQLLREQGMTDVLVVAGGIISDEDAEILK
FT                   REHGIAEVFGPGSSTQAIIDFIRSHVELTRG"
FT   gene            50996..51946
FT                   /locus_tag="Caur_0043"
FT   CDS_pept        50996..51946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0043"
FT                   /product="LAO/AO transport system ATPase"
FT                   /note="TIGRFAM: LAO/AO transport system ATPase; PFAM: ArgK
FT                   protein; SMART: AAA ATPase; KEGG: rrs:RoseRS_2025 LAO/AO
FT                   transport system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33297"
FT                   /db_xref="GOA:A9WAR9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAR9"
FT                   /protein_id="ABY33297.1"
FT                   /translation="MSEHELVTRLRNGERRALARAISLVEQGGPTARALLAAAYPYGSA
FT                   HRVGITGPPGAGKSTLVTALAQEWRKRGVPVGIVAVDPSSPFSGGAVLGDRIRMQALGG
FT                   DPGVFIRSMASRGRMGGLARATADAVTLIAAAGFPVILIETVGAGQDEVDIAQAADTTI
FT                   VVEVPGMGDDVQSIKAGMLEIADVFVVNKADRPGVDQTVRQLRTMLNLGAPPVDGWMPP
FT                   VLTAIATTGEGCAQIVDAVEQHRQHLIASNSQSQRALSAAERELTAAVQELVLERLRGS
FT                   RWSELVQQIAARQRDPYAAANELLTADVIVRDGEE"
FT   gene            52177..53520
FT                   /locus_tag="Caur_0044"
FT   CDS_pept        52177..53520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0044"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: rca:Rcas_1218 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33298"
FT                   /db_xref="GOA:A9WAS0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAS0"
FT                   /protein_id="ABY33298.1"
FT                   /translation="MQVNPTIFKAYDIRGIYPTELNEEVAYLIGRAFVTFLGAETVIVG
FT                   RDMRTSGPALFDAVTRGIMDQGADVADIGMVSTDQYYFACTQLGFPGMMVTASHNPKQY
FT                   NGFKMVRRMPYLLSGDEGIQDLRRLVESEAFPTPTRRGQRREYDFKEQFVQKVLSLIDV
FT                   DAIKPLKVIVDTGNGMVGPILQEVYARLPIQLTGMYLDPDGTLPNHGLDPLMPENRAEL
FT                   QQRVKDEGADIGFAFDGDGDRFFAIDDRGEFISGDFLTAILGRYLLEKEPGAKILYDVR
FT                   ASWAVPDEVRAAGGVPLVERVGHAFIKRRMANEDAIFAGEVSGHYYFKAFAFADSGIIP
FT                   SLYLLEMLSKRGVKMSELLGRLESRYFISGEINSRVSDVAAKLNEIAERYSDGKIERID
FT                   GVSVSYDTWHFNVRGSNTEPLIRLNLESIASREEMEAKRDEVLAVIRS"
FT   gene            53777..54850
FT                   /locus_tag="Caur_0045"
FT   CDS_pept        53777..54850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33299"
FT                   /db_xref="GOA:A9WAS1"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAS1"
FT                   /protein_id="ABY33299.1"
FT                   /translation="MSVKKIGILVGREWSWPPAYIEEVNRRNAGVRAEFIKLGGTRMAE
FT                   FCDYDVIIDRISHEIPYYRTFLKTAALSGTRIVNNPFWWSADDKFFGASLATALGIPHP
FT                   RTVALPSHSYIEGIVEESLRNLQYPIPWKEHVDYVGGFPVILKPAWGGGFKKVYKVHSY
FT                   EELWRAYNETGIECMMLQEYIAWEKYVRCIVIGRRHIMTIKFDANAPWPHRYFRDDNYL
FT                   TPEEGLQVVEGALKLNQALGYDMNTVEFAIRNGVAYAIDFTNPAPDFDVNSLTPHYFDW
FT                   VVRTMADFTIELALQGRAKPEEFAWHRLLNGPMAPATSPSAPVTTDSANNDPPAAEASA
FT                   TPKRRRTTRKKTAEEPS"
FT   gene            54907..56289
FT                   /locus_tag="Caur_0046"
FT   CDS_pept        54907..56289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0046"
FT                   /product="protein of unknown function DUF407"
FT                   /note="PFAM: protein of unknown function DUF407; KEGG:
FT                   rrs:RoseRS_2616 protein of unknown function DUF407"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33300"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAS2"
FT                   /protein_id="ABY33300.1"
FT                   /translation="MTLAQAIADYHALLEPTLAVESWQRLTAEMRARRLYFGERPLATV
FT                   LRPRLITASQYELLRRGTQQVAEAARAIVAAALDSSEAGQAVREVLMLTPLEERLIEMH
FT                   PGYLEPSAHSRMDTFLTVDGSSLQFVEYNAESPAAIAYEDLLAQAFLAMPVMQEFAKRY
FT                   PILPLPARQYLLRTLLDCWRAAGSPGHEPQVAIVDWHGVPTATEFEMFRQYFVEHGLPA
FT                   VICAPQDLSFRDGQLLAPTPDGGEMPVTIVFKRVLTSEFLTHYGEEALSHPLVQAYAAG
FT                   ACVIVNSFRAKLLHKKSLFALLSDERFHDPLSADQRAAVAAHVPWTRVVRPGTTTYQGE
FT                   QIDLLSFARANRERLLLKPNDEYGGKGITIGWEVSADEWDAALQAALSSPFVVQERVTI
FT                   AYEPYPALIDGKVVIGERLVDSDPFLFGTEVNGCLCRLSTVTLLNVTAGGGSTVPVFII
FT                   DE"
FT   gene            56310..57092
FT                   /locus_tag="Caur_0047"
FT   CDS_pept        56310..57092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0047"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   rca:Rcas_2937 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33301"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAS3"
FT                   /protein_id="ABY33301.1"
FT                   /translation="MLVYDALGREIELAGTPQRIVSLVPSVTEWLFSVGAGERVIGITD
FT                   YCIEPAAALQHLPRLRGTKNPDRAAIIALQPDLIIAEQEENRERDVQALTAAGLAVYVT
FT                   AIRSVADAMTQLAALAEVLDVTDGAAPITQAIEQTVTAPPPPSRRVLALIWRDPWMAIG
FT                   RDTYAGDLLRLSGGFNVAATLPGRYPRAALADFLALDPDIILLPNEPYPFSERDLPAFN
FT                   AVAYRGRIVLCDGMALTWPGPRTATAITTFRRILEQTT"
FT   gene            57089..57967
FT                   /locus_tag="Caur_0048"
FT   CDS_pept        57089..57967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0048"
FT                   /product="protein of unknown function DUF547"
FT                   /note="PFAM: protein of unknown function DUF547; KEGG:
FT                   gur:Gura_3347 protein of unknown function DUF547"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33302"
FT                   /db_xref="InterPro:IPR006869"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAS4"
FT                   /protein_id="ABY33302.1"
FT                   /translation="MNPFIRLREAVIDTVLSINEQQVLNAGTGTVPAPTDDGVALAAAL
FT                   RQAMQQFKAQAMDEEGKLVAYQRLRNDPAYLAYRSELTPQLQRFDPASLPDRATRLAFW
FT                   INLYNALVIDAVIAFGITTSVADQWSGLRFFRAAAYQIGGLRCSLDDIEHGILRANRGH
FT                   PFIPGPQFAASDPRLGWIIDPPDPRIHFALNCASLSCPPIGVYRAEQIDQQLDLALRAF
FT                   VAADVAIDPTRAEIHLSRIFDWYREDFGGTDGIIQLLRQALPADERRAWLLQARQARLI
FT                   YRPYDWRLNLA"
FT   gene            57978..58508
FT                   /locus_tag="Caur_0049"
FT   CDS_pept        57978..58508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_0093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33303"
FT                   /db_xref="GOA:A9WAS5"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAS5"
FT                   /protein_id="ABY33303.1"
FT                   /translation="MTDDWRKQSLKELYRLTGQIFSQIPALARLWGSAYRALNFDEIPF
FT                   TPFRKPLHEARLALITTGGVHLRDQPPFDMADPRGDPTYRRIPATTPLSDLTITHDYYD
FT                   HSDAERDLNILFPLDLVRTLVQRGIIGSLADCYGFMGHIEPPHLTTLLQQTAPEVATFL
FT                   KQEQVDAVLLTPA"
FT   gene            58527..58823
FT                   /locus_tag="Caur_0050"
FT   CDS_pept        58527..58823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0050"
FT                   /product="putative reductase"
FT                   /note="KEGG: bbr:BB4888 putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33304"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAS6"
FT                   /protein_id="ABY33304.1"
FT                   /translation="MGLIARIIEAAGISTVCIVSLKPIAEQVRPPRTLHLAWPFGHPLG
FT                   EPGNRAQQLSVLHAALQALATAEPGAIIEPGWRWRREIYTPPPDWLGEGKERL"
FT   gene            58908..59567
FT                   /locus_tag="Caur_0051"
FT   CDS_pept        58908..59567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33305"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAS7"
FT                   /protein_id="ABY33305.1"
FT                   /translation="MVNKDHPLSIGRTIRHAIFFNARNWQSGRPIMDELLQSVNELFAM
FT                   LTERNVRYTLVGGIAMLQYIQGRNTEDIDIVISITSLRKLPEVTITQKDIFFARGMYRQ
FT                   LQIDFLLTKNPLFAHIQKHHVVELPFAERTIPTATVRGLILLKLYALPSLYRQGDFARV
FT                   GLYENDIATLMFAYAPPIDDILHELSAFISQPDRDIAQGIVHNLEQRILRFKALRG"
FT   gene            60158..61117
FT                   /locus_tag="Caur_0052"
FT   CDS_pept        60158..61117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33306"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAS8"
FT                   /protein_id="ABY33306.1"
FT                   /translation="MEGTTNPTTAPTAQLAPAEAIDPRPLDTAGMEECSIISDSDLESI
FT                   VNSVPIYSQPTYAEYGTLGCTYTFEGDKDVSIRIELDSPGRQVYDSVMQYVDVSADAEP
FT                   VNIGDIAVIKEKDGLVSLDAVLNGWYVSLSTRGFPRASALTLAQWLTGRLIPRPDDIVA
FT                   EQPTATAPGPVSGSLIDMQVTIESPAEAAGVTTLAEIKAIGFMGFSMCSRPYNVPFIVA
FT                   FNAPPGTQPPTPVGVFSITAEAGVTPGQPSPATIIIGIGPSDAAEETLWQGTIVVAADG
FT                   TSGTFEVPGQVKVPGRACLRRERGTTISVILVWRGIEA"
FT   gene            complement(61181..62830)
FT                   /locus_tag="Caur_0053"
FT   CDS_pept        complement(61181..62830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0053"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methionine biosynthesis MetW protein;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   vha:VIBHAR_01393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33307"
FT                   /db_xref="GOA:A9WAS9"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAS9"
FT                   /protein_id="ABY33307.1"
FT                   /translation="MADAETIRSYDQLAREQAAFQRHLQPTAIYRLVETFFHPGRPTID
FT                   IGSGSGRDVAWLNQHGYQAIGLEPSAGMIAEARAAYAGIEIRQGALPDLAGIADASFDN
FT                   VLCVAVLMHLPAAELIGAVINLARILRPGGRLIVSYRTPPPEGERAHDGRLYTVIPPAR
FT                   LMLLLESSGLQILFSEDLPDPHRPSIRWFNMVAEKSDRDVSRGLERVGSVLAHDRKTAT
FT                   YKLALLRALCIIARNAFNLVEWSSDVVYVLLRAIATQWLIFYWPLLTSSEFIAQIRGEH
FT                   PLSPKPIAFRPAITSLAKQLGGAAGLYNVLRILEEDPHRYDDILKLIANTIRKGPVTYS
FT                   GSIHSPIFSYRPGKSDTFGWVAVPIDIWLDICRFNHWIEDSIVLRWAYLTDELNRTADP
FT                   GRYLSLLVAKPLHERDTQEVRQALNRSPELFCVWTGQRLGHGYEVDHVIPYSVWGNNDL
FT                   WNLLPAHPRINQTKRDALPARSILLARREAIIDYWQRYAQIDVFQPRFAVQIHRALGCN
FT                   LRHADWPKLAFAGLEEVVERTAIVRGLPRWSP"
FT   gene            complement(62849..64306)
FT                   /locus_tag="Caur_0054"
FT   CDS_pept        complement(62849..64306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0054"
FT                   /product="Domain of unknown function DUF1957"
FT                   /note="PFAM: glycoside hydrolase family 57; Domain of
FT                   unknown function DUF1957; KEGG: rrs:RoseRS_3734 glycoside
FT                   hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33308"
FT                   /db_xref="GOA:A9WAT0"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR015293"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037090"
FT                   /db_xref="InterPro:IPR040042"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAT0"
FT                   /protein_id="ABY33308.1"
FT                   /translation="MPIAFVIEVHVPYLRHPGRQPIGEERLHAFTAHTLIPLLDLIGEL
FT                   QRHSLPLSITLACSPIALEQWRDPVVHKHFVQWLEGRITHHQNELSRFEHEGNQHGAYL
FT                   ARFYLDWDRQLLRSFTIRYQRNPLGRLQELVAAGLITPLCVPASYAILPFLGHEGMVRA
FT                   QLEHGLLYISRYLKRPEGLWLPGSAWRDGLERIILELDLRYVIVDPSNVQLQHGHLPGW
FT                   LVPRRLAAIGVEADLARHIWSVELGYPGDPLYRNPADPTGYTANGADAPQPYDPYDALR
FT                   RAQEHANHFVDQLLFRLSQLPSETTLVVPIDARLWSRNWFEGPTWLQAVLTRCATDPRL
FT                   RLTQPGSLLHHLSSNDTVVLQATAQADASATSWQSPFTDHYRQSLYEAERRFAELVTYY
FT                   PAAEGLRERVLTQAARELLLAEMSDWLMESDPGWQRYLDRFDHLLLLARQESLSATDLF
FT                   ALEQIESHDSIFPVLNYRLFGEKHHRS"
FT   gene            complement(64394..66088)
FT                   /locus_tag="Caur_0055"
FT   CDS_pept        complement(64394..66088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0055"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   rca:Rcas_1479 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33309"
FT                   /db_xref="GOA:A9WAT1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAT1"
FT                   /protein_id="ABY33309.1"
FT                   /translation="MTGGSGRRIGRYELIEELGRGGMARVYRARDTQLQRIVALKVLAA
FT                   QLSMDAEFIKRFEREARTAANLRHPHIVTVYDIGEDQGLHYIAMEYIDGRPLHAILEQY
FT                   GSLGLKYAIAILEPIALALDYAHQAGAVHRDVKPHNILIDRNGRVVLTDFGIAQTPEAD
FT                   EQRLTRTGVFMGTPEYISPEQAEARRVDGRSDLYSLAVVAYEIIAGRVPFSGATPQLIV
FT                   AHAQLPPPPITSFAPDLPTDLDLVLTRALAKRPERRFQTGAAFIAALRDIAERNGIVPA
FT                   TTAELVALLNPSLQVESTIPGLVQSSATPKPVAPPLLSSTPTASRQPKQPDGLAVNQDQ
FT                   RATPLPPAPVIPRRHLPEPAVAEPKPRNNRSDQWPFFIIGGLLFIIVGALVVLIMRNFD
FT                   DSDAPTPTPIVPAGPSPTLAVPLPTATATFTAVPTLTPTLTPSVEPTPTPVLPTPVPPT
FT                   SPPPPPPPPPPSPTPTVTATPTETVTPTVSLTPTEPATPTETATPTETATPTETATPTE
FT                   TTTPTVSPTPTETATPTVSPTPTETTTPTVSPTPTETATPTVSPTPT"
FT   gene            66229..66888
FT                   /locus_tag="Caur_0056"
FT   CDS_pept        66229..66888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0056"
FT                   /product="transcriptional regulator domain protein"
FT                   /note="PFAM: Forkhead-associated protein; transcriptional
FT                   regulator domain protein; KEGG: rca:Rcas_1480 putative two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33310"
FT                   /db_xref="GOA:A9WAT2"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAT2"
FT                   /protein_id="ABY33310.1"
FT                   /translation="MQSAPAPQLIVKRSNGDYREIVWDQPVITVGRDGANDIIIDHPLA
FT                   SRRHARFERTDEGFFIRDLDSTNGTFLNQERLIGTRSLHHSDQIMIADTVIIFNDPAAT
FT                   MKGTLDPTLLRAVRAEIRVDEPTKSVYIRGELLSPPLTVKEFQLLALLYRRQGEVVSKE
FT                   EIANQVWDYAIFDYNAIDALVYRLRQRIEPDPSKPRYLITQRGFGYKLIVAPELES"
FT   gene            66922..68229
FT                   /locus_tag="Caur_0057"
FT   CDS_pept        66922..68229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0057"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   rrs:RoseRS_3657 3-phosphoshikimate
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33311"
FT                   /db_xref="GOA:A9WBA4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WBA4"
FT                   /protein_id="ABY33311.1"
FT                   /translation="MKGITLTAPKRLRGVIEVPGDKSISHRSVLFNAIATGSAHITHFL
FT                   PGADCLSTVACIRALGVTVEQPAERELIVHGVGLGGLREPADVLDCGNSGTTLRLLAGL
FT                   LAGHPFFSVLTGDASLRSRPQRRIVVPLRAMGAQIDGRDDGDRAPLAIRGNRLRGGHYE
FT                   LSIASAQVKSALLLAALNAEQPLTLTGRIDSRDHTERMLAAMGLEITVTADQITIQPPS
FT                   EATAPTALSLRVPGDPSSAAFWWVAAAIHPDAELVTPGVCLNPTRIGAIEVLQAMGADL
FT                   TVMNERLEGSEPVGDVVVRSSSLRGTTIAGTLIPRLIDEIPVLAVAAACASGETVIRDA
FT                   QELRAKETDRIATVAAGLSAMGAVVEPTADGMVIVGQPGQLQGTTLNSFHDHRLAMAWA
FT                   IAAMVARGETTILEPAAAAVSYPEFWQTLAMVQEAA"
FT   gene            68226..68810
FT                   /locus_tag="Caur_0058"
FT   CDS_pept        68226..68810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33312"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBA5"
FT                   /protein_id="ABY33312.1"
FT                   /translation="MNDGFTFTVEIFTPTLLCTGSYTLPMYRRVSDALNNRLSRFVNLH
FT                   DVSIAPLWRPQQAQRVQHALVAWGDALLVAVLAEPEPPPDYHPVAPPRETHPVMFFTAE
FT                   FAVRAEMYKRPDMDLEEMLSGLTDDFIPLRNVTIFPINGGAPLHRSFVCLAQRAIQVLY
FT                   SVRGHTPADHHSEPPADTTATVPESNTNAEA"
FT   gene            68831..69814
FT                   /locus_tag="Caur_0059"
FT   CDS_pept        68831..69814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0059"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; KEGG:
FT                   rca:Rcas_2654 UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33313"
FT                   /db_xref="GOA:A9WBA6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBA6"
FT                   /protein_id="ABY33313.1"
FT                   /translation="MRILVTGGAGYIGSITSAELIRAGHEVIVIDNLYQGHRAAVPPEA
FT                   TFIQADLANRQELSEIFAAYPGIDGIMHFASYTLVGESMEKPMLYLRDNVTNAGNLLEV
FT                   AIAAGVRRFILSSTANLFDQPERIPIAEHERIVPGSPYGESKFFIERMLHWMARIYGMR
FT                   YACLRYFNACGDTPERGEDHDPETHLIPIVLQVALGQRPHVTIFGDDYPTRDGTCVRDY
FT                   IHVLDLASAHILAMEALDRLGERRYNLGNGQGFTVREVIETARKVTGHPIPAVVGPRRP
FT                   GDPAVLVASSETIRAELGWQPRFPDLESIIASAWEWHRTHPHGYDD"
FT   gene            69804..71756
FT                   /locus_tag="Caur_0060"
FT   CDS_pept        69804..71756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0060"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   rca:Rcas_4117 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33314"
FT                   /db_xref="GOA:A9WBA7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBA7"
FT                   /protein_id="ABY33314.1"
FT                   /translation="MTTNPVSVPSLPRFYGHYEVEQQIGRGESSRVFRAHHRQIKEHKV
FT                   ALKVLLSQEAARIKRFEQEAQIAARLRHPHISRLLDYGIQNPFHYAVFEYIPGSSLRDL
FT                   IKGHDQRLPPDQVMAYFQQIADALDYAHSLDIIHRDLSPGNILIDTENHKAYLIDFGIA
FT                   RNPDQSLTSTNVTMGTPGFIAPECMHSATNATHLSDIFSLGVILFLMLTGEKPWYEMPQ
FT                   PGSSLDPFLRIRTLADTGVKLPSEVDRIIRVMLAFEPAHRYTSAGAAAIDFVAVMQRHL
FT                   SVTQIQSSEPVKVDQTATRRKHIVLIEPNEVELALSGSLFREPLERALMRARQLDETTI
FT                   KSLIEQWAKRQRFYQPHLGRIAQIQDTKHHNVFFFQLRLLIEQRLDAGTEEEPDSQQKQ
FT                   IPPQRELERWQVELPPPKDFQKHPGGRVIVPGSERVVTCPSCKGHGVHICAMCKGSRRV
FT                   TVTDQAATTTENAADSSSVARQRVVPCPECQGRGSLPCKRCDSFTRVIQRKLIEWSRWP
FT                   VEDQAHTDLPDVDEMWLRRTCKAELVYKKRVDRIPKEWLEITEIKEILEQRRKNLNNDS
FT                   RIVLAELQIHFIPLTEVTLDLGKQGPGERLAIYGFEHNIPPDWRFLHWERIICLSVIAL
FT                   LSIFLMISLAFIING"
FT   gene            72070..73017
FT                   /locus_tag="Caur_0061"
FT   CDS_pept        72070..73017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0061"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: rrs:RoseRS_1835
FT                   ATPase associated with various cellular activities, AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33315"
FT                   /db_xref="GOA:A9WBA8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBA8"
FT                   /protein_id="ABY33315.1"
FT                   /translation="MQTAQLASALLNEARKTLVGQEENLTLLLTALLSGGHVLLEGPPG
FT                   TAKTLMAKTLAQMIQADFRRIQFTPDLMPADVIGIQVFDMKSGEFRLYRGPIFTQILLG
FT                   DEINRAPAKTQSALLEAMEERQVTIEGQRLPLPEPFFVIATQNPIEYDGTYPLPEAQLD
FT                   RFLFKIVIGYASRDVETEVLRRYHLGFDAHQLTASGLRPIVSPEALATCRAEITQVQVE
FT                   QGILDYIVSIIQATRNSPELLVGASLRAGVAMLLAAKTLAAIHDRNYVTPDDVKLLARP
FT                   VLRHRIILRPEAEIEGLNPDMAINRILNRIEVPR"
FT   gene            73019..75568
FT                   /locus_tag="Caur_0062"
FT   CDS_pept        73019..75568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0062"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rca:Rcas_1858 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33316"
FT                   /db_xref="GOA:A9WBA9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBA9"
FT                   /protein_id="ABY33316.1"
FT                   /translation="MLSRMLVRSSLRWIRQHPWQMLLCIIGVALGVAVVVAIDLANASA
FT                   RRAFQLAGDTVAGQATHQIVGGPTGLPETVYPTIRRQFPTLAAAPVVEGYLTAPALGPG
FT                   VYQLFGVDPFAEAPFRPYLAGNGAVDLAALLVEPGAALLARTTSEQAGLQPGDQLPVQI
FT                   GARQTALRIVGVLDPADDLSRRSLAGLVIVDISSAQELLDNTGRLSRIDLIVPEAFDLA
FT                   ALTAQLPAGVTVQPVAARAGTLQQMTAAFELNLTALSLLALIVGMFLIYNTMTFSVVQR
FT                   RGLWGTLRCVGVSRGQLAGMVLIEAFIISLVGVAAGLVLGVVLGRGLVGLVTQTINDLY
FT                   FVVTVRDLAIEPLVLIKGTALGIIATLLAALAPTLEAMYTPPRTVLRRSSLEERIRRAI
FT                   PRLAGGGVGLLLLGGGLLLIPATADTSSLYIAFGGLFAIVIGTALLTPLILMTLMAVLR
FT                   PILGRAAGMLGNMAARDVVNSLSRTAVAVAALMVAVSVTIGVGIMIGSFRQTVINWLEQ
FT                   SLIADIYLSPPSNVANRIDTTIDPALPAALASLPEVEAITTFRSVQIDLPTGPTTLVAV
FT                   GSTTDRGRRALRFQQGGDEATWTAWENGAVLISEPLAFRSGLGVGDTLTVRTDRGLREL
FT                   PIAGVYYDYTSDRGVVRINEATYRQLWDDTALSSLAIYVREGYEVDAVMERVRAISAAY
FT                   GTIIVNSSRALREGTLIVFDRTFAITSVLQLLATIVAFIGILSALMALQLERTRELGVL
FT                   RAIGLTPGQLWGVVLGQTSLMGLAAGLLAAPLGLALAVVLTYVINKRSFGWTLEFTLDP
FT                   TLFVQALAVAIVAALLAGIWPALQMSRTSPAVALRDE"
FT   sig_peptide     73019..73132
FT                   /locus_tag="Caur_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.762 at
FT                   residue 38"
FT   gene            75650..75916
FT                   /locus_tag="Caur_0063"
FT   CDS_pept        75650..75916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0063"
FT                   /product="acyl-coA-binding protein ACBP"
FT                   /note="PFAM: acyl-coA-binding protein ACBP; KEGG:
FT                   rrs:RoseRS_0103 acyl-coA-binding protein, ACBP"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33317"
FT                   /db_xref="GOA:A9WBB0"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBB0"
FT                   /protein_id="ABY33317.1"
FT                   /translation="MSDLQAAFERAAQEVQQLPRRPDNETLLQLYALYKQATVGDVQGS
FT                   RPGVLDMTGRLKYDAWAKLKGVTAADAMQRYIELVERLKQSLA"
FT   gene            complement(76425..76709)
FT                   /locus_tag="Caur_0064"
FT   CDS_pept        complement(76425..76709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0064"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; KEGG:
FT                   mca:MCA1010 RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33318"
FT                   /db_xref="GOA:A9WBB1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBB1"
FT                   /protein_id="ABY33318.1"
FT                   /translation="MLVKLFVGNLPWNVGDAELGSIFEPHGEVQSARVINDRDTGRSRG
FT                   FGFVEIETNNVAAVIRATDGLEVGGRNLRVNEAEDKPRNAPRGGFGRRY"
FT   gene            77165..77749
FT                   /locus_tag="Caur_0065"
FT   CDS_pept        77165..77749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:77405..77407,aa:Sec)
FT                   /locus_tag="Caur_0065"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; Contains
FT                   selenocysteine; KEGG: gvi:glr0029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33319"
FT                   /db_xref="GOA:A9WBB2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBB2"
FT                   /protein_id="ABY33319.1"
FT                   /translation="MSRPFIPMTAKWRQEFIKPRGPANVPAVGSEAPDFTLPYAQFLSG
FT                   PPEDRVEYGRTITLSALRGRPVVLNLTRIVSDRFFUPHCAPQLDALREHYDLFVQRNAH
FT                   LLVVSSTDLEMTSYVAEVLRAPYPILSDPEWGVFYRYGMGSAMGVPLPGVFVIDADGII
FT                   RWSWAAPLSVVFTPPRPAELAAVLDALASEG"
FT   gene            complement(77807..78511)
FT                   /locus_tag="Caur_0066"
FT   CDS_pept        complement(77807..78511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33320"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBB3"
FT                   /protein_id="ABY33320.1"
FT                   /translation="MWLIAEYEAVSLFSLRPSFTTASGGKTLLAPTPFAIKMAIFDALC
FT                   RAQSLDVARSHWPAIARLEVALRPAAQAVVSNVFQRVLRPSRSEAKPNDPDFEGFFQRT
FT                   IGYREYVHLFGDFAIGLGWEGSDQRDWLRDALLHITYLGKRGGFVQVLSVPAYNEVLPA
FT                   EFVSLTRPETNFPLDGTMQVVDDCAPNLSFEKIDVYNPAKKLSKGDRTERHVVLPYRLK
FT                   RSSKSFSWYERV"
FT   gene            complement(78514..79503)
FT                   /locus_tag="Caur_0067"
FT   CDS_pept        complement(78514..79503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0067"
FT                   /product="CRISPR-associated autoregulator DevR family"
FT                   /note="TIGRFAM: CRISPR-associated autoregulator DevR
FT                   family; PFAM: CRISPR-associated regulatory Csa2 family
FT                   protein; KEGG: rca:Rcas_1012 CRISPR-associated
FT                   autoregulator, DevR family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33321"
FT                   /db_xref="InterPro:IPR010154"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBB4"
FT                   /protein_id="ABY33321.1"
FT                   /translation="MKPVFSLSIAARAVLNLHSLNNEGGEGNQIQTRMVNVFADGRLHS
FT                   VNAISGDMFKHIQSEHLHRLAVQADLPLSMGARLFNANRINYDLDLDKEFLNQLQTAKS
FT                   NAGELDLILQRCAVTDMAGALITAGNRSLPRKSVVEFGWVVGVPGSVKTDSYFHVKFES
FT                   ERGGGSAGVDESGSIAGKQTPFHRPASSGVYAIVVQVEAARIGFNDISQRYAVDADQRR
FT                   KRLRALLESILYTFIEPAGAMRTAQNPHILDVSGVMTVSSNVIPAPCISPLKDDFVSDV
FT                   QRVAESLNQLHPDAIELFSFDSLGAFAEQMSRLIQEAEPFTLPAVNGA"
FT   gene            complement(79534..81093)
FT                   /locus_tag="Caur_0068"
FT   CDS_pept        complement(79534..81093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33322"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBB5"
FT                   /protein_id="ABY33322.1"
FT                   /translation="MVGVVEDYEQAKADNETYWTWRKSVGGQQPQLHPPVEPHPDWELF
FT                   RAINPTALQAANSAAAEWFQGRVAFPALLETVLIYASTLPNDQEGAEKHWAAVCKQHGL
FT                   HHTKQLSASQVINPTQGKGTANGKAIFAKPGNLSNFWLTEYLKWVGLRWAGFTRLIRDS
FT                   KDRKIYVLAPNQLDWHDHRGIREEFRRLMVGSGGAIQLDVLAALRYTRAVLDYAAVTQS
FT                   ERLLTQIFGSHQGVNRLVYGLDSAYYKNLGQSAAVMNIARIGLPAWVQPRVRQDIQLYQ
FT                   NMIDEHIRIVRNLDEKRGEDYELLRLYRDFLSTNELTALLAFTDAYSGFVIQRDKLAPQ
FT                   FTVHHLEVIMSSIAPPLSKITQSRGFRNLAYAIRMATVEAHRRNLKRNQGRYDVSYEVR
FT                   YGLGQELLRKSAYPNEFITALSEFIHDYNAENARMRERLERQGYSQPRGARSDVSIKDI
FT                   DELLALMDEYRDPQMIASLLVAYGYASTFQRDETYTPDSDAEEVTEPVSSDGDDDNSPE
FT                   AE"
FT   gene            complement(81155..81394)
FT                   /locus_tag="Caur_0069"
FT   CDS_pept        complement(81155..81394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33323"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBB6"
FT                   /protein_id="ABY33323.1"
FT                   /translation="MNASIYRSKYYVEKRTGTFADNLVAFGLAYVLDGIADSRARVTIA
FT                   DHGSHFAVICDPPLREDWVKNCQFFYRRFSFSHC"
FT   gene            complement(81409..83814)
FT                   /locus_tag="Caur_0070"
FT   CDS_pept        complement(81409..83814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0070"
FT                   /product="CRISPR-associated helicase Cas3"
FT                   /note="KEGG: rca:Rcas_1010 CRISPR-associated helicase Cas3;
FT                   TIGRFAM: CRISPR-associated helicase Cas3; PFAM: helicase
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33324"
FT                   /db_xref="GOA:A9WBB7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBB7"
FT                   /protein_id="ABY33324.1"
FT                   /translation="MQLYPYQQRVKDIILAGENVVLQAPTGAGKTRAALVPFIEGFFDR
FT                   PDTTPRKCLYVTPMRVLANQFYAEYRELAARYQRLHGRQLDVRIQTGEQPEDRRFEGDL
FT                   IFCTVDQFLSSYLMMPYSLPYRLANVNAGALAGAYLVFDEFHLFDPDAALPTILHVLRQ
FT                   LHGLAPFMLMTATFSSAMLQSLATLLQPAQVVTLSAAEIAAINTRGGQPARQRVWQVAD
FT                   QPLQAAAVLAHHQHASLVICNTVRRAREVYAELKQQAPPETEVLLLHSQFLPDDRRQIE
FT                   AKLRSRLGVSSQRQQANLIVVATQVVEVGVDISVEVLHTELAPPASLIQRAGRCARYPG
FT                   DTGTVIVYPVETYVPYAFKPDEILKHEMDATLAWLKERQGAVFDFDHEQELVNAVSAAR
FT                   DQNIIAGIQADRHNRRASIQGCLEGQRAGASRLLVRDVDSRLVLIHPDPDQLLASPYDA
FT                   VGLNIPLYSLRSMGKDWLQRPTDAPWRVRRLDESDAGDQAESNRPLYRWVDVHDSKELA
FT                   QSAIIVVHPALAGYSAHEGFSPETGNLPFISTLPPARPLIDRPRSSLYVETYAEHIQRV
FT                   LDAFQELVLPELRFAASALECAAGWSPGSVLRAAWLACLFHDVGKLSKGWQQWAHAYQQ
FT                   AIGQPVAKTIALAHTTFDFQNPTHRQAEREVSRSTPRPRHAAEGALAVAQILAGAFNIS
FT                   HEKELVQAILTAIARHHAPFVQDCQAFSLVSEAGNLIQNTLQFLPEEVNYSLNINDLWV
FT                   NSHHHQQFAELLIKPTSRYGWIAYTLLARALRRADQRGTEMGAGQTLP"
FT   gene            complement(83818..84846)
FT                   /locus_tag="Caur_0071"
FT   CDS_pept        complement(83818..84846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0071"
FT                   /product="regulatory protein, DeoR"
FT                   /note="KEGG: rca:Rcas_1009 regulatory protein, DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33325"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBB8"
FT                   /protein_id="ABY33325.1"
FT                   /translation="MGKGRGLSRAERLSEMKRLYVQRAFSDAEIAERLEIDRTTAYRDR
FT                   IALEQEYPFVEESPGRYRIDRSRLVSEVRLNPHEALFLYLPARRLLRQTRFANVHVVQA
FT                   VEKLAACLQQPMTERLLQLSTSVLKQQKQPQRLSILEQITMAWLNQRKVRITYRALRAR
FT                   RPLIHTICPYLIEPALWSDSVYVVAYSDIARDIVPFKLERIEDAVTTLETFDIPDDFDE
FT                   QQLLRHTWGIWLGDEEPVTVRLRFMPGEVTRRVQETIWHPSQQITLLDDGGCEWQAQVT
FT                   DWREMLPWVRGWGAGVEVLEPLEFRETLMGEARALAERYGWHVSSVPTPTGSTTLHDFF
FT                   GG"
FT   gene            85231..86709
FT                   /locus_tag="Caur_0072"
FT   CDS_pept        85231..86709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0072"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33326"
FT                   /db_xref="GOA:A9WBB9"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBB9"
FT                   /protein_id="ABY33326.1"
FT                   /translation="MTTSHLPLDHLVRCCKQERQSYRDSGELASPCCMHLFRRAFAGEQ
FT                   EAWGYVIDIFQPLIDSWLRRVRGTRLDFIDDDDLTAVAHDALLKLRDSANRLPELTTGD
FT                   DLSRLLAYLKRCAIREVQTLFRRRNRSREISYIKDDTPHVAHFLDAETRITLYQRLREV
FT                   LNEDELFVIEHLFFKGYKPQDIIHYFSERFVDVDHIYQIRQNALRRLRNDPVIRDLVFP
FT                   QEQSSDHRDPPIDSPQDRRQKPRGPDSLKIELDQEQKEPGLMGTPCTLDEQILLDYAAG
FT                   RLSVEQRLLVEANPDCVAQAQRLAAEIAAIEASLYRLQCPDVDTLHAYYYRELEATQHL
FT                   IVHRHVEDCLFCREELALLQVMDETPLIEPSPFERVRQVVEAILQPALALQLRGQALIY
FT                   AAPEVLLTLTVRRTKQGVPQWTVIGELKMPDGAPTDQPIEQVVATVTDSHTITAEIDED
FT                   GVFVIRDLPPGTYRLTVYTPDKEIVIRSLQIGND"
FT   gene            86711..89500
FT                   /locus_tag="Caur_0073"
FT   CDS_pept        86711..89500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0073"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; SMART: Tetratricopeptide domain
FT                   protein; KEGG: sus:Acid_3454 tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33327"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBC0"
FT                   /protein_id="ABY33327.1"
FT                   /translation="MDDLIAELIDLPEAEWPGWLTTHASRLSLETVARLKQRSDQFIKS
FT                   DSARADRISRAAIAVAEQLPTEPIARALAYWARGNWAVYRRPEEAVDLYQKALVVYEQI
FT                   GDSEAIARLSSNLILACTTLGRFADALTFAERAQRLLEEIAAGPVIYRVKFGMNYGLLL
FT                   YECGRYQEALDVNEKMIALARNHGLQEELAELQVNQAFTLAAMGRLAECERLLIDSRQR
FT                   LEQLTPKPVLTIARIDLNLGDYYSATANLSAALNHFRDASKGFQEENVAMDYATVLLYE
FT                   ANLLKRLGALREARRAYDRAYQAFREDNLTQYAAQALLAGAAVRREINPADPELPEMLN
FT                   RACDMFTNLQLPIWRNETLLEQARLALLFGNYAQAESLLTTAWSEDADTVLHLAIDHQL
FT                   LWGRLRMAQGDEAGALTAFTSALTQSQNGAQIWSEREALVALGNLLAARQPDSAIQYLQ
FT                   DAVRIDELMRAELSVAELTADFQSRRNDALPLLAKLEWQAGHFQTALQTVWRWKGGALI
FT                   DLIRRHDGYTDVNPTIAQLQQRIAVLRWELERKQRDEESEERLDELRRQIRDLEAQAYH
FT                   ERRYHIHKPGQSDASIYNWQTVLSKLDADCLIEYVSIDNELYAWCLTRNGDCTITTLGS
FT                   TSTISELLQRLELKNLNALRLNDEQRQQRGETLIRDARVLLQRLYRTLIEPLPIPVEGK
FT                   LLIAPCAPIHLAPFAALWNGNNYLMERYLIEQIPTGALLGIPVPAGPSGPALVIGASAD
FT                   GMLAAVQREINAIAGILADAEVYLDDPAALTALHNLTTAPRILHFSAHTTFDEEPTIFA
FT                   GLHLADRTFTIEECYRLNLAGTELVTLNGCTTAYGMESGGALIAFQSAFLIAGAQRLLV
FT                   SLWPIKDEPAAGLMARFYQNLMQTQSPAVALRQTQRDLLHDPALAHPAIWSAFAVMRR"
FT   gene            89548..91068
FT                   /locus_tag="Caur_0074"
FT   CDS_pept        89548..91068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0074"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; KEGG: gvi:gll3709
FT                   polysaccharide transporter, PST family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33328"
FT                   /db_xref="GOA:A9WBC1"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBC1"
FT                   /protein_id="ABY33328.1"
FT                   /translation="MPTPHSPHPHPNPPPALLATRAVRGSLWVVASSYWTIGFGFLANM
FT                   LLMRLLSPDVYGEFALAMFFFSLFQVRSKIALNYAFAQQRAITGETVGTLFVLDVLAGW
FT                   GGVLLAFSVAPLLRWLGYPAAVIEIMLVLTILSGIESLLGVFQIVLESDLHFKPISIIN
FT                   GIAMPLSYIPAFVCAFTDLKRYSILAQSTSFTLLSLIGIGLYALYTQRHLLRLRWRYQS
FT                   TLAVAYLRFGMTSGLGQAIAGLTTQVDNMILGTIAGTVHLGYYDRAYRVAQWPALLLSA
FT                   VLGRAAIFTYSQLRDDVIRLQRAVTRVLWGSLHLAVPVALAVMLSANELVPLLFGAQWE
FT                   PAIPLLRVLILLAVIRPVWDNLSAWFIGSGEPQRVVALSAIQLLLLVLIGTPLTLMGGE
FT                   FGMAIGAVIAAGCSLLIAYWQVRRQLVVDLRQVLGNPLLAALGTLLIFWLLDRLVGSGQ
FT                   PLWLAVGWKAGVAFGGFFCWAYVLQPALFRRQIGEVWRAIRGKGERDA"
FT   gene            91216..92115
FT                   /locus_tag="Caur_0075"
FT   CDS_pept        91216..92115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0075"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: rrs:RoseRS_0743 D12 class N6
FT                   adenine-specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33329"
FT                   /db_xref="GOA:A9WBC2"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBC2"
FT                   /protein_id="ABY33329.1"
FT                   /translation="MKHQRTPSPILQRRTRRLIAFGWYGGKYSHLDWLLPLLPPCHHYC
FT                   EPFGGSAAVLLNRDPAPVETYNDIDGEVTNFFRVLRDQPDQLTRAIALTPFSREEFALA
FT                   CEIDPSLEPIERARRFYVRARQVRTGLAQSASLGRWANCKQTSRSGMAGAISRWFGAIE
FT                   DLPDIAIRLLRVQIENRPALEVIRLYDSPDTLFYCDPPYVHETRGDNNAYAYEMSNEEH
FT                   QQLADVLNSVQGFVAISGYDCDLMNELYSPPKWIKHVGPTRTIHSTKDQRTEILWTNYD
FT                   PILYQSHTLFGVELGKSS"
FT   gene            92099..93226
FT                   /locus_tag="Caur_0076"
FT   CDS_pept        92099..93226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_0742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33330"
FT                   /db_xref="InterPro:IPR019066"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBC3"
FT                   /protein_id="ABY33330.1"
FT                   /translation="MENPHEILKRILEYVSVDLSRSSITDQEIRTRIESVCRQISNRAC
FT                   TRMLMACLLAKIHRPEIDPRKPYTEIGGEDSFSGRTYDEKYITHFINTYQLPLNPTTAF
FT                   LTPAFRNLDKPLTTDLELVGRPRRTYKDTLQLLDDVYRGRVSAEDMLAEIIRILVVIRE
FT                   ENRNRIRTLLAGLASTEDPLPLSSEDIVSLIEQHLKCKNSSRLPVLIIAAAYLSVSEKI
FT                   GEYIQPLQKHNAADEQTGSFGDVEVCLANDDRVVTVYEMKMKQVTIDDIDRAREKVARA
FT                   RDKIHNYIFITTDVITDDVKFYAAKCYEETNDTEITVLDCIGFLRHFLHLFHRSRIQFL
FT                   NHYQQLLLNEPDSAVNQPLKEAFLTLRRAAEIDKG"
FT   gene            93459..94595
FT                   /locus_tag="Caur_0077"
FT   CDS_pept        93459..94595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0077"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rrs:RoseRS_3120 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33331"
FT                   /db_xref="GOA:A9WBC4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBC4"
FT                   /protein_id="ABY33331.1"
FT                   /translation="MKILFIARYHHPTTQRKVEYLAQAPDIDLCHIVPAYQPQSADLRP
FT                   LDEQRRYRQLTIPMLGSVSDPHRALYRTVTFHLHRFRPDIIHAEEEPDSLSALQIVWAR
FT                   RIWAPQARLLLHTWQNQDRRKSRAVRWVIRQTLEAADLVFCANSEAITLLRRFGFTGPA
FT                   PLLPAIGVDTTLFRPCAAYNGLSEQSAAKSSYTIGYIGRLVWEKGIDLLLQAVAALTSA
FT                   MPDRQIQVWVTGAGPLQAELQSLARQLGIEERVVWKGAQPPHEIAKILCHLDVLVLPSR
FT                   TTNVWKEQLGRVLLEAMACGVPVIGSTSGAIPEVIGDAGLIVPEGDVQALTQALKHLLS
FT                   TPDLRQTLAQRGRIRAETYYTQRHLAEQTLAIYREIVA"
FT   gene            96498..96884
FT                   /locus_tag="Caur_0078"
FT   CDS_pept        96498..96884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33332"
FT                   /db_xref="GOA:A9WBC5"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBC5"
FT                   /protein_id="ABY33332.1"
FT                   /translation="MTSQPPQTAQKNPVEMLQDQVTLLAHIHQTQQEQLRFLATDIYRT
FT                   QQEQLQVLRSLSEQLASLQVEVSQFAQSVHRVQVEDFDMPFTSMVPFLLKRSFALGIVS
FT                   IILGVIGLCIFFALITFAGPYFRF"
FT   gene            96990..97862
FT                   /locus_tag="Caur_0079"
FT   CDS_pept        96990..97862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0079"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rca:Rcas_0463 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33333"
FT                   /db_xref="GOA:A9WBC6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBC6"
FT                   /protein_id="ABY33333.1"
FT                   /translation="MHHSDMRQNTSLLPPASVIVLTHNTCELTITCLKQFYQQALDHGW
FT                   QVIVVDNGSTDGTYQRLTGLFPSVEVMRSEQNRGFAAGNNLGLRRAMGQAVILLNSDVL
FT                   ASFATLSRLPEFLAHYPQVGVVSPQLQTASGLPQAFAYGCDPTLPYLLQRGLCWLIWRK
FT                   PLHDWGVAAPIEVDWVSGACMCVRRAAIEQVGLLDEGFFLYFEDNDWCLRMRNAGWKVM
FT                   YVPTYAVTHLGGQSWPTPRQAGQHYRQSLRYFYQKHYGPLATGLLGVGLLGYQVLLKLM
FT                   AFRLRKEED"
FT   gene            complement(98452..103038)
FT                   /locus_tag="Caur_0080"
FT   CDS_pept        complement(98452..103038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0080"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; KEGG:
FT                   sat:SYN_01127 RTX family of calcium-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33334"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBC7"
FT                   /protein_id="ABY33334.1"
FT                   /translation="MRFRINVWAILGTTVLVSGFLLASRSVWSATIPVLPPPHTQAVIS
FT                   VCDPITTDTTWTTGNVYVVGDCALVVQSGATLTIQPGVIVKFFWVSAYGGSRGGGIRVD
FT                   GRLIAQGTADQPIVFTSLADDSAGGDTNGNGPSSGAPGDWHGLILNTGSQTTLDHVSIR
FT                   YAGGNLINSSLDGWSEAQIEVKAGAQFSLTNSEVRDGGRIGIYLNGAGLSPTIQHVQLS
FT                   GHTATGSSYGYTVLQSTINMQPTYSNLTFSNNTRNEVTIGSFEGEITQNATLGGTNFGA
FT                   TCGSTLCQLIIPNGRTLTIRPGTRLALGPAFGITIASGGTLNAEGTATQPVIFTSAAAA
FT                   TTPPGGTVPSNSEWLGLWAQAGSTLRLAYCDISYATDSNYGNGGLEINTDDAQVQNCKI
FT                   HHNKRTGLYLASKNNSTIRPVLSNVEVSDNGQYGVYLEAQRGTVLAPTWEGGAIRRNGW
FT                   SGIFGYTYEGILEPTLRNLTIAGNGASGGLDREKHGIYFNNHNINPVLEGVSFNNNTGA
FT                   AVLWYCNGSITARNLTATGNTQNELVLPGCDISGGRRWDLGDAGIPVRVAGDINVTPNA
FT                   LLSILSGTILRFDKNQYNSPTWLEVQDQATLNASGTVTRPVVFTGATQTPGWWIGIQAR
FT                   QRATLMLRHCEIGYGGAQTTGSLLIRWGYPRTGIPVANIQNCEIHHSSTRGVHFYFDNE
FT                   PPASPPVFRYNHLHDNAELAVAAWGTPPIDARYNYWGHATGPYHATQNPTGQGNGVGDN
FT                   ILFYPWLSAPSSGEVAGEMIVRTGAPTRVSPGETVDYAIQYYNGMSITVENAVLLIQLP
FT                   RAAEYVDSTGGGIYWSDRHQVFWKLGDLLPQAEAFVSVRVRFQWGLPADYKDGSITLLA
FT                   ADNYNAGAFNTAEYLAHQMEEVITGKTIVSQTEFDALRRTVPDLQTLYEEAIAQGYRYL
FT                   EAGRITYDDGTSVTGAVFRTPDRRAVRLLTLYEGMALAMTSADGLYTLHDTTGGITMTL
FT                   NGLSRSYWGDWMPGADSQTVGLRASTGCSVSDCNFNCIGQQVNFKVMADSLTKMFMWTI
FT                   ATGGSGGTVALALEVLDVTKMIYDCYTECEADPNSNCCTTTGQVRWTVPGWSKLLGDAC
FT                   VKEECNGTTGTYGTPGVIYCAGGQRCVAGYGNEGGCKSCVEATASYSAVSLASPGICAA
FT                   GETSRCSELELLRAKDPNDITGPTGDLLPGQVVTYTIRYENEGEGRAYGVFVVNPLPAV
FT                   FDERTLTFVHGSGQYLTATREIVWTVGELAPKGQAGSSGVLTYTVALTNGLPSGTVVAN
FT                   QATVYFPSVPEETPTNTWVNVVTPLVAEPQSLTTAYMAPLPITLSGREVSGLPLTYEIV
FT                   DRPHGGTLTGTAPNLTYTPGENFTGADAFTFRVSNGTSTSRAAQISVMVTAQGDTTSPR
FT                   VLWTSPADGAKGVVVLATPVYTDTAGPIYVPEILVGMSEPLDATTVTTTTVILRRSDGT
FT                   VVPAWVRYDAAVHQIVMMPRTVLANGTYRAEVTTGVKDSAGNTLSAPYTIQFTVGSERK
FT                   VYVPVIQR"
FT   sig_peptide     complement(102949..103038)
FT                   /locus_tag="Caur_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 30"
FT   gene            103793..104938
FT                   /locus_tag="Caur_0081"
FT   CDS_pept        103793..104938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33335"
FT                   /db_xref="GOA:A9WBC8"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBC8"
FT                   /protein_id="ABY33335.1"
FT                   /translation="MPRLNPAIHLTFLLILTCFVRLLASIFANDIIDVRNYQQVAEVID
FT                   RFGVSGLYRHTPDIYPYPPLWAGFEVAAYWLAQNNILSFSLAIRLPIIAADAGIVAVIW
FT                   QWVHRHSGSSRQAMQAAMIYALNPVSIIVSCWHGQFDALPLFWAALAMICTAWQWQAIA
FT                   LSIGIALKSFPVLLVPAFLWHLQPLRRQVQFGLLALVPVLLLLAPFVVDDASAVVRELF
FT                   GYRGHALLGIMVPVRTVYVPLVGERFPVETTRLLISLSAYGFLILYALTVWSMKRRSMS
FT                   VPMQATLIVLLFYVVYAGIAPQYLLWVLPFMIMAARPGAVLVYSAVSTLALLGFYLYAV
FT                   PDIFPFALTVSPRLAQVAYGLFGSLWWLTCGGLLVWFWRQR"
FT   sig_peptide     103793..103879
FT                   /locus_tag="Caur_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.808) with cleavage site probability 0.468 at
FT                   residue 29"
FT   gene            complement(105018..105093)
FT                   /locus_tag="Caur_R0001"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(105018..105093)
FT                   /locus_tag="Caur_R0001"
FT                   /product="tRNA-Arg"
FT   gene            complement(105220..106434)
FT                   /locus_tag="Caur_0082"
FT   CDS_pept        complement(105220..106434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0082"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Arsenical pump membrane protein; Citrate
FT                   transporter; KEGG: rrs:RoseRS_0950 citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33336"
FT                   /db_xref="GOA:A9WBC9"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBC9"
FT                   /protein_id="ABY33336.1"
FT                   /translation="MTIISILTLGIVAATIIGVAVGRWPLLRADRTTITLIGAALLLGI
FT                   GAMSLEEAYAALDLDTIVLLFSMMVINGSLFLAGFFGVITQRVVQFARGPRSLLALVIG
FT                   ASGILSALFLNDTIVLMMTPIVLDVTRALRRNPLPYLIGLAVAANVGSTATITGNPQNI
FT                   IIGSASKISYLDFAAALSPTALIGLVICWIVVLLVYRDEFRGGPLTTPDVLRTRVYRPL
FT                   LRKAALVISLMLIAFLVGVPVPLAAFVAAATLLATRRLRPERVFKTIDWNLLTFFAGLF
FT                   VVTHALDVQGWTDILFTNLAPLAQAGMVPFGLVSVVLSNLISNVPAVLLLQSLIPAFAD
FT                   QERAWLTLAATATLAGNLTLLGSVANLIMAELAARWGVRVTFGAYLRVGLPVTILTVAV
FT                   SLILV"
FT   sig_peptide     complement(106366..106434)
FT                   /locus_tag="Caur_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.864 at
FT                   residue 23"
FT   gene            complement(106505..107578)
FT                   /locus_tag="Caur_0083"
FT   CDS_pept        complement(106505..107578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0083"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: rrs:RoseRS_2550 PHP C-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33337"
FT                   /db_xref="GOA:A9WBD0"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBD0"
FT                   /protein_id="ABY33337.1"
FT                   /translation="MNYPFIYPGAIHMHTTYSDGSATFPHLIAAAREAGLRWVIVTDHD
FT                   TLEGLPFAGWHDDVLVIVGHEITPDHNHFLALNVDTVISNELPPQQFIDEVYQRGGFGI
FT                   IAHPDERVRNSFKDIYRWDDWTIDGPSQRTGRVVGLELWNFMSDWGEHLTERNKLALVL
FT                   YPQLGLSGPTLATLAWWDRLNMVGRRTFGIGGVDAHGFKRKAPWGEIEVFPYPWIFRTL
FT                   TNYLLLPEPLSSDATTATNQVYAALTAGRCYFVNRLDGDAPSIIFRLSRPGDLAEIGDT
FT                   ISLAGGPLLVEVDVGADAYARLIVNGEVMTSGIRRIRQTVTDDGVYRVEAYWGGKPWLF
FT                   TNPIFVTAADAGREGSL"
FT   gene            107630..108739
FT                   /locus_tag="Caur_0084"
FT   CDS_pept        107630..108739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0084"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rca:Rcas_4314 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33338"
FT                   /db_xref="GOA:A9WBD1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBD1"
FT                   /protein_id="ABY33338.1"
FT                   /translation="MIVIDIDASRVTVAQRTGTERYSYELIAALDRIAPSDIHFRLYVN
FT                   GRRDQLPPVSERATIHDIRLPRLWTHLRLGPTSWRARPHVLFVPAHVVPLLHPPTVVTI
FT                   HDVGYRAFPETHTARRRLELELTTRWSLRAARHVITISHATKRDLINWYGADPNRITVT
FT                   HLGCSSIFAPPADPRVVAAVTAHYGLDQRPYLLYIGTVQPRKNLSRVIDALALTIAAGY
FT                   DLDLVIAGKRGWLSEPIERRAGELGIANRVHFTGFVADADLPALLAGALAFVFPSLYEG
FT                   FGMPVVEAMACGTPVITSTSSSLPEIAGDAALLVDPLDTNAIAAAIMRLSDDQDLRATL
FT                   RQRGLARAHLFNWETCARQTLAVLLQQSR"
FT   gene            109679..110044
FT                   /locus_tag="Caur_0085"
FT   CDS_pept        109679..110044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0085"
FT                   /product="protein of unknown function DUF309"
FT                   /note="PFAM: protein of unknown function DUF309; KEGG:
FT                   rca:Rcas_1756 protein of unknown function DUF309"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33339"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBD2"
FT                   /protein_id="ABY33339.1"
FT                   /translation="MGSSDHQCSEAADALVCGIHLFNQGEFWHAHEQWEICWRAAQGMD
FT                   ADFYQALIQSAAALVKWRQGNLRGLRLNWAKAQRRLSRLPSFYRGIDLARLQTAMTALV
FT                   NDPELASAPVLDLPPAQ"
FT   gene            complement(110797..113220)
FT                   /locus_tag="Caur_0086"
FT   CDS_pept        complement(110797..113220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0086"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: rrs:RoseRS_1605 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: peptidase S16 lon
FT                   domain protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33340"
FT                   /db_xref="GOA:A9WBD3"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBD3"
FT                   /protein_id="ABY33340.1"
FT                   /translation="MTTTPANEQSPSPSGTTLYERPVLPLLDSVLFPQMLAPLFVSDER
FT                   AINAVEQAVAEDRLVLAVAVRGPVDELTLGIDDLYPVGVEATVQRVRRLPDGTLSVVLE
FT                   GRQRMQIVSVVTEHPALRVLATPLETPPLDEDAALMVEALSRTILTTFEKIVRLSRNLP
FT                   DDAYLSALNSAEPGELADIIAALLPISVEDRQRILALADIQQRLRQLEILLAKELDLLE
FT                   LENRIHSQVQQEVDRSQRELFLREQLRAIQRELGQEDPSRREIMLLRERAAAAGLPAHA
FT                   MARFEEELARLELISPMSPEHGMLRTYLDWLISLPWSNASPENRDLRAAAAVLERNHYG
FT                   LRKVKDRILEYIAVRQLAGPSRRAPILCFVGPPGVGKTSLGQSIAEALGRRFVRLSLGG
FT                   VHDEAEIRGHRRTYIGAMPGRILQRMKVAGTINPVFMLDEVDKLGSDFRGDPAAALLEV
FT                   LDPEQNSTFSDHYLDLPYDLSQTLFITTANVADDIPDPLLDRMELVELPGYTEDEKLHI
FT                   ARRFLIPRQMTDSGLPPATIRFGDATIHTIIRNYTYEAGVRNLEREIGAICRKIARRIA
FT                   EGRRYPRQITPRALPKLLGPPRFEIGKIDPRDQVGVAIGMVYTSAGGDIMPVEVVLMDG
FT                   KGNLLLTGQLGEVMQESAQAALSFARANASRLGIEIRHFDKLDIHVHVPEGATPKDGPS
FT                   AGVTIATALISALTGRTVRHDIAMTGEITLHGRVLPIGGVKEKVLGAYRAGIRQIILPR
FT                   RNEHDLVEIPVALRRQLTIHLIERIEQALELVLGPPPPKEPRRAPRVIPRRDED"
FT   gene            113440..114276
FT                   /locus_tag="Caur_0087"
FT   CDS_pept        113440..114276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0087"
FT                   /product="alpha/beta hydrolase fold-containing protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: gka:GK2874
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33341"
FT                   /db_xref="GOA:A9WBD4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBD4"
FT                   /protein_id="ABY33341.1"
FT                   /translation="MRDRHRAEDTTVKITINDITLHIEITGSGPALLAIHGFTGSGQTW
FT                   QPLVPTLAQDHTLVLVDLIGHGASAAPPDPHRYTIEQCVTDLLTLLDYLGIEHTDLLGY
FT                   SMGGRIGLLLTAHAPTRIRRQILIGASPGLADPAERTARLASDEALARLIEERGLEWFV
FT                   DYWAAQPIFASQQRLPPAVLAAQRAQRLAGSAQGYANALRGMSVGRQPSLWATLPTITT
FT                   PTLLITGALDSKFCAIAAQMTALMPHARHEIVPDAGHAVHLEQPDAVATLVSAFLA"
FT   gene            complement(114596..115063)
FT                   /locus_tag="Caur_0088"
FT   CDS_pept        complement(114596..115063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33342"
FT                   /db_xref="GOA:A9WBD5"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBD5"
FT                   /protein_id="ABY33342.1"
FT                   /translation="MAQAELDDRIKFLLVGVEVLFVYIFGLVRLATMEWLSLFAWIGLL
FT                   MWPFVHVMIVSAFILSFRLNFKDAVLYIAVHLFFLLAWLLQSDFANNHTWVVFGKFPFI
FT                   RGLEPFLIEWGSTLFLTTATATLVCYAVIFILVIVRIVQFLVSLNKDAQAA"
FT   gene            complement(115078..115332)
FT                   /locus_tag="Caur_0089"
FT   CDS_pept        complement(115078..115332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33343"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBD6"
FT                   /protein_id="ABY33343.1"
FT                   /translation="MPLARLLPLGYAMRRMIRLWLIVCASVETEIVQAGGGDCAVFSGD
FT                   SCVRTAPLPLALSLPFTPADGNCQPDMRNTTTDNVAITI"
FT   gene            complement(115639..116187)
FT                   /locus_tag="Caur_0090"
FT   CDS_pept        complement(115639..116187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0090"
FT                   /product="PBS lyase heat domain protein repeat-containing
FT                   protein"
FT                   /note="KEGG: rrs:RoseRS_1736 PBS lyase heat domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33344"
FT                   /db_xref="GOA:A9WBD7"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBD7"
FT                   /protein_id="ABY33344.1"
FT                   /translation="MILLLPDVLPLDPKERDDWIRRIHLLLKVAKQDNLLDLVKAILEL
FT                   LDGWRGKDQPEPPQPPSCPTGWSGQQWIVVDFFNLVIAILRVLEEWLVRDQQEPQQPSS
FT                   RSTGWGVQQWIVVGLLIALAVLVCIVAALLSVIGDVVTTLWMVLLQTPLWLVGAGLVFA
FT                   LVGLVAFLGWWVYVKKRGM"
FT   gene            complement(116225..119440)
FT                   /locus_tag="Caur_0091"
FT   CDS_pept        complement(116225..119440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0091"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: HEAT domain containing protein; PBS lyase HEAT
FT                   domain protein repeat-containing protein; SMART: Armadillo
FT                   domain protein; AAA ATPase; KEGG: rrs:RoseRS_1736 PBS lyase
FT                   heat domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33345"
FT                   /db_xref="GOA:A9WBD8"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBD8"
FT                   /protein_id="ABY33345.1"
FT                   /translation="MRQVCPRPERPSLAPSPPISEPSAQQATDTGYVAVGEGHASARSD
FT                   SVSVSDVASAPVIPLETILHTRRHLAILGEPGAGKSTTLQFIGLSYALATAQQPVERLS
FT                   ITRPAVPVYLRLPVSASTITQQTVREAMVAEVRDRLQCSAAEAEAVLRSWQEWPGVIIL
FT                   LDGLDEVPVALRVQVRERIKTLMRSGIGRVIITSRPSVLLHLGGLDEYTLKPFEHFDRD
FT                   VLPYLKGWLRVLKPDLQAQVVDNVAQDVMTKLRASPALRSLIGNPLLLRLIVQYFVTTG
FT                   DIAWNRADLYRQWVTEAWARARWRGAAATEEPHYLIALHTLAWHLHAGRDNTETALQTV
FT                   LRTSGLAADDRAAADLLHRLQAQTGLLLRLSTGQDGLAHVRYVFAHQTLREYLVALRLQ
FT                   QAWQRGKHRTWRFLQPRLHLPEWREPLALLVGLLTESEAQHLLRQILHAKSSEERLLCR
FT                   DLLLTANLAVESGYIHSVWESLAPKLARALRREHLSKETAAVLARVGKPAVPMLAQALN
FT                   DPSVEVRRAVVQALGLVGDAAVPVLAQALNDAQPEVRWAAVASLVAVGNAAVDTLVQAL
FT                   GDDDAEVRRVIGQALLEIGDAAMPALVKALADKRANVREAAARALGESGYAAAVSALVQ
FT                   SLRDENPWVRQAVAEALGAIGDAAAVVALAQALNDENVWVRQATARALGRIGGAAAMLP
FT                   LTVALNDENPWVRQAVAEALGTIGDAAAVLPLTRALSDEHAWVRRSAARALGQIGDGAA
FT                   VPALAKALSDGDVQVRQQVVEALGCIGDSAAAAALVKALGDTNAEVRWTTMKAFEQIGS
FT                   RNVATLLRAISDGKWQFPWQDAQAWKIGNQAIEAIGSVFNGGDTGKRMIATLALGETGN
FT                   SAALPALERALRDTDLWVRRAALEALAKIGDQAVIVPALERALRDTDQWVRQTAAEMLV
FT                   KIDDTAAVLPALERALRDADQWVRRTAAEALGKIGDASAVEALQRALADTESMGAAGRS
FT                   RGARKDRRCVGGGGAAKGIGRYRSMGAAGRSGGARKDWRCVGSGGAAKGIGRYRSMGAA
FT                   GRSRGVGEDRRCKSGSITDTVTE"
FT   gene            complement(119415..119777)
FT                   /locus_tag="Caur_0092"
FT   CDS_pept        complement(119415..119777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0092"
FT                   /product="PBS lyase heat domain protein repeat-containing
FT                   protein"
FT                   /note="KEGG: rrs:RoseRS_1736 PBS lyase heat domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33346"
FT                   /db_xref="GOA:A9WBD9"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBD9"
FT                   /protein_id="ABY33346.1"
FT                   /translation="MISLQLQQALQRLRDGICTSSDLEVVRAALQSGQIRLSTPTPGGA
FT                   IGGSGDAVLVVTRDGNVLQRLRGTAANQVKLADLTVRYLRAVIEDWQYLTVLTRGEDRR
FT                   VPLTGVFIYASGLPAT"
FT   gene            complement(121577..122044)
FT                   /locus_tag="Caur_0093"
FT   CDS_pept        complement(121577..122044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33347"
FT                   /db_xref="GOA:A9WBE0"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBE0"
FT                   /protein_id="ABY33347.1"
FT                   /translation="MARKDLDIRIKFLLIGAEVLFVGILSLMRIAITGWLVLIFGFLLI
FT                   AWVVFHLVLMSVFILNLRSSTMDMVLFITVHLSYLLAWLFQSDADDVRVRWVIQLFPFT
FT                   GGLEPFLAAWGGTLFLIATAVNLVCYAVIFILVIVRIVQFLVSLNKDAQAA"
FT   gene            122914..123741
FT                   /locus_tag="Caur_0094"
FT   CDS_pept        122914..123741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0094"
FT                   /product="naphthoate synthase"
FT                   /note="TIGRFAM: naphthoate synthase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; KEGG: gtn:GTNG_2771 naphthoate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33348"
FT                   /db_xref="GOA:A9WBE1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBE1"
FT                   /protein_id="ABY33348.1"
FT                   /translation="MPIEWVKVHDYTDIIYEHDAAGEGIAKITINRPEKRNAFRPETVN
FT                   ELIDAFSRARDDERIGVILFTGAGDKAFCSGGDQSVRGIGGYVGKDQIPRLNVLDLQRL
FT                   IRIIPKPVIALVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDGGYGSNLLAR
FT                   MVGDKKAREIWYLCRQYNAQQALEMGLVNAVVPLERLEDEGVQWAREILEKSPLAIRML
FT                   KASINAAADGYAGLQQLAGDATLLYYLTEEAQEGKQAFLEKRKPNFRRFRRYP"
FT   gene            124211..125116
FT                   /locus_tag="Caur_0095"
FT   CDS_pept        124211..125116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0095"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   rca:Rcas_2084 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33349"
FT                   /db_xref="GOA:A9WBE2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBE2"
FT                   /protein_id="ABY33349.1"
FT                   /translation="MTTKATSVPPSHLKIWLMASRPATLPAAVVPVLVGSALAYSSDAF
FT                   QPLVMLAALLGALFIQIGTNLANDYFDAQKGADTSERLGPVRVTQSGLLPARTVLTAAL
FT                   VSFGLAALAGIYLITVAGWPILVIGLLSIAAGILYTAGPFPLGYHGLGDLFTFVFFGLV
FT                   AVIGTDFAHTGQFRWIALWAALPIAMLVTAILVVNNLRDAPTDRKAGKRTLAVIFGERF
FT                   ARSEFAILVIGAFVSLPLAWMWGGASPFTLLAWLTAPMALNLIDFVNRERGRALNKALV
FT                   GAGRLHLAFGVLFAIGLLFG"
FT   sig_peptide     124211..124330
FT                   /locus_tag="Caur_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.855 at
FT                   residue 40"
FT   gene            125639..127102
FT                   /locus_tag="Caur_0096"
FT   CDS_pept        125639..127102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0096"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="TIGRFAM: O-succinylbenzoate-CoA ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: gka:GK2872
FT                   O-succinylbenzoic acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33350"
FT                   /db_xref="GOA:A9WBE3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBE3"
FT                   /protein_id="ABY33350.1"
FT                   /translation="MLIPDWLARRAALHPHRPALIYAGTTYTFAELDRWAGAVASHLRQ
FT                   LVTPGARVALLSRNRPGFVAIVHAAPRTAITLVPLNTRLTAAELAFQIQDSDPALLIIE
FT                   HDLLPVAREAAGNRPLIVLEELTAATTAPTAPAPPIDLDAMHTIIYTSGTTGRPKGAIL
FT                   TAGNHWWNAIGSMLNLGLHEDDRWLAVLPLFHVGGLSILLRGAIYGIPVILHERFDPAL
FT                   VRHDLDAQRITIVSLVAVMLQRLLAIDPSPFPPHLRCVLLGGGPAPQTLLEQCATRGIP
FT                   VTQTYGMSEAASQAATLSPAESLIRLGSAGKPLLPVELSIVTPSGQPAAPGEVGEICLR
FT                   GPNISPGYLGLPPRSPTDWFHTGDLGYLDQEGYLYVVDRRSDLIIAGGENIYPAEIEAI
FT                   LLSHPAIAEAGVVGLPDPEWGQRPVAAIVAQQPTTAEELIAYCRSRLAGYKVPRTIVFL
FT                   HELPRTAAGKLRRHELRAILLAQMSGNDH"
FT   gene            complement(131222..131860)
FT                   /locus_tag="Caur_0097"
FT   CDS_pept        complement(131222..131860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0097"
FT                   /product="protein of unknown function DUF1405"
FT                   /note="PFAM: protein of unknown function DUF1405; KEGG:
FT                   rca:Rcas_3542 protein of unknown function DUF1405"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33351"
FT                   /db_xref="GOA:A9WBE4"
FT                   /db_xref="InterPro:IPR009845"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBE4"
FT                   /protein_id="ABY33351.1"
FT                   /translation="MRQVRQLIDWIYALITGHPLLFWACMLINLFGVVWGGIVWYGPML
FT                   ASSPAWAWIFIPDCPAAALYATIAFILLRYGRQVPWFTAFAAFACIKYGLWTLAFWTRH
FT                   WLGAGTVEPLELMLFVSHIGLTCEGVLLATRIGPLGMTARAAVAAFFSLSILVDYGLGF
FT                   HPPLTWVVTPTFALWTAVILTSVLGFWLTRPSLVVAQRAEALGLQVPRE"
FT   gene            complement(131916..132455)
FT                   /locus_tag="Caur_0098"
FT   CDS_pept        complement(131916..132455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0098"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: rca:Rcas_3543 transferase hexapeptide repeat
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33352"
FT                   /db_xref="GOA:A9WBE5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBE5"
FT                   /protein_id="ABY33352.1"
FT                   /translation="MNAMLETFSSDDLGSTATRKARLQSVPVPGPHNALWYFPQLAGGY
FT                   LRIMRNAALIQLARYTPFIAVKNMIYRWLGVNVAPHASVGLMVMFDIFFPEDITLGENC
FT                   VIGYNTTILCHEVTRREWKRGPVVIGPDVTIGANCTILPGVVIGAGATVSAMSLVNRDV
FT                   PPGAFVGGVPIRRLDR"
FT   gene            132456..133331
FT                   /locus_tag="Caur_0099"
FT   CDS_pept        132456..133331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0099"
FT                   /product="Transcriptional regulator IclR"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: rxy:Rxyl_2850 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33353"
FT                   /db_xref="GOA:A9WBE6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBE6"
FT                   /protein_id="ABY33353.1"
FT                   /translation="MLRTTNVSFAVPVGKKDDFPLHYDWKEVLNGEKRMVQSLDRAFDV
FT                   LEALAFADDDLSVSELSEQLDLPLATVHRLLSSLAARGYVTQEASTRRYGPGPRLLEVA
FT                   ARAARSRRFDLIRIARAELVKLTAETGETSNLIVRQGDLAVYQEQIPSPHMVRMFTEIG
FT                   QRAPLYCTGGGKAILSALPIAELEQYLAGGHFERWTNRTITDPERLRAELMTARERGFA
FT                   LDDEEREEGVCCVAAPIFDRRGQVVGAISLSGPSTRLNRARAEELGPRVREAALACSRQ
FT                   LGFHTTLTGK"
FT   gene            complement(134516..135217)
FT                   /locus_tag="Caur_0100"
FT   CDS_pept        complement(134516..135217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0100"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: iron dependent repressor; FeoA family protein;
FT                   KEGG: rca:Rcas_3322 iron (metal) dependent repressor, DtxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33354"
FT                   /db_xref="GOA:A9WBE7"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBE7"
FT                   /protein_id="ABY33354.1"
FT                   /translation="MTPVEDPNLPGRITPAIEDYLKAIYLLQQQVGAVTTTLLGEQRGS
FT                   RPASVTGMIKKLAEMNLVQHTPYQGVILTPAGERIALEVIRHHRLLELYLVEALGYSWD
FT                   EVHEEAERLEHHISEKLEARIAERLGFPDFDPHGDPIPGIDGVLPTTRAIRLADLPLNQ
FT                   VARIVRVRDQAAERLRYLADLGLVPGARVTVVASAPFDGPLTVQIGTNEPTPLDRRLAR
FT                   TIEVEVESEAA"
FT   gene            135421..136197
FT                   /locus_tag="Caur_0101"
FT   CDS_pept        135421..136197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0101"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rle:RL0373 putative enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33355"
FT                   /db_xref="GOA:A9WBE8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBE8"
FT                   /protein_id="ABY33355.1"
FT                   /translation="MSEESLVLSTIEGPIAILTLNRPQALNALSPALIDDLIRHLEACD
FT                   ADDTIRVIIITGAGRAFAAGADIKAMANATPIDMLTSGMIARWARIAAVRKPVIAAVNG
FT                   YALGGGCELAMMCDIIIASENAQFGQPEINLGIIPGAGGTQRLTRALGPYRAMELILTG
FT                   ATISAQEALAHGLVCRVCPPESLLDEARRIAQTIATKSPLAVQLAKEAVRMAAETTVRE
FT                   GLAIELRNFYLLFASADQKEGMQAFIEKRAPNFSGR"
FT   gene            136350..138815
FT                   /locus_tag="Caur_0102"
FT   CDS_pept        136350..138815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0102"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: ppd:Ppro_2908 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33356"
FT                   /db_xref="GOA:A9WBE9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBE9"
FT                   /protein_id="ABY33356.1"
FT                   /translation="MDIHERLRSLERENALLRQQLSILRAQISANLAPNQLPFDTLFHQ
FT                   LPIPMVLFSLDGLAVAMNQANAQLVATPIDQVVGVYNIYNDPAAQKHGFVAAFESARRG
FT                   QITTMPPTPYNTAEARLEGRVVDQQFWSETTYFPVYDVANRLILIGEINRDVTDWIRVR
FT                   DEEHRLAIALRDRERRFATLFDQLSLGIVVIEESGRILDCNRAVTAILGVERDELIGKM
FT                   ILQRTHPDDRERDLELWIELLNGERDSYTIEKRYFHKDGHIVYARMTCLAVRDENGEIT
FT                   FLVRLVEDVSARREAEAAIETGRRLLQDIIDQIPALIFVKDAEGRYLMVNERLASFSGY
FT                   RPEEMIGKSDDELFAPALAAYYRAFDQEVIRERRPIQRDDDRWTADGLTAFTTVKFPLF
FT                   DHEGNLYGVAGISLDVTERRQLELERERIEQRLREAQRLESLGVMAGGIAHDFNNLLVS
FT                   VLGNVSLALNEVSADHSLYDLLVQIEQAALRATELTNHLLTYTGRHQPVMQRIDLRRAV
FT                   DEMQTILRSLVPHRIELIFHPSATPLPIEANIAQVRQVLMNLVINGAEAIDGAGIVRIT
FT                   TELRELSATDMQKMEIGADQPPGRYAALIVQDTGHGMDELTKARIFDPFFSTRFTGRGL
FT                   GLAAVNGIIRAHRGALKLDTTLHAGTTFTIFWPLATAPDVSDDPPLPSPSTVTSQPETT
FT                   PGDGRMVLLVDDEPQVRQVAQRMLRRLGFTVHEAENSDIALQLMQEYGSQIVLALIDLT
FT                   MPGMTGDELATTLLEQFPTLRIILMSGFSQQELPPHLRTSGRVSFLAKPFTLTTLTAAV
FT                   TTALSSHTV"
FT   gene            138858..140105
FT                   /locus_tag="Caur_0103"
FT   CDS_pept        138858..140105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0103"
FT                   /product="Xaa-Pro aminopeptidase family enzyme"
FT                   /note="KEGG: slo:Shew_0499 Xaa-Pro aminopeptidase family
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33357"
FT                   /db_xref="GOA:A9WBF0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBF0"
FT                   /protein_id="ABY33357.1"
FT                   /translation="MTITPIEPSLRRQADVQNQWLAERLATLLPVLMERTGIDLWIVVA
FT                   REYNEDPVIMTLLPAPAMNARRRTILIFARRDDGVVDRLTLDRYGYGDLYQQVWNPDTE
FT                   SQDDCLARIVGEYDPQRIGINTSATFAFADGISHHEYERLLAALGPLAARCVSAEPLVI
FT                   GWLERRIPAELAVYAELVALGHRLIATAFSRAVITPGITTTDDVVWWLRQTMHEAGLRA
FT                   WFQPTVSIQARGMPFNTPATRNRIWPGDLLHCDVGFCHLGLCTDQQQHAYVLARGETAP
FT                   PPGLVTALAQANHLQDIVMAEMQVGRTGNQVLAAARERAISAGLQPSIYSHPLGFHGHA
FT                   AGPTIGLWDRQDGVPGAGDYPLYDETVYAIELNNVAIVPEWDDQPVRIALEEDAVLTGG
FT                   RMEWLHGRQTQLHVIE"
FT   gene            140184..141551
FT                   /locus_tag="Caur_0104"
FT   CDS_pept        140184..141551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0104"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rca:Rcas_2058 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33358"
FT                   /db_xref="GOA:A9WBF1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBF1"
FT                   /protein_id="ABY33358.1"
FT                   /translation="MAVPETDTRRAIMTVLFVGVFMSALDSAIIGPIVPALRAAFAIDN
FT                   TQVVLVTIIFTLCSLSSTTLMASLSDRYGRRNVYLLNVFGFALGSLIIALSHDLTMVLI
FT                   GRALQGVCAGGITPTASAVIGDVLPSAERAKALGLIGATSGMAFLVGPVLASLILAVAA
FT                   WQWIFLLNLPVAAAVIFLGWRALPRATAVHRATAATAFDWPGLTLLVLILVSITLGINQ
FT                   LLDRLLGLTLWPWLFLLVALLTPLLAWREVRAPVPLLPPRLFTNRQLQIVYLLAAGSGI
FT                   AMGSIIFITSVAVNFGVPISQAGFFLLPLVFLASVTSIIAGRILPRIGGRMAMLIGYGQ
FT                   LMIGTGLLGLPAAPFWLFILATLIMGSGLGIVVGGTLRALVLEEVAAGDRGVAQSVINI
FT                   AISIGTLIAVALMASIADAFDLSTAYLACTGAMALMTAISLALRRQFSPPSTANAS"
FT   gene            141613..142758
FT                   /locus_tag="Caur_0105"
FT   CDS_pept        141613..142758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0105"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rrs:RoseRS_4045 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33359"
FT                   /db_xref="GOA:A9WBF2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBF2"
FT                   /protein_id="ABY33359.1"
FT                   /translation="MRVALVHDYLNQYGGAERVLEALHDLFPTAPVYTSIFDPTTMPAA
FT                   YRTWDIRTSFMQQLPAWRTQFRRYVALYPTAFERFDLSGYDLIISSSSAFAKGIIPRPG
FT                   ALHICYCHTPMRFAWRTDDYVAREQINGIQAHLLPFLLNYLRIWDTVSANRVDLFVANS
FT                   HEVAGRIARYYRRPAKVIPPPVDLPPYEPQPPEEFYLAGGRLIPYKRLELAIEAFNRLR
FT                   LPLKIFGDGRDRARLERMAGPNIEFLGWVDEATRLDLFARCRAFIFPGEEDFGITPLEV
FT                   LAVGRPVIAYAAGGALETLIEGVTGRFFYQPTAAALAAAVALSRTDTIDPLVLRHHAEQ
FT                   FSRERFLNTFRNFVTEALTAQREGRLFEFEQSLTGQRLLAV"
FT   gene            142857..143489
FT                   /locus_tag="Caur_0106"
FT   CDS_pept        142857..143489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0106"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   rca:Rcas_3666 lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33360"
FT                   /db_xref="GOA:A9WBF3"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBF3"
FT                   /protein_id="ABY33360.1"
FT                   /translation="MELTTLLRIVRRFWLLMLVPALIAGGLSLWFDLQQPPRYTATARL
FT                   LITYPATTATDSAEIWQITEYIIDDMPQVVSSASFAAKVSPLLATRNINLTLAEIQQGL
FT                   RINPLHRAVDISGEASSPAAAQALVEAAITVLQTEGLTFWGRTDTQLSVVVLDGVGTPQ
FT                   PATSLRSVVFDAALRTALGLIAGFALAVAATVLYERRENRLWKSATM"
FT   gene            143468..144121
FT                   /locus_tag="Caur_0107"
FT   CDS_pept        143468..144121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0107"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   rrs:RoseRS_4043 lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33361"
FT                   /db_xref="GOA:A9WBF4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBF4"
FT                   /protein_id="ABY33361.1"
FT                   /translation="MEIRDYVNVLVKRWWVIVLTAIAAVGSAYVISKLLPQTYRSQAVY
FT                   LALANQADNGLNIVLRNSMNSYRELVMQPSVLDQISQQIGLDISGERLMEDVNIQPRPD
FT                   EQKIVIEVDLPRLDQSQALADAVGERIVAEVNRINATLEGTARINVTRIQPARLVEIRP
FT                   NTRINMLAGAILGLVLGIVLAFVLEYLDDTLKTSEDVERFVGLPTLGAIPLSER"
FT   gene            144194..144838
FT                   /locus_tag="Caur_0108"
FT   CDS_pept        144194..144838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0108"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="TIGRFAM: capsular exopolysaccharide family; KEGG:
FT                   rca:Rcas_3668 non-specific protein-tyrosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33362"
FT                   /db_xref="GOA:A9WBF5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBF5"
FT                   /protein_id="ABY33362.1"
FT                   /translation="MIVTSSSEQVLITLREPASAAAEAYRTLRTNILFSSLDKPIHTLL
FT                   ITSAEPTPEKSLTAANLAVTMAQAEQRVLLVDCDLRQPMLHTIFGLANEQGLTSAILDQ
FT                   EAPLAIQPTEVPGLSLLPSGPLPPRPADLLGSRRMEGLLHRLRQAADIVIFDTPPVQNV
FT                   TDALVLSTRVDGVLLVVQAGRSRRDRVREARQKLEKVKANLLGVVLSNARL"
FT   gene            144907..145593
FT                   /locus_tag="Caur_0109"
FT   CDS_pept        144907..145593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0109"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rca:Rcas_1176 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33363"
FT                   /db_xref="GOA:A9WBF6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBF6"
FT                   /protein_id="ABY33363.1"
FT                   /translation="MQPTILVVDDEASIRNVAKAYLEHAGYRVLCATTGPEGLQMALEE
FT                   QPDLIVLDLMLPGMDGMEITARLRERSDVYILMLTARSDEMDRVAGLRVGADDYLTKPF
FT                   SPRELVARVEAILRRQRNKTAKSSLMRFTHVEIDPEAREARANGQLLELTPTEFDLLLA
FT                   LARNHNRVLSREDLIEKVWGADFFGTDRVVDVYVSQLRRKIEAITGENVIRTARGVGYR
FT                   FVDTPA"
FT   gene            145630..146682
FT                   /locus_tag="Caur_0110"
FT   CDS_pept        145630..146682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0110"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: rrs:RoseRS_0804 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33364"
FT                   /db_xref="GOA:A9WBF7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBF7"
FT                   /protein_id="ABY33364.1"
FT                   /translation="MRFWRQLRWQMIGAQMLVVVVGVVTLNLTANILIEQSIAPDQVAT
FT                   VRTAVVQALTVAAVAATIAGLTTSILLVQVILRSLRSIARSSRRIAAGRYDERVTVPAS
FT                   DELRAVAESFNQMAEALEQIEQRRITMIGNVAHELRTPLAGIEGYLEGLIDGVLPNTAD
FT                   TFLDMKQEVRRLRRLVDDLQTLSRVEAGQIALHFTTFDVNDVIRRVVAQIQPQVLDSCL
FT                   QVQFAPDQQPILVHADADRVAQILLNLLGNAVRYTPEGGCITVRSELNNDNVQVIVEDT
FT                   GIGISAEHLPFIFERFYRADPSRARTSGGSGIGLTIARHLAWAMGGDISAASAGIGKGS
FT                   TFTLTLPRAG"
FT   gene            147218..147328
FT                   /locus_tag="Caur_0111"
FT   CDS_pept        147218..147328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33365"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBF8"
FT                   /protein_id="ABY33365.1"
FT                   /translation="MQTLQPKNPYVRIALRRAARGTGSSDAFLDQRTALQ"
FT   gene            147383..147853
FT                   /locus_tag="Caur_0112"
FT   CDS_pept        147383..147853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33366"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBF9"
FT                   /protein_id="ABY33366.1"
FT                   /translation="MALRAYAPERLTQDVDIIIHARDEQVARAAFTAAGYRIGNPLPIS
FT                   RFTAHPQDETGYSIDVLVLNEPWLDEALAQPVCDCAGFPVLARQFLILMKLQAGRAQDI
FT                   ADITRLLRRTDHTERSIARTTVATYAPDLIDDFDALVVLTDLEFGTESSAAT"
FT   gene            complement(148444..150741)
FT                   /locus_tag="Caur_0113"
FT   CDS_pept        complement(148444..150741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0113"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   rca:Rcas_1673 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33367"
FT                   /db_xref="GOA:A9WBG0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBG0"
FT                   /protein_id="ABY33367.1"
FT                   /translation="MARLIALRSILLLVVVVLVSRLAQLQLIETDTQRFGADIEVTTRR
FT                   YLTNQPRRGEIFDARGVLLAESVPIYNLAVIPGQLPSSSAAPEQRALTLARLAQIAELP
FT                   ATLVIDPGTAIDTTPGLRSDLRSFGSLPTASDVVTMTIAPSDVLRALDVSQKYRDVATL
FT                   VNPIEQLLTQANVRSYQPIVIKEDISPELALALRENANYLPGARVVEGFRRRYPLSGEI
FT                   PSLSHLLGYVGRINACELVAVNPASSWLRALTDITANAPTCGLMAKSIEPTSVGLPPYL
FT                   SSDQIGKDGLEGAYESVLRGQMGIDSLLVDALQRPVSGVTTLRAVANGHDLILTIDTRF
FT                   QAEVERILQRWINVGEERRLAAREAHKRAYEPIVAGVAVALDPRDGRILAMVSLPDYDN
FT                   NIWVDPARIAELQALLAPPDAETQQTLQRLAPFTNRAIAGLYPPGSTVKQFVGAVALQQ
FT                   GIIAADTQLRDPGLLRLIERSGAEFILPNSVRNRDNGLINVRDALRLSSNVFFASIAGG
FT                   NDQAINLDQRALRITGLGIDQLVEGLSWFNFGRPTGVDLVGEASGRVPTQAWKAQVLRE
FT                   AWTTGDTYNTAIGQGYLEVTPLQLAVAAGAVATDGTLYRPHLVDRIVDENGQLIQQMQP
FT                   EAIGQVPIDPRHLAAIREGLFASITDGLGVAAREVCSGLRIAGKTGTAEFGPLLTTADG
FT                   RLVRQSHAWFVGFAPYENPEIVVAVLVEGVGDLNDGSSTIAVPAVTQIMQAYFGITPPA
FT                   NRPAICPVLPGE"
FT   sig_peptide     complement(150670..150741)
FT                   /locus_tag="Caur_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.539 at
FT                   residue 24"
FT   gene            complement(150787..151326)
FT                   /locus_tag="Caur_0114"
FT   CDS_pept        complement(150787..151326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33368"
FT                   /db_xref="GOA:A9WBG1"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBG1"
FT                   /protein_id="ABY33368.1"
FT                   /translation="MGNSQPRRLEERLARELGLLLILLVIALIQVTLLTGPTGFSVPIL
FT                   LVLAIARALVGSSTAEPVRGLIRSLWWAFYGGLALDVLGSLPIGSHAIAQLLAVIVVGL
FT                   ATRRFAVERPIVPLLAVAFGTLIYEAVLWLIVLPPISDWQTYGLIVMLPSLLLALIPTL
FT                   PVVAIVHRLVRNTEYQ"
FT   gene            complement(151299..152207)
FT                   /locus_tag="Caur_0115"
FT   CDS_pept        complement(151299..152207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0115"
FT                   /product="Rod shape-determining protein MreC"
FT                   /note="PFAM: Rod shape-determining protein MreC; KEGG:
FT                   rrs:RoseRS_1282 rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33369"
FT                   /db_xref="GOA:A9WBG2"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBG2"
FT                   /protein_id="ABY33369.1"
FT                   /translation="MRDFLDERPLKLRREVAGDRGYWRVFALALSLVLVSVLLIVLDRQ
FT                   GVIAPARLMVRETIQPLAGWLTQRRSELLSWWATPRDAATMQARIAELEAENTRLAAEV
FT                   LRLEQARVENIFLRQQLAITQSYPWTILGAEVMIRAPDAARRVLTIARGANDGVRVGMA
FT                   VIGQQPGGPPALIGVVEAVGPRTADVLMITDISSQLSVRLLQADTAPLGLMQGQWQRGS
FT                   RMRVELIDRSITMREGDHVVTAGISGALNLPLDLASMPTAVPIGVVEAVRQEGQRQIGE
FT                   IRPFVDPDQVRYVWVILSQDD"
FT   gene            complement(152211..153290)
FT                   /locus_tag="Caur_0116"
FT   CDS_pept        complement(152211..153290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0116"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: rrs:RoseRS_1283 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33370"
FT                   /db_xref="GOA:A9WBG3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBG3"
FT                   /protein_id="ABY33370.1"
FT                   /translation="MGLNPFNTIFGAFSRDLGIDLGTANTLVHVRGKGIVISEPSVVAI
FT                   DTRTKKVHAVGAEAKAMVGKTPANIVAVRPLKDGVIADFDVVEQMLAYFIKKAHTYAAL
FT                   PLIDPRPRVVVGVPSGVTEVEKRAAREAALNAKAREAYVVEEPMAAAIGAGLPVEEPIG
FT                   SMIVDIGGGTTEIAVIALGGIVINHSIRIAGDEIDEAIIQFARREYNLLIGERMAEKAK
FT                   IAAGSAYPLDEEIKVVLRGRDLLTGLPKAIEVSSVELREGIAGPVNAIVAEVRAALEET
FT                   PPELVADIMEHGIMLAGGGSLLHGLDKRIAAETKMPVHIAQDPLSCVARGAGKMVEHFD
FT                   NSVYQDILMRTQTTRRVRR"
FT   gene            153639..155729
FT                   /locus_tag="Caur_0117"
FT   CDS_pept        153639..155729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0117"
FT                   /product="Magnesium chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="KEGG: mba:Mbar_A1776 magnesium-chelatase subunit;
FT                   PFAM: magnesium chelatase ChlI subunit; von Willebrand
FT                   factor type A; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33371"
FT                   /db_xref="GOA:A9WBG4"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012804"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBG4"
FT                   /protein_id="ABY33371.1"
FT                   /translation="MNITNLPQRPVYPFSAIVGQERLKRALILNAINSRIGGVLIRGEK
FT                   GTAKSTAVRALTRLLPSITVVVDCPYSCDPDTPAALCADCQERLKQGPLPTMVRPIRLV
FT                   ELPVSASEDRVVGSLDLEHAITEGQRRFEPGLLAQVNRGVLYVDEVNLLDDHLVDLLLD
FT                   AAAMGINTVEREGVSVSHPARFILVGTMNPEEGELRPQLLDRFGLAVEVVGLTDVNDRI
FT                   AVIERRMAYEADPIGFIQQWQAAEETLAQRIAAARALLPHVRIDRTDMAVVASLCIEMG
FT                   VDGHRADLTILETARTHAAWSGRRTLVAEDIRLAAELALPHRMRRQPFGEVKLDEQRLA
FT                   SILDQYGKRAEEVSVQAEVKKNPDLTDVSETNDEGGNESGGGSTTMPLGGAGQPEATAP
FT                   VSEQQTGGTQHRAGDLFKPRRLEATPDRTQRRAPGRRSRSRTTRKQGRYITSRRATKVT
FT                   DLALDATLREAAIYQRKRRTELLHTVGMPHRRRPKILIKRTDLRQKVRVRRTRNAVCFV
FT                   VDASWSMAAEERMQATKAAVLSLLRDAYQRRDQVGLVSFQRDYARVLLPLTNSVELAQR
FT                   RLQSMPTGGKTPLSRGMLTAFELLERARRRDAEVVPLMVLLTDGQANVSISDLPPQQEA
FT                   YRIAEMIAEHQIHAIVIDTEHPHFERGLSRRLAEYLRGTYYRLEDLHDDGLVRAVRQQM
FT                   RS"
FT   gene            155819..157381
FT                   /locus_tag="Caur_0118"
FT   CDS_pept        155819..157381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0118"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   rrs:RoseRS_3968 RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33372"
FT                   /db_xref="GOA:A9WBG5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBG5"
FT                   /protein_id="ABY33372.1"
FT                   /translation="MTDQVRREEVAAGELPDTPHTAASAPAAEAAVAAHEQAAEAAAPT
FT                   PEEEAVLPAATGEADASATAPTAAGESASSGSEATGASFTPVSDDQPHKPRRLKDLQPG
FT                   MELEGKVTSIALYGVFVDIGVGRDGLVHISEMSDRRIETPSEVVQIGDTVKVWVKSIEP
FT                   EARRISLTMRDPARAETPRRARQPQPQQQQPRRQEVDREKLAALRVGDVVEGVITGFAP
FT                   FGAFADIGVGKDGLIHVSELAEGRVEKPEDAVKVGERYQFKILEIDGEAARISLSLRRA
FT                   LRTQRMQQLETGQILEGTVSGIAPFGAFVDIGVGRDGLVHISALAPHRVEKVEDVVKVG
FT                   DKVKVKVLGVDQQSKRISLTMRLEEEQPASETTTEPATTPAEPAPARAGRSNMERFAAA
FT                   AQAARERSERGERGERGERSERGERGERGERNERRDRRDRRAAQTAPETYVVGEDDDET
FT                   FEGNATLEDLLTKFGGSSNRRDRDRDRRRRDYDDDEDDMERPTNRRQRDAIRRTLQQIG
FT                   HDE"
FT   gene            157515..157688
FT                   /locus_tag="Caur_0119"
FT   CDS_pept        157515..157688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0119"
FT                   /product="ribosomal protein L34"
FT                   /note="PFAM: ribosomal protein L34; KEGG: rca:Rcas_1423
FT                   ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33373"
FT                   /db_xref="GOA:A9WBG6"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBG6"
FT                   /protein_id="ABY33373.1"
FT                   /translation="MPKRTWQPKRIPRRRKHGFRARMATKDGREVLRRRRLKGRWKLTV
FT                   SDERRAVRRGHR"
FT   gene            157782..158189
FT                   /locus_tag="Caur_0120"
FT   CDS_pept        157782..158189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0120"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; KEGG: rca:Rcas_1424 ribonuclease P
FT                   protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33374"
FT                   /db_xref="GOA:A9WBG7"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WBG7"
FT                   /protein_id="ABY33374.1"
FT                   /translation="MRRAYRLRRPEQFRRVRQEGRTFTSPWLILTVAPARRRTLRCGFV
FT                   VSRRVGGAVQRNRARRRVREAVRLLLPRLTAGYDMVFTIRTPEVIDAPFTQLQDDITAL
FT                   LRQACLLPAPTNETVSPVSDTPLPQHERGSQ"
FT   gene            158186..159130
FT                   /locus_tag="Caur_0121"
FT   CDS_pept        158186..159130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0121"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; KEGG:
FT                   rrs:RoseRS_3965 60 kDa inner membrane insertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33375"
FT                   /db_xref="GOA:A9WBG8"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBG8"
FT                   /protein_id="ABY33375.1"
FT                   /translation="MNIWSAFVGLLEQLLLFFSSLTGNMALGIVLFTIAARLFILPLTL
FT                   SSLRSSRRMQEVQPILKEIQRKYGKDPQRLQEETLRVYREHKINPVGGCLPLLLQLPIF
FT                   FGVYQAVYHLMVPEQRVNLSAAAAEMLKDERLAQILAAPFFGMDLGVPAFGPNGFAGFA
FT                   YLILPVLSIVLQLMQQLMATPRVQDPQQKAFTQAMLIMPFVFGYIAFTFPTGAVLYWVV
FT                   SSVVGVVQQYFTSGWGSLANYLRFLPPDNRPTPTLALASASTGSTSESQPETPKIDFWS
FT                   VMRPLTEAAVEESDPTHTEQRPSRQHPNPRRRR"
FT   gene            159170..159838
FT                   /locus_tag="Caur_0122"
FT   CDS_pept        159170..159838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0122"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; KEGG: rrs:RoseRS_3964 single-stranded
FT                   nucleic acid binding R3H domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33376"
FT                   /db_xref="GOA:A9WBG9"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBG9"
FT                   /protein_id="ABY33376.1"
FT                   /translation="MKRIEISERTVAEAVELALAQLGRDRDEVAIEVLDPGENGDEALV
FT                   RVTVVEDEEEAPSVEKVSEIAQRVLEDLLERMDIHAYVTAVISHATGPNGEPEATITLH
FT                   VEGADEEAMGLLIGRRGETLRSLQFLLNLLVSRRVQKWPQLVVDVGNYRQRRQESLESL
FT                   ARRMAERVRQTGRPIMLEPMAAYERRIVHLALRNDKTIYTESSGEGENRKIVIYPAKHS
FT                   "
FT   gene            complement(160491..160874)
FT                   /locus_tag="Caur_0123"
FT   CDS_pept        complement(160491..160874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0123"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: rrs:RoseRS_0783 globin"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33377"
FT                   /db_xref="GOA:A9WBH0"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR019795"
FT                   /db_xref="PDB:5D1V"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBH0"
FT                   /protein_id="ABY33377.1"
FT                   /translation="MSEPTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPADLEPGK
FT                   EHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEP
FT                   ARSVMENYFRHAAQAMMNRLGED"
FT   gene            160995..161870
FT                   /locus_tag="Caur_0124"
FT   CDS_pept        160995..161870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1925 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33378"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBH1"
FT                   /protein_id="ABY33378.1"
FT                   /translation="MSYETLTITSRRLRLTVLAAGGPRILALHLDNGPNLLAETPNARW
FT                   ETPWGEFVLLGGHRLWHAPEAFPRSYWPDLNGPAAEQIDHGVTLRSAVDPGYIAKSLTV
FT                   TLDPEQPRLHLQHTLTNHGLWPVELAPWAITQLAPGGKAILPLHNGQPPANPLLPNRQI
FT                   AFWPYTPLPDPRLAFCDDFILIDTAIAGPPAKVGAHSAAGWLAYLHQATLFIKRTVYQP
FT                   AAHYPDNNCNLEIYYDRGCTELETLAPLCRLDPGASVSHTEIWQVIPWTDDLDQSDLFT
FT                   TLAQRAAEMV"
FT   gene            162312..163511
FT                   /locus_tag="Caur_0125"
FT   CDS_pept        162312..163511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0125"
FT                   /product="arsenite-activated ATPase ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="KEGG: plt:Plut_1173 anion-transporting ATPase;
FT                   TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33379"
FT                   /db_xref="GOA:A9WBH2"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBH2"
FT                   /protein_id="ABY33379.1"
FT                   /translation="MRTLIFTGKGGVGKTSVAAATALRAADRGLKTLVMSTDPAHSLAD
FT                   SLDLEGPLGPEPVRITKNLDALEVSIYHDIESNWGIVREHFAQLMAEQGVQGILADEMS
FT                   VLPGMEEAFPLIRIKKHKERGDYDLLVIDCAPTGETLRLLSAPETFKWAINMLRGAERY
FT                   VIRPLIRPMSKITPGLNKMVAPPEVYDAVDEMFRQMEGVTATLANPRETSIRLVMNPEK
FT                   MVIKESQRALTYLSMYGMTVDMVVVNKILPLDQDSGYLNHWRDVQQRYLQDVEHAFVPL
FT                   PIRRVPYYPEEVVGLEKLRQMGDDIYGDMDPTAVLYDRAPLDIAKVGDKSYRVKIRLPF
FT                   ADVSQLDLYQNGDELVIQIGDFRRVITLPTSLAGLEAGQAEMEGEWLIVPFMAPQMAQR
FT                   "
FT   gene            163594..163836
FT                   /locus_tag="Caur_0126"
FT   CDS_pept        163594..163836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0126"
FT                   /product="bacteriochlorophyll C binding protein"
FT                   /note="PFAM: bacteriochlorophyll C binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33380"
FT                   /db_xref="GOA:P09928"
FT                   /db_xref="InterPro:IPR001470"
FT                   /db_xref="InterPro:IPR038387"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09928"
FT                   /protein_id="ABY33380.1"
FT                   /translation="MATRGWFSESSAQVAQIGDIMFQGHWQWVSNALQATAAAVDNINR
FT                   NAYPGVSRSGSGEGAFSSSPSNGFRPKRIRSRFNR"
FT   gene            163897..164985
FT                   /locus_tag="Caur_0127"
FT   CDS_pept        163897..164985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33381"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBH4"
FT                   /protein_id="ABY33381.1"
FT                   /translation="MINLLYYSHTTVPAHLEEITRLDVLDPDEQVLVAIDGVLVDQQGQ
FT                   RLSGPTLHDYCLITDLRVILWARDYGRHLCYAFPLHELTLIDGRGIDPIHGAVTMGFSA
FT                   PDTDDQIFTLTLVPQAYVPALMVLLRTAAETARSALAAGIDARQAAPDVMTALGAAIYG
FT                   SEDALRIDETPYRWPGGAARTPAAPNALFAIDPANLPPNQIFTAGRLARSAWDTLRRTL
FT                   READLPFDLSPTSIRELTDAIRAVNDLVQTVANNPAAQQIALAFLNRQMGNQQSTAPSP
FT                   PVEPPTPEATPAPHRYHEIPLRRRATPSREPAMTQPTATASSPLNITDRREIPLRRRTT
FT                   PLHRTSLAALSGSGDADQDRTT"
FT   gene            165028..166371
FT                   /locus_tag="Caur_0128"
FT   CDS_pept        165028..166371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plt:Plut_0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33382"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBH5"
FT                   /protein_id="ABY33382.1"
FT                   /translation="MRPFLGVNVSMASVEEMQQRGLLEEGETLLALFDGTLLDEQRRRI
FT                   GGLALADFVALTDRRLILWARGFFNDTVDGFPWSDVDVVRAETWDPWHGRVSLALRIPA
FT                   TPPRKRRVALGEVQEAGQPERVIINTLDYMPVEDVDVLAKMVAWVGDQVVAGVTGEELI
FT                   KAFEAEFPAVERKPLPPFFLASEPAPPPMPEPAPQQPKKKPWWKFGAADKEEEATPASP
FT                   GNLIAAYERQRSGSGVSPETPPAPVGPLPTLPEQPNMYEVSRSLRLMLEVPRGLARGMR
FT                   RASEILSGATELINNMQDPRVRRNAMRGLYYAAAQQEAEGGPLAPVGPVVRAAVRFAEP
FT                   TEQQSAAEPPQRRIAVRAAVRQSSPAPAPEPTTTAPAATDNPATPANQPVRRAISIRRS
FT                   ETPDSGQDGSVPVRRIVVNRTDRPATVSGSGTGITPETRNGHNDSDAE"
FT   gene            166418..167641
FT                   /locus_tag="Caur_0129"
FT   CDS_pept        166418..167641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0129"
FT                   /product="Arsenite-transporting ATPase"
FT                   /EC_number="3.6.3.16"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: cch:Cag_1412
FT                   anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33383"
FT                   /db_xref="GOA:A9WBH6"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBH6"
FT                   /protein_id="ABY33383.1"
FT                   /translation="MTRVIIYSGKGGTGKTTLSAATAVMLAQAGRRTLVLSSDPAHSLA
FT                   DVMGIAISRDRPTPLAPHLYGLEVDTIYEWRQNLGGFQQFVTATYSARGIERSTAAELA
FT                   NQPGLDEILALQRVMDEAQSGRWDAIVLDTAPTGNTLRLLAYPEMIIGGEAGKRLFRVY
FT                   RGIANVARPFRRDLPDDRFFEEVGKLLERMDQLANFLVSSNVSVRLVLNPERLPLLETR
FT                   RAYTFLSLYGLQLDAVLVNKILPHRTDLGPYFDYWVNLQQQYLAEIESSFAPTPIFRTV
FT                   LQGGEPIGVEALLHVGRLTFGEVDPGALLYDERPIWLEQWSDDGEPGQYDLCLRLPFLD
FT                   PGEAIEVSHSGPDLTIVVGRLERTIALPRVLYDCTLGDYRYEDGVLRLAFYEANVVRTA
FT                   NKQQVEAA"
FT   gene            167713..168816
FT                   /locus_tag="Caur_0130"
FT   CDS_pept        167713..168816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0130"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: rca:Rcas_0926
FT                   ATPase involved in chromosome partitioning-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33384"
FT                   /db_xref="GOA:A9WBH7"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBH7"
FT                   /protein_id="ABY33384.1"
FT                   /translation="MRTLIFTAHHQLQQSAAALATACHAARRGYRTLLASSGPGHLIGH
FT                   LLHQSLGARPLELEPNLAAMEIHPHEEVARRWEQVRPSLRSGLVARLRDLGPDELPAFP
FT                   GIDAVAAMLVAERARQSGRFDLLILDGPAPDALIRALTLPDVLRWAVRLIFGLDRGPGK
FT                   SRASQEQAMIPAAILAPSATAPLQELRIELETQRARLETESGARVRMVVLPPELRLPPL
FT                   RSALTAFGLYGMASDEVIVNGSPDQVDDESRHDFSHETSRARPLLRIGQLDLTPTDRDS
FT                   WALRGAALYRDGDIFATEPPRPQSSERDMRLLIPFLDPKALDIAVASEEVVVQLGQMRR
FT                   HVLLPGLVDGGRLRARVEGEQLRLWVE"
FT   gene            168831..169838
FT                   /locus_tag="Caur_0131"
FT   CDS_pept        168831..169838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0131"
FT                   /product="alpha/beta hydrolase fold-containing protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pvi:Cvib_1124
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33385"
FT                   /db_xref="GOA:A9WBH8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBH8"
FT                   /protein_id="ABY33385.1"
FT                   /translation="MSVLAQPVPFERPPARPVDAPPTAKYVAYANEVATRLAGRLSGRE
FT                   RRRLEGERALLARARFIELNGVVHHYQDVGPSDGQPLVLIHGWDCSSFWWHHVVDPLAQ
FT                   AGYRVISYDLKGHGFSDTDPRQNYTVAGFSADLQALIRALDLGAVHLAAFSLGAFVGLH
FT                   VAAHHPDMVRSLIFFNFSLLPYNKLASAFVPRLLDVVFNRVLRPIERRNLWWLPFIYAR
FT                   LVMAQHTPSISDIRLGTLGLRYCDPAAVRVSATELSRPEILNAVAEQARMIRQPLLLVA
FT                   GANDPIMRPADGRKLVALTPNGSFLEVPKCGHLILFELPEQVIQIMRLFLKSVR"
FT   gene            169851..170732
FT                   /locus_tag="Caur_0132"
FT   CDS_pept        169851..170732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33386"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBH9"
FT                   /protein_id="ABY33386.1"
FT                   /translation="MQLLLRSGGQQLIIDMERADDRPLTVGQYTYRPRRLAGKVRRLAT
FT                   KMWPDLPPTVLAERLTFEAMDTVRDTAWSDSGSFSPRSGSVVLLGRWDEDGSVGIALHE
FT                   LAHEMHLYHGGYDDSDGVVREAVAMLAEREAGLRRTFEREPYHSACQLVEQLESLSAFN
FT                   RLSFPKRWAEVISVTSMVGLADLVNYYLDRSERLGLARWLDRLTKNIDVRDQLLARLAT
FT                   TSLRYSLALRRVLIKKLVRCKPETPVEQLLYVLDSIATLDRRYPNDDLEQIINFCFAPY
FT                   VPQRRRLFAFGS"
FT   gene            170748..171464
FT                   /locus_tag="Caur_0133"
FT   CDS_pept        170748..171464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33387"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBI0"
FT                   /protein_id="ABY33387.1"
FT                   /translation="MNRFNEDNDTVRWLPGFVRRWFGLTDETPQRREAAGPGWMPGWLQ
FT                   RFFGLTYEEPVRYTDEGTPSVSSRTTYTPPPRSYTPGTPSFTPTPRGFAPASYRPTSGE
FT                   GTPSTPTQRSLAGDELPTDIQPIGYLLRSYARGALPPQGLEAFTREVRTTTEKVFNFYG
FT                   HWLRFQTEELFRIGGDLCNAVINALPGEPAKPQNQTIRRIKVVADNGNGSSNATSTAQT
FT                   GSAETTTEPERSEDKE"
FT   gene            171489..172154
FT                   /locus_tag="Caur_0134"
FT   CDS_pept        171489..172154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0134"
FT                   /product="putative lipase"
FT                   /note="KEGG: tel:tlr1982 probable lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33388"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBI1"
FT                   /protein_id="ABY33388.1"
FT                   /translation="MGGWLSSPADYFGMARILAAPPYNRIVYVVNFSRLDWLALRDPNF
FT                   GPALDALAATVQIALSETGADTIDLIGHSAGGRIARAYLADEPYQGVRYAGHKVVASLT
FT                   TLGTAHATSEVWVKQFADWLEARYPGAAFPHIRYRAVAGRSVRGRRFGSPEEMIAYRSY
FT                   EVSFGNGNLIGDGIVPTAACYLAGADNLILEGARHAPYNAPATWYGARDVVPLWFDAG"
FT   gene            172163..172876
FT                   /locus_tag="Caur_0135"
FT   CDS_pept        172163..172876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0135"
FT                   /product="putative lipase"
FT                   /note="KEGG: tel:tlr1982 probable lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33389"
FT                   /db_xref="GOA:A9WBI2"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBI2"
FT                   /protein_id="ABY33389.1"
FT                   /translation="MVRPLVIIGGYLTSPNDFSALAQALSQPPFDFRVFVTPIGRLRWA
FT                   LTRDWDFRPVLRIVRETVAQALHETGAETVTILAHSVGGTVARMYLGDQPYKGEIYGGH
FT                   RFVDHLIMLGTPHHSQEFWTRQTVGFTNRSYPGAYYRHIRYTSIIGRSIQANRKGRWIE
FT                   RMAYNSYVMIDGPAGAQAWGDGITTLRCAALAGAEYLVVPGLHHSPIHGRPWYGDPDGL
FT                   REWQRVLMRSSPLVV"
FT   gene            172910..173410
FT                   /locus_tag="Caur_0136"
FT   CDS_pept        172910..173410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33390"
FT                   /db_xref="GOA:A9WBI3"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBI3"
FT                   /protein_id="ABY33390.1"
FT                   /translation="MNSTHFDRIILYVMAAVSGVSLACYTAVLYLCRQEARGSQPTRST
FT                   LRTRLANLAHALDWLMNLLIALVGIGRLFREEQFGGQHQPRWLKIYFMITGPLPTIGMV
FT                   GAMITGHRWEKTMHHHPHQRRLHRIFAWVGYFSWWLSFIPIFFQPWLNRMAARTNDSTS
FT                   VLS"
FT   sig_peptide     172910..172981
FT                   /locus_tag="Caur_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.651 at
FT                   residue 24"
FT   gene            173441..174505
FT                   /locus_tag="Caur_0137"
FT   CDS_pept        173441..174505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0137"
FT                   /product="C-20 methyltransferase BchU"
FT                   /note="TIGRFAM: C-20 methyltransferase BchU; PFAM:
FT                   O-methyltransferase family 2; KEGG: cte:CT0028 CrtF-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33391"
FT                   /db_xref="GOA:A9WBI4"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR014088"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBI4"
FT                   /protein_id="ABY33391.1"
FT                   /translation="MTTVPSVDATKTNGTDLTQHDLFAATNRAYDMVFKGTVDFFVIKA
FT                   AKDLGLFDLLASAPRTLADLATLTETVPPRLEKFLITMEQIGLVTRQGDAWQLTPFADQ
FT                   FFADPERHRNMTMVPFVDYIADLIENYYLRLADVVRGKVDFTSIVPHPPRTREDSLFYE
FT                   TLHRSNIQLFTELLIKRARLADVQTLIDVGGGIGDIAAALCQAFPQLKVTLINLPSALD
FT                   LVRENVAAKGLADRITPVAIDMYREPYPPGDAVLFSRILYPMNAQFCTMLLRKAYDALP
FT                   SGGRILILDMVISDPNHPNYDYLTHYLCAIGMGFSVLEFKDHAVYPDLLRQVGFTDVTL
FT                   DEGYEHVLYQAVKP"
FT   gene            174564..175481
FT                   /locus_tag="Caur_0138"
FT   CDS_pept        174564..175481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0138"
FT                   /product="bacteriochlorophyll/chlorophyll synthetase"
FT                   /note="TIGRFAM: bacteriochlorophyll/chlorophyll synthetase;
FT                   PFAM: UbiA prenyltransferase; KEGG: cch:Cag_1538
FT                   bacteriochlorophyll a synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33392"
FT                   /db_xref="GOA:A9WBI5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBI5"
FT                   /protein_id="ABY33392.1"
FT                   /translation="MISTEQRVSLSRKIRAHIELADPVTWISPVLVCFCGALASGYERG
FT                   FDWTRPDHWWLMLLGALMTGPLGTGFSQSINDYFDRDLDAINDPQRPIPAGIISLNEAR
FT                   WNWIVLGAATLLVSLVFGNPLIVLFAVVGIVLSVIYSMPPIKLKKHFWLGPPAVGLGYV
FT                   SMSWMAGHLIFAPLTWQSVVVALINGGLAAGLLFLNDIKSVEGDRKLGLQSLTVAIGVK
FT                   RTLIVAYVTINSFEAMLMILALIWGQYWVAAFMFLALVAPIYNQIKLYQEPTQQNYVRY
FT                   LLASNPFVALIQIISGFLVGGYFG"
FT   gene            175504..175794
FT                   /locus_tag="Caur_0139"
FT   CDS_pept        175504..175794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33393"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBI6"
FT                   /protein_id="ABY33393.1"
FT                   /translation="MTESEGEVRVRSVPVRRNDSFVESAMEFGGGIVRLGFSIFTLPLA
FT                   LLPPESRQHMHNATKELMYAFASLPRDFAEIAGKSIEKWAEEGEEPKGEAK"
FT   gene            175833..176270
FT                   /locus_tag="Caur_0140"
FT   CDS_pept        175833..176270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33394"
FT                   /db_xref="GOA:A9WBI7"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBI7"
FT                   /protein_id="ABY33394.1"
FT                   /translation="MSNETTNERDGLFEMAAGFVGGATRIGLTVASVPLVLLPRNSRRR
FT                   VRRAMAEVAMAVVAFPKELANVSERVVDDIFAADPPQINLPSPQRVGEQVRSFTERLAR
FT                   AAEELGTSFSRAAGRAADAVEQGAAKVDEWVETPPKTPPAP"
FT   gene            176465..177634
FT                   /locus_tag="Caur_0141"
FT   CDS_pept        176465..177634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0141"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bcy:Bcer98_3646 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33395"
FT                   /db_xref="GOA:A9WBI8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBI8"
FT                   /protein_id="ABY33395.1"
FT                   /translation="MRIVILGAGYAGLRTALDLARLRRAYGLEITIQVVDQNPYHQLVQ
FT                   LLHLTATAGITDQKSIYQLDTLFRGREVERIEGRVEAIHPLERRVVLNTGQTLEYDRLV
FT                   LALGSETAFQVPGAREYTLPLRTFSDALKLRKHLIEQFTRAASITDPTELRITMTTAIV
FT                   GGGYTGCELAGELAAWADDLCRQTGAPRKEVRIALIEREDHLLPHLGTWASNEAVRRLE
FT                   RLGVNIFLQTPVVQVEPQRLRFADGRLLRAGTIVWGAGVRAPALLAEAGFPTDRLGRVL
FT                   VDRYLRVQGHATVFAIGDCAAVPDGRGGTLPPTASYAMRQGEHLAEVLAAEARGEAPRA
FT                   YEPVELGEVVSLGPNDAVGNPLGVPITGYPALMLKRGIEEYYRATIESA"
FT   gene            177650..178105
FT                   /locus_tag="Caur_0142"
FT   CDS_pept        177650..178105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ter:Tery_0501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33396"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBI9"
FT                   /protein_id="ABY33396.1"
FT                   /translation="MIVQEQFVSIKAPPATVERYLTDPQLMMEWRSPLVVLDPIEGELM
FT                   TLGSKHKLRLKSLALAGSTYTVTERDSNHILLTIDGLWRGQELWRWFADGDRTIVQNRV
FT                   EYEVPDPSLRVFVVGLGQIFASLDMRIQLDRLRMLIEGKGQPAAQAR"
FT   gene            178272..178556
FT                   /locus_tag="Caur_0143"
FT   CDS_pept        178272..178556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33397"
FT                   /db_xref="GOA:A9WBJ0"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBJ0"
FT                   /protein_id="ABY33397.1"
FT                   /translation="MARQQRFSPRDEVYLTSTSFEVYMAAGGVFIGLFGLLFAISIKIS
FT                   FAWLVWPALFVSILAGYITLNRLEKRERKRKLAELEAEYAAKEQIAKGD"
FT   gene            178643..179605
FT                   /locus_tag="Caur_0144"
FT   CDS_pept        178643..179605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0144"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: helix-turn-helix domain protein; peptidase
FT                   M23B; KEGG: rrs:RoseRS_2287 peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33398"
FT                   /db_xref="GOA:A9WBJ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBJ1"
FT                   /protein_id="ABY33398.1"
FT                   /translation="MQTLRSIRRTRDLTFVDLALLSGIPARAIAEAEYGLRRLSNHEVE
FT                   AIALVLGLSPTTLFPPFQQRSSSPNLTPLILTAGLATSLALSPLVMTEWQRAQQQLLST
FT                   TIHHVGEALNAPDRQPTPDIIRPLPTAPQAARSIPATPTADALAPLVAPLPPRTPTPIP
FT                   TPSFYLDEAGPHGCPVQPTTGQVVITQGYGVGTHAPAHVWGAVDLAVDGNGDGIAEPGS
FT                   SWYTPIVATHNGVVRVTLDSYPAGHHVWVMAPDGIWRTGYAHLAVVTVIDGQYVQAGDV
FT                   IGLMGNTGFASGPHLDYQVWRGDENIDPTTLVGCSTIKP"
FT   sig_peptide     178643..178735
FT                   /locus_tag="Caur_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.617) with cleavage site probability 0.512 at
FT                   residue 31"
FT   gene            complement(181900..182655)
FT                   /locus_tag="Caur_0145"
FT   CDS_pept        complement(181900..182655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0145"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mth:MTH1092
FT                   ABC-2 type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33399"
FT                   /db_xref="GOA:A9WBJ2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBJ2"
FT                   /protein_id="ABY33399.1"
FT                   /translation="MYATYVIWTRHMRKFVQQTEELFGLALQSVLWVVLFGVGMRGMIG
FT                   AVGGNDYMSFILPGIIALSALGGAVGGGMVLLDERLRGIVKEYLAAPIPRLSILLGSAA
FT                   STATKALFQAALMLVVGLLMGARLSVNPIGWLGALALLAVFAIGFSGLALGVAAISRSI
FT                   AGYHGMIFLFNLPLLFASNALYPLDVLPGWMRVIVLINPATYFIDAVRALAFGTAATLP
FT                   LWLSGLILIGFAVLSMMFALTLFQRSLRA"
FT   gene            complement(182667..183614)
FT                   /locus_tag="Caur_0146"
FT   CDS_pept        complement(182667..183614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0146"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: mem:Memar_0243 daunorubicin resistance ABC
FT                   transporter ATPase subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33400"
FT                   /db_xref="GOA:A9WBJ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBJ3"
FT                   /protein_id="ABY33400.1"
FT                   /translation="MDTPAIETIDLVKRYGNLTALDHVNLQAPSGKIYALLGPNGAGKT
FT                   TLLSILTTLLPPTAGTARILGYDVSREAAEVRRRIGVTFQEMVLDPLLTGRETLDFHGR
FT                   LYRLPAAVRRQRIRDLVELVQLTDAIDRPVKSYSGGMKRRLELARGLMTDPQVLVLDEP
FT                   TQGLDPQNRVNIWQYVRDLNRQRGMTILLTTHAMDEAEALADLVGIIDHGRLIVEGQPT
FT                   DLIASLGSDVIRVRGQGDSHHLTSAICGIDGVQRVETDPTEGLILIYTDNGSRRLPVVL
FT                   SAVSGNGFAIEDVTLARPSLGDVFLHYTGTALRD"
FT   gene            183964..184383
FT                   /locus_tag="Caur_0147"
FT   CDS_pept        183964..184383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33401"
FT                   /db_xref="GOA:A9WBJ4"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBJ4"
FT                   /protein_id="ABY33401.1"
FT                   /translation="MQQQPIRIEQRSGPNILIRVIYFFVFGLWFSGIWAAIGWILCVTI
FT                   VGLPVGLWMLNRMPQVVTLAPQRNNLVIVGNQVYQSSVPQRPFLIRALWFVLVGWWLSA
FT                   LWLLVAWALSVSIIGMVFAFWMFDRVPAIITLARR"
FT   gene            185401..186291
FT                   /locus_tag="Caur_0148"
FT   CDS_pept        185401..186291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fno:Fnod_0510 protein of unknown function
FT                   DUF450"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33402"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBJ5"
FT                   /protein_id="ABY33402.1"
FT                   /translation="MIFIVVKKAGMSDWADRQLFEYAFLQGIPMVIFTNGQEWSFYLTN
FT                   AQGSYDERRVYKLDLLESDIEESIYRLERYLQYDWVCSGEALEATLSDYQNVARTREIE
FT                   AALPKAWKSLLEEPDSLLLELLADKVEDLCGYKPDLDVCSRFITTVMRNHVDVPPQYPT
FT                   LPRTRNPLPAERIETDDRVRAGSECFIMFEGKTYKPGSAIRTMLKLFQRLAEADPGFLD
FT                   RFAAMKHGSKRKYIARNRLELYPDRPDLAKQCSVEIIPGWWMGKNFSKRDIKHIIEMAL
FT                   GIISPTLRAKIQYEL"
FT   gene            186610..188460
FT                   /locus_tag="Caur_0149"
FT   CDS_pept        186610..188460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0149"
FT                   /product="amino acid permease-associated region"
FT                   /note="KEGG: rrs:RoseRS_3857 amino acid permease-associated
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33403"
FT                   /db_xref="GOA:A9WBJ6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBJ6"
FT                   /protein_id="ABY33403.1"
FT                   /translation="MFAQLKRILVGRPIATEHQHHERLNKATALAVFSSDALSSVSYAT
FT                   EAILTILVLGGSVALGLSLPIAAAIAGLLLIVGFSYRQTIHAYPQGGGGYIVTRDNLGD
FT                   LPGLVAAGALLIDYVLTVAVSISAGVAAITSLATNWGFPTLRDHAVEIALVCILIVTIA
FT                   NLRGAKESGFIFSIPTYAFISGILSMIVFGIAHDLMFGADPVVHSIDPDIPPTGEVLSL
FT                   WLILRAFAAGCTALTGIEAISDGVQAFKPPEARNAAITLTLMISLLVTMFLGITWLAYT
FT                   HQAVPNEFTHETIVSQIARTIFGVGPLYVFIQIATALILVLAANTAFADFPRLASFLSR
FT                   DRFLPRQFSSRGDRLVFSNGILVLGLCSAVLVVIFQANEIAMLPLYAVGVFTSFTLSQS
FT                   GMVRRHFRRKQPGWHYSAMINGIGATLTGIVLVILMVTKFVHGAWMVITAIPILVMVFR
FT                   AINQHYQRVAEQLSLSGAILPPELRRHTAIVLVSGIHRGVLPALQYARSIAPDNVTAVY
FT                   VDLDPEATAKLRQRWQNWGCDIPLVVLESPYRSLINPILRYIEEVESRYGDDVITVILP
FT                   EFVPARWWEHLLHNQTGLLIKTALRLRGTVVTSVPYRLAR"
FT   gene            complement(188477..189307)
FT                   /locus_tag="Caur_0150"
FT   CDS_pept        complement(188477..189307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0150"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: rrs:RoseRS_3963
FT                   PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33404"
FT                   /db_xref="GOA:A9WBJ7"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR016831"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBJ7"
FT                   /protein_id="ABY33404.1"
FT                   /translation="MIEFVAIGHVTRDLLPQQTTAPGGTARFAALLAQRLGLRAAIVTA
FT                   SVEPAPPGVAWISLPTTFSSTFENRYTPAGRQQWLHAIAPSIPVTALPAAWRTAPIVLL
FT                   GPVLHECSPDLAGAFPGALIGATAQGWLRDWNTDLPTPIRPRRWRPTPAELRHLHVLTL
FT                   SSEDVAGDDELAAYYARLVPIGIVTHGAAGATLFIHGKPHHIPAFPAQESDPTGAGDVF
FT                   TTAFLIRLWETGDPVGAAHFAAAAAACVVEGVGDMALPDRVQIAQRMARVPDHG"
FT   gene            complement(190653..191549)
FT                   /locus_tag="Caur_0151"
FT   CDS_pept        complement(190653..191549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0151"
FT                   /product="alpha/beta hydrolase fold-containing protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   cph:Cpha266_1941 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33405"
FT                   /db_xref="GOA:A9WBJ8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBJ8"
FT                   /protein_id="ABY33405.1"
FT                   /translation="MSTPTEINTTRKFEIREEYRSGPDGLMRVWMSSPVQGLPVLLIHG
FT                   YGALIEHWRPVMRAIAGEQTLYALDLYYFGYSARPAGRPSRERWAAQAAALIRNTIGRP
FT                   AVVVGHSMGGVVSAQLARAYPDLVHALVLVNSSGAQLQARPLSTFDRFMLDAIGSPLIG
FT                   EALAGVFGNRWGVRQGLLSAYHRKECVTPELVELFSGPLRRYGAGSYLKVSREFANLVL
FT                   DLTPGEIKQPTLLIWGAEDRSIPPAHAEIIRQRMIPHAEIKIIPDSGHCPFDETPAAFL
FT                   DILLPWLRKVGEQTVVA"
FT   gene            complement(191655..192728)
FT                   /locus_tag="Caur_0152"
FT   CDS_pept        complement(191655..192728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33406"
FT                   /db_xref="GOA:A9WBJ9"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBJ9"
FT                   /protein_id="ABY33406.1"
FT                   /translation="MKTVEPPVSPQRPPEYPLRRRLLGIMLIIGGLGWLLFELVSRGSI
FT                   AGFDLQLARENSAQTLPVQRFAVSRVEVTGVNDQVTLSATDGEEVILRGERRGFGWAAN
FT                   AAAAAAAQITIEVEQRGDTLFVHVRRQPQIMWYFGRDPYASLELSLPRDVTFNVELVSG
FT                   DVTLRQIEASGTITTVSGDVVADRTSGQLTVNTTGGDIELRDHRGGLKVVTIGGDTDVN
FT                   GQFTDLDIQAIDGDVTLQGSFNTAVIGTVSGRVAVEATEASRLTISTTSGDVRFTGQPA
FT                   AERQEIETIAGNVELVLREPLDTQMTFTTVSGRINIPSELSALSANSRSFTATFGQGRT
FT                   VLKTNTTSGDITLRLYK"
FT   gene            complement(192841..193362)
FT                   /locus_tag="Caur_0153"
FT   CDS_pept        complement(192841..193362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0153"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="KEGG: sfu:Sfum_3916 dual specificity protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33407"
FT                   /db_xref="GOA:A9WBK0"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBK0"
FT                   /protein_id="ABY33407.1"
FT                   /translation="MLPHPNAYLVTERFIAGEYPFPTAADIQRLAWYQAAGITCFIDLT
FT                   TPGEAWSYAPALPSPMHHQRFSIPDFGLPATPAQMQAILAAIDEQLNRGATVYLHCLGG
FT                   VGRTGMTVGCWLVRHGFSGDEALATVARRWQTVAKAAMHPQSPETPDQRAYVLNWPTLQ
FT                   LSLSVRRRME"
FT   gene            193471..193965
FT                   /locus_tag="Caur_0154"
FT   CDS_pept        193471..193965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33408"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A9WBK1"
FT                   /protein_id="ABY33408.1"
FT                   /translation="MPILIDGHNLIGQMPDIELSDPDDEAKLVAKLRRYVAKKRGRKIV
FT                   VVFDGGVYGHPQNLNGFGVETRFVKPPQNADHELIRQIRAIRRCDEWLVVSSDRAVVGE
FT                   AQARGIRVMSAQEFARRLQMLDQPRINARDKRGDRPLSKAEVEEWLRFFGVDEDEDTLY
FT                   Y"
FT   gene            193970..194833
FT                   /locus_tag="Caur_0155"
FT   CDS_pept        193970..194833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0155"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rxy:Rxyl_2574 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33409"
FT                   /db_xref="GOA:A9WC16"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC16"
FT                   /protein_id="ABY33409.1"
FT                   /translation="MPDPVTEQNRRSWNAVVPAHVSHRADEAAFLRQGGSTLFPEEVAL
FT                   LGDVRGCRLLHLLCNTGADSLSLAARGAIVTGVDLSDAAIAHARALSVASGIPATFVQA
FT                   DVYEYLAAAAAANTRFERIYAGYGVICWLRDLTAFANGIAHLLAPGGRFVLMEFHPASN
FT                   MFNADWQLAYDYPQGGQTLTLPGVGDYVGAADGGLSPSGFLPGVRDFVNPEPCTLYRWG
FT                   VGEVVTALVQAGLRLHVLREYCYVNGERPFTRMVATPERRMYPPADVPAIPLMYGLAVE
FT                   KDTSDG"
FT   gene            194826..195209
FT                   /locus_tag="Caur_0156"
FT   CDS_pept        194826..195209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0156"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   rxy:Rxyl_2579 dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33410"
FT                   /db_xref="GOA:A9WC17"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC17"
FT                   /protein_id="ABY33410.1"
FT                   /translation="MDEWGIGHDRIILSGMQFIGYHGTRPEENRLGQRFVVDVAVQLDL
FT                   QAAGVSDDLSQTVDYSQIHDRVREIVCGPPLKLTEAVAERIAAAVLHDHPTIVAVAVRV
FT                   TKPGVRLGETILAGSMVEIVRRR"
FT   gene            195206..195871
FT                   /locus_tag="Caur_0157"
FT   CDS_pept        195206..195871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0157"
FT                   /product="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /EC_number="1.1.1.193"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: rxy:Rxyl_2578 riboflavin-specific
FT                   deaminase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33411"
FT                   /db_xref="GOA:A9WC18"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC18"
FT                   /protein_id="ABY33411.1"
FT                   /translation="MMRPRVTLCFAQTLDGRVAAVDGSSQWISGPESLRFCHHLRANSD
FT                   AIMVGVGTVLRDDPRLTTRLVAGPDPLRVIVDTHLRTPTTAAVIRDGAGTGTLLACTAA
FT                   APLERRIALQECGATVLTMPEAAGGGVDLAALLTALGERGVASVMVEGGARLITSLLRA
FT                   NLVDALAVTIAPIILGSGPSAIGDLGILTLNQALRLTNVTWTTYGADVVIEGDLAHHQ"
FT   gene            195897..196919
FT                   /locus_tag="Caur_0158"
FT   CDS_pept        195897..196919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0158"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; KEGG: rxy:Rxyl_2577 alcohol dehydrogenase,
FT                   zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33412"
FT                   /db_xref="GOA:A9WC19"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC19"
FT                   /protein_id="ABY33412.1"
FT                   /translation="MKPLPAQAIWFTAPHTVSIREEIAPPPAYGDVRIAAIASLISHGT
FT                   ERLVYRGEVDPTLALDLPTLQGSFAFPIKYGYAIAGRVIDIGPGVEQFQIGDPVAALHP
FT                   HQTIFTLPAHLVKRLPDTLDPALGGFYANVETALTICHDAAPRLGETVVVLGQGVVGLL
FT                   VTQLLQRTGAQVIAVEPDAHRRALATQFGATTLAQADPATIAELTDGRGADIVVEVSGS
FT                   PAALQQAIELTATEGLVVVASWYGQKPAPLILGGHFHRGRVRLRSSQVGRLAPETLPRW
FT                   DYARRSATVMNLLPRLCLNELISHRIPFVQAAAAYDLLDQAPPGLVQVMLTYADYAPQT
FT                   "
FT   gene            197111..197491
FT                   /locus_tag="Caur_0159"
FT   CDS_pept        197111..197491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0159"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: rxy:Rxyl_2576 6-pyruvoyl
FT                   tetrahydropterin synthase and hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33413"
FT                   /db_xref="GOA:A9WC20"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC20"
FT                   /protein_id="ABY33413.1"
FT                   /translation="MYEVGVIAQFEAAHRLEGNFGPATRMHGHTYRLEAIVSGERLQAD
FT                   GTLFDITRLQEAVNAIVADLHYRDLGTVAGLENVNTTAENVARYCWDRIAAAIRGVGLM
FT                   TLTVRIWENPQAFASYQSRLEG"
FT   gene            197496..198545
FT                   /locus_tag="Caur_0160"
FT   CDS_pept        197496..198545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0160"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rxy:Rxyl_2575 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33414"
FT                   /db_xref="GOA:A9WC21"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC21"
FT                   /protein_id="ABY33414.1"
FT                   /translation="MALRIAFLTVGDPQRRTGGYLYHREVFRCWQARNQPVEEIVLGPA
FT                   DVAGQIAASNRAGQLVEAGRYDVIVVDALARAVVAPWLAHWQRLCPLVTLVHELPTVAG
FT                   ASDPREYEWEQMLLRADALVAVSDDGANTLIARGVEAARIHIASGGCDRLLSRMPVGKA
FT                   REELVIAVAQWIPRKNLAHLVRVWGQVAEHPWRLELIGESDADPVYAGEVWQAIQHCPA
FT                   NVIVRGVLADDELAERYARASLFALPSRFEGYGLVFAEALACGLPVIAGAVGPVPALVG
FT                   AGGMLVHPDDEQALSVALRTVMRDAHLRQHLSTAARQRASTLPRWQDTAQHLLCAIEWA
FT                   YAQRHRVST"
FT   gene            198653..199771
FT                   /locus_tag="Caur_0161"
FT   CDS_pept        198653..199771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_4165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33415"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC22"
FT                   /protein_id="ABY33415.1"
FT                   /translation="MTGKKAILSLITTALVLLLTACGGGATSSSQPTPTTEEARPTRTP
FT                   RPAGNVTSPTTAPTTAPTTDTTVEQAPVLSTNADLTALGNVQVEMKLEGTSQESGQEAE
FT                   PFNLVMQQIILANGDRSLTMESTSPESGLVRIISVQVGGQVYQYVEDSNQPYCMAMGNF
FT                   DLFSGSMLTPDALIGSIPEAQLVERGVQVNGFTTDRYTFTINEQTPNYQGEAKGEIWAA
FT                   QDPAVVVRHIGEFTGTITGVTTEEGGTPLPGQLGNIRWEYNVTQLDANTNITLPETCAQ
FT                   QQAAGAEIPLPANISNRVQMGDLISFETTESPDNIVSFYQTEMVAQGWQAGEVSQYGSD
FT                   YQLTFSKDGRTATILVSVIDNKTSVIIMLASS"
FT   sig_peptide     198653..198745
FT                   /locus_tag="Caur_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.588 at
FT                   residue 31"
FT   gene            200038..200616
FT                   /locus_tag="Caur_0162"
FT   CDS_pept        200038..200616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33416"
FT                   /db_xref="GOA:A9WC23"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC23"
FT                   /protein_id="ABY33416.1"
FT                   /translation="MDTTLKQGTLSVWYDEKGYGFIVDPQEERTFVHITAFGRIPRRPV
FT                   VGDTIFYTTTIDRDGKIRADYAWIEGLPAPRRRSYVHQHRKKGQPWSLTDVVLLLTVIV
FT                   LFFVAGGLFTVAFAGDTVTTTVAQIFAKRPGPPECVIKGNISIETGEKIYHLPGMRDYD
FT                   STRIREEYGERWFCTEQEAIEAGWRRAGR"
FT   gene            201720..203462
FT                   /locus_tag="Caur_0163"
FT   CDS_pept        201720..203462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0163"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: rca:Rcas_1557 acetolactate synthase,
FT                   large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33417"
FT                   /db_xref="GOA:A9WC24"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC24"
FT                   /protein_id="ABY33417.1"
FT                   /translation="MTKPLTGAQIMCEALIREGVEVMFGIPGGAIMPFYYAMWDYRDRL
FT                   RHVLCRHEQGAGHAAEGYARATGKIGVCIGTSGPGATNLVTPIADAMMDSTPLLAITGQ
FT                   VGSHVLGKDAFQETDITGITMPITKHNYLVKNVDELAYVFKEAIYIATTGRPGPVLIDI
FT                   TKDAMQKTTVPNWDIKLNLPGYKPTYHGNRRQIREAIKLLISAKKPLIIAGHGIIMAGA
FT                   HRELQEFAERLRIPVITTLHGIGAIPENHPLSIGMPGMHGWVHVNRAIQECDVLFNIGG
FT                   RFDDRVTGKASTFAPNARIIHVDIDPSEIGKNVRVDVPIVGDARLVLQAFLEDLPPPSE
FT                   LADLHTHASDWMEHIREMQDKHQGKQQYKNRAAMVNMALPPHDVYEALSRTLNARGNYR
FT                   VVTDVGQHQMWAAQLIDWNHGPRTHITSGGAGTMGFAVPAAMGVAIACPNDTVWAIVGD
FT                   GGFQMTNQEMATIVQEGLKNVKIAVINNGYLGMVRQWQELFEHKRYSGTPLSGPDFAKL
FT                   AEAYGWKGLTVERSEDVQDAIDEAHATDGPVLIDFRVEREVNVFPMVPQNKSIGEMILS
FT                   ESQA"
FT   gene            203501..204040
FT                   /locus_tag="Caur_0164"
FT   CDS_pept        203501..204040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0164"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG:
FT                   rrs:RoseRS_1967 acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33418"
FT                   /db_xref="GOA:A9WC25"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC25"
FT                   /protein_id="ABY33418.1"
FT                   /translation="MKKHTIVALVQDRPGVLSRVTGLVRRRGYNIESLAVGHSETPGVS
FT                   RLTLVVESEDVEQVVKQLYRLIEVIKVSDVTDDPTVESEMTMIKLHAPPAVRHEIISMC
FT                   SVFGARIVDVGSNTMIVEMTGTPGKVENFIEVVRPYGIKEMMRTGRIAMVRGARGHNAG
FT                   EYVEPATNGASVPVLN"
FT   gene            204138..205160
FT                   /locus_tag="Caur_0165"
FT   CDS_pept        204138..205160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0165"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: rrs:RoseRS_1966 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: acetohydroxy
FT                   acid isomeroreductase; Acetohydroxy acid isomeroreductase
FT                   catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33419"
FT                   /db_xref="GOA:A9WC26"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WC26"
FT                   /protein_id="ABY33419.1"
FT                   /translation="MAELYYDNQADLNRLKNKPIAIIGFGSQGHAHARNLADSGLDVRV
FT                   GLYPGSKSWAKVEAAGLKVMTVAEAAREAQIVMILTPDIGQADLYREHIAPAMEPGKTL
FT                   MFAHGFNIRFGQIIPPQGIDVSMVAPKAPGHRVREVFVQGGGVPALIAVEQDATGGAFE
FT                   DALAYAKGLGCTRAGVLRTTFAEETETDLFGEQVVLCGGVSALVKAAFETLVEAGYQPE
FT                   VAYFECMHELKLIVDLFYQGGLNYMRYSVSDTAEWGDYTAGPKIITDQTRAAMRQILAD
FT                   IQSGAFAEDWIDENHNGRPRFNAYRQADINHPIEQIGRELRRMMPFVNPREVKPGEGGA
FT                   "
FT   gene            205232..206938
FT                   /locus_tag="Caur_0166"
FT   CDS_pept        205232..206938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0166"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: rrs:RoseRS_1965 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33420"
FT                   /db_xref="GOA:A9WC27"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC27"
FT                   /protein_id="ABY33420.1"
FT                   /translation="MSNTTEPSVEYVRIFDTTLRDGEQAPGCTMTLEEKLEVARQLARL
FT                   RVDIIEAGFPAASPGDWAAVHEIAREIGTPDGPIIAALARANRDDIDKAWSAIQPAAKK
FT                   RIHTFMSTSDIHLEYQFRKTRAEALALIHEMVSYARSLCEDVEFSPMDAGRTDPLFLRE
FT                   AVAVAVAAGATTLNIPDTVGYLTPDEYGAMIRDLRENVPGIERCILSTHCHDDLGMAVA
FT                   NSLAGVRAGARQVECTINGIGERAGNASLEEVVMALHTRQQYYGLRTRVETREIARTSR
FT                   LVSSFIGVPVPPNKAIVGANAFAHESGIHQDGVLKYRQTYEIMSAETVGLDSNTLVLGK
FT                   HSGRHAFRKYLEEKGYKLNEEEFQHVFARFKDLCDRKKKVDDRDIEALIAGEMQHTPEL
FT                   YKLDHVQYASGIGMIPTATVRLIGPDGQTRIDSAQGTGPVDAVYQAINRIIQRPNELIE
FT                   FSINAITEGLDAVAEVTVRIREQGAPARLNESSSTATSLTGRRPAQQIFSGYGVHTDTI
FT                   VAAAQAYMAALNKMLAARQERIKAEAVAYAAGYSGESGTLPVDIFGGSTLG"
FT   gene            207061..207915
FT                   /locus_tag="Caur_0167"
FT   CDS_pept        207061..207915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0167"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: rrs:RoseRS_1964 prephenate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33421"
FT                   /db_xref="GOA:A9WC28"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC28"
FT                   /protein_id="ABY33421.1"
FT                   /translation="MQTIAYLGPPGTFSEEAALAYAAGREARLLPLASIPAVVTAIETE
FT                   AATVGVLPIENLLEGSVSYTLDLLIHETNLQIAGEIVVPIRQYLLARPGLQLSDIKVLY
FT                   AHPQSLAQCRRFVERCLPGVATVASLSNSAAPAEAMADERPAAAIGTLRAAELVGATIL
FT                   AREIADSPHNVTRFIVLAREDAPPTGDDKTSFCFGFTREDRPGSLVSALQELAVENINM
FT                   TKLESRPTRAILGQYIFLVDINGHRREPHVARALERIRLHTGMLKIFGSYPRWRGANGN
FT                   HAS"
FT   gene            207940..209364
FT                   /locus_tag="Caur_0168"
FT   CDS_pept        207940..209364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0168"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: rca:Rcas_1549 3-isopropylmalate dehydratase,
FT                   large subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   large subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33422"
FT                   /db_xref="GOA:A9WC29"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC29"
FT                   /protein_id="ABY33422.1"
FT                   /translation="MNKPRTLFEKVWEAHLVRPETAETPAVLYIDLHLIHEVTSPQAFT
FT                   ELRQRGLRVRRPDKTLATMDHSTPTTPRNHLGIIPVVDPMAISQLEQLRKNCAEFGIPL
FT                   FELGDENQGIVHVIGPEQGLTQPGMTIVCGDSHTSTHGAFGALAFGIGTSEVGHVLATQ
FT                   CLLQRKPKTCAVRIDGRLGPGVTAKDIILALIAKYGVGGGTGYVFEYMGEAIRALSMEE
FT                   RMTICNMSIEGGARAGMVAPDDTTFEYIAGRPFAPKGADFEAAVARWRTLPSDEGATFD
FT                   HELTLSASELKPMITYGTNPGMGIPIDAPVPRPEDMPDARSRAALDKALAYMGLEPGKP
FT                   LLGHPVDVVFIGSCTNSRLSDLRQAAQFFRGRKVAPGVRVMVVPGSQQVKRAAEAEGLD
FT                   RIFKEAGAEWREAGCSACLGMNDDKVPPGKYAVSTSNRNFEGRQGPGARTMLASPLTAA
FT                   AAAITGVVTDPRTLLN"
FT   gene            209376..209981
FT                   /locus_tag="Caur_0169"
FT   CDS_pept        209376..209981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0169"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   rrs:RoseRS_1960 3-isopropylmalate dehydratase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33423"
FT                   /db_xref="GOA:A9WC30"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WC30"
FT                   /protein_id="ABY33423.1"
FT                   /translation="MEPVSTITGKAVVLPVENIDTDQIIPARFLKVTDRSGLAAGLFEA
FT                   WRYQADGTPNPDFPLNRPEAAGATILISGRNFGCGSSREHAPWALQDYGFKAVLAPSFA
FT                   DIFRSNSLKIGLLPVTIDQAVYDELVARYAADPQMHLTIDLATQTVTLPDGRQVHFPID
FT                   AFSKYCLLHGVDQLGFLLQQEEAIIAYEASHPQPVTTR"
FT   gene            complement(211032..212369)
FT                   /locus_tag="Caur_0170"
FT   CDS_pept        complement(211032..212369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0170"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; FAD dependent
FT                   oxidoreductase; KEGG: nfa:nfa9670 putative dihydrolipoamide
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33424"
FT                   /db_xref="GOA:A9WC31"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC31"
FT                   /protein_id="ABY33424.1"
FT                   /translation="MKQIVVIGGGAAGVEAAVAAAQGNTKVTLVSEGPIGGRTGWDSLL
FT                   PSKVWLHAAEVAGIATAAAGEGVAVNGVQVDPTAVLQRIKHVATRWSDHEQQRLQAAGV
FT                   TVMQGVAAFSSPHELTIQTQAGQQTITADVIIIATGSVPRFPPTMKPDGQRIIAPRFAS
FT                   HLHTLPDDIIVIGGGPTGSEFASLFSRLGVKVTWLVGSPGVLPMFATNARSTLAAAMQA
FT                   HGVEIHQVDVERAERTEEGVSVLAADGTTYTAAMAFLAIGRTPDLSRLNLSAAGLTVEA
FT                   NGQLTVDNYGRTPVNHIFAVGDAAGGPMLANRALAQAWIAGRTAADLPAPGYCPHTIVH
FT                   AVYTVPEVAQVGLVMDTELSRIRAEYGSSLKSYLGAETSGWIELTFDPITRQVRGGVAV
FT                   GDHAADLLAPVALAIQTGATLADLAAVFAAYPTLSETVFAAARAAG"
FT   sig_peptide     complement(212310..212369)
FT                   /locus_tag="Caur_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.506 at
FT                   residue 20"
FT   gene            complement(212868..215813)
FT                   /locus_tag="Caur_0171"
FT   CDS_pept        complement(212868..215813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0171"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; KEGG:
FT                   rca:Rcas_0508 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33425"
FT                   /db_xref="GOA:A9WC32"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC32"
FT                   /protein_id="ABY33425.1"
FT                   /translation="MIRSRRLHANGRNGRRHVPPHLLRGLRGRSTPRSAVSRWLVNALL
FT                   AGLGLVAVVIVAIAGFAYNAYAQVAESLKPRLALLDNRELFENSRIFDRNGELLYEFFD
FT                   TGKRTKVTIDEISPLLIQATIAIEDKTFYTNPGIDLAGIVRTLIDSLRAGEETGGASTI
FT                   TQQVIKNSVLTPEERLPERRYERKLKEIILAQELDRIYTKDQILELYLNENFYGNLAYG
FT                   IQAASEVYFGVSAADLDLNQASLLAGLPQLPSVYNPINYLERDEQGGYLPPVFVGDGWL
FT                   DPDARLPAGTPLPRIRQAAVLRRMVEDGYITEAQARQALATPLRFAPQEAPLNAPHFVF
FT                   YVRDLLLQRYGAQIVYGGGLRITTTLDLQLQRMAQRTAFERIAELESRNIHNAAVVIMQ
FT                   PNTGQILAMVGSIDYNAVKPTTTPGESGNVLDGQVNVATRERQPGSALKPFTYLAAMEQ
FT                   GMTPETVLWDVPTRFPTGTGDWYAPQNYNGQWNGPVRIRTALANSLNMPAVRALKFAGI
FT                   DYTIRLLERVGIRTGLKRGAGFYGLSLTLGGGEVSPLELTTAYNTLASGGRYFAPVAIL
FT                   EITDSQGRVLERFTQTPGEEVVDPALVAIISDMLSDDRARQAIWGLNSPLRLSLPAAVK
FT                   TGTTNDWRDAWAVGYTPFVTVGVWTGNNNNEPTARVESLTGGGIIWRNVMENIFRLIAE
FT                   DERYRDLFAAPFPNGEIQTEFVLPEEVVPRPICELPGPFGGYREELFTLDMIKRLEEAA
FT                   QPTPEATTGDAIPNEGFCSAYTKVRVVRIPTPEEWTTSGELRPNPPPPPPTDPKAPPLP
FT                   QDLSALTDGAYCRPAPDAAYPPELVRDIYLWKLPPPDPDEEVEYKWRGGDATVPLKYEE
FT                   LPECTPAMFEPPIPVPPVEGAILMPDLRRLGENQAKEVLALLGIDPGRIYVDYQGPDRA
FT                   GEDYYRYGPYVVLSSLPAAGEWILPDTTIVLGIRAPDPNPEPPASDSTEGN"
FT   sig_peptide     complement(215619..215813)
FT                   /locus_tag="Caur_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.649) with cleavage site probability 0.363 at
FT                   residue 65"
FT   gene            215985..217481
FT                   /locus_tag="Caur_0172"
FT   CDS_pept        215985..217481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_0867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33426"
FT                   /db_xref="GOA:A9WC33"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC33"
FT                   /protein_id="ABY33426.1"
FT                   /translation="MHQPSLIGPAILIVLLITLPLASIGDLILDQIGWQPLWLIGASII
FT                   AGMEAFALRMRMLAGLHEAEGGTLRYLAAEIFALVVLARLVATLGFGGEGIRAMMSWIT
FT                   DPLAFFDVPFLICLLALTTVVMLSRSGIAAIAAITPNPPQKMPLYTLDVLFYNSDAKIR
FT                   RWNAVKAIISGVSWGGLLIIWLQSWRPGNADAFSGWIALYLIGGLSLIELARRRASLAD
FT                   WQSDGAEVAVDVQRSWHLLSVMLIGLMIVLTLVFPFPREMSMPEEWRRAIYSLVGLVIF
FT                   IGLIASLLFVGLISLIMLLPMLLYLLLNWLLTTNSTSAAMPIPQPPLIPPATASEPMVW
FT                   PGLIFWFCVAVLTVLAFWRIARRQTWLKAAWVNAVTWLTAWWHHLRHRRIGGWPHWWHS
FT                   QEEPPPPPHSRCSRSGPVDTVIACYHAALRHATARGYPRRPPQTPAEYAERISGELPAG
FT                   AAELQALTEAYQRVVYAGKPFDRSERRQFSALLRRFRRKV"
FT   sig_peptide     215985..216053
FT                   /locus_tag="Caur_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.646) with cleavage site probability 0.429 at
FT                   residue 23"
FT   gene            complement(218482..219540)
FT                   /locus_tag="Caur_0173"
FT   CDS_pept        complement(218482..219540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0173"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   rca:Rcas_0913 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33427"
FT                   /db_xref="GOA:A9WC34"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="PDB:4E3E"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WC34"
FT                   /protein_id="ABY33427.1"
FT                   /translation="MSAKTNPGNFFEDFRLGQTIVHATPRTITEGDVALYTSLYGSRFA
FT                   LTSSTPFAQSLGLERAPIDSLLVFHIVFGKTVPDISLNAIANLGYAGGRFGAVVYPGDT
FT                   LSTTSKVIGLRQNKDGKTGVVYVHSVGVNQWDEVVLEYIRWVMVRKRDPNAPAPETVVP
FT                   DLPDSVPVTDLTVPYTVSAANYNLAHAGSNYLWDDYEVGEKIDHVDGVTIEEAEHMQAT
FT                   RLYQNTARVHFNLHVEREGRFGRRIVYGGHIISLARSLSFNGLANALSIAAINSGRHTN
FT                   PSFAGDTIYAWSEILAKMAIPGRTDIGALRVRTVATKDRPCHDFPYRDAEGNYDPAVVL
FT                   DFDYTVLMPRRG"
FT   gene            complement(219562..220608)
FT                   /locus_tag="Caur_0174"
FT   CDS_pept        complement(219562..220608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0174"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: rrs:RoseRS_4173
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33428"
FT                   /db_xref="GOA:A9WC35"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WC35"
FT                   /protein_id="ABY33428.1"
FT                   /translation="MRKLAHNFYKPLAIGAPEPIRELPVRPERVVHFFPPHVEKIRARI
FT                   PEVAKQVDVLCGNLEDAIPMDAKEAARNGFIEVVKATDFGDTALWVRVNALNSPWVLDD
FT                   IAEIVAAVGNKLDVIMIPKVEGPWDIHFVDQYLALLEARHQIKKPILIHALLETAQGMV
FT                   NLEEIAGASPRMHGFSLGPADLAASRGMKTTRVGGGHPFYGVLADPQEGQAERPFYQQD
FT                   LWHYTIARMVDVAVAHGLRAFYGPFGDIKDEAACEAQFRNAFLLGCTGAWSLAPNQIPI
FT                   AKRVFSPDVNEVLFAKRILEAMPDGSGVAMIDGKMQDDATWKQAKVIVDLARMIAKKDP
FT                   DLAQAYGL"
FT   gene            complement(220660..221889)
FT                   /locus_tag="Caur_0175"
FT   CDS_pept        complement(220660..221889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0175"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rrs:RoseRS_4174 acyl-CoA
FT                   transferase/carnitine dehydratase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33429"
FT                   /db_xref="GOA:A9WC36"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="InterPro:IPR026347"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WC36"
FT                   /protein_id="ABY33429.1"
FT                   /translation="MKGILHGLRVVEGSAFVAAPLGGMTLAQLGADVIRFDPIGGGLDY
FT                   KRWPVTLDGKHSLFWAGLNKGKRSIAIDIRHPRGQELLTQLICAPGEHAGLFITNFPAR
FT                   GWLSYDELKRHRADLIMVNLVGRRDGGSEVDYTVNPQLGLPFMTGPVTTPDVVNHVLPA
FT                   WDIVTGQMIALGLLAAERHRRLTGEGQLVKIALKDVGLAMIGHLGMIAEVMINDTDRPR
FT                   QGNYLYGAFGRDFETLDGKRVMVVGLTDLQWKALGKATGLTDAFNALGARLGLNMDEEG
FT                   DRFRARHEIAALLEPWFHARTLAEVRRIFEQHRVTWAPYRTVREAIAQDPDCSTDNPMF
FT                   AMVEQPGIGSYLMPGSPLDFTAVPRLPVQPAPRLGEHTDEILLEVLGLSEAEVGRLHDE
FT                   GIVAGPDRAA"
FT   gene            complement(222002..222409)
FT                   /locus_tag="Caur_0176"
FT   CDS_pept        complement(222002..222409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33430"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC37"
FT                   /protein_id="ABY33430.1"
FT                   /translation="MVACIGKSDGTAAHPYLAWHGMGSTAINHLPFGWGRAARLTGDRR
FT                   HQALFAGPARNPAQITDLRSQRVTQVLAMGARAWHRCTAMRSTRPRLMVACIGKSDGTA
FT                   AHPYVARNRMGSTAIHHLPFGWCRAARYWRS"
FT   gene            complement(222384..223025)
FT                   /locus_tag="Caur_0177"
FT   CDS_pept        complement(222384..223025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33431"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC38"
FT                   /protein_id="ABY33431.1"
FT                   /translation="MGARAWHRCTAMRSTRPRLMVACIGKSNGTAAHPYLAWHGMGSTA
FT                   INHLPFGWGRAARLTGDRRHQALFAGPARNPAQITDLRSQRVTQVLAGGARAWHRCTAM
FT                   RSTRPRPMVACIGKSDGTAAHPYVARNRMGSTARLVQGNGTTWGRAARLTGDRRHQAVF
FT                   AGPAQNPAQISDLRSQRVTQVLVVGARAWHRCMAMRSIRPRLIGGLHRQE"
FT   gene            complement(223035..224252)
FT                   /locus_tag="Caur_0178"
FT   CDS_pept        complement(223035..224252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0178"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rca:Rcas_0910 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33432"
FT                   /db_xref="GOA:A9WC39"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WC39"
FT                   /protein_id="ABY33432.1"
FT                   /translation="MDGTTTTLPLAGIRVIDAATVIAAPFCATLLGEFGADVLKVEHPI
FT                   GGDALRRFGTPTARGDTLTWLSESRNKRSVTLNLQHPEGARVFKELIAHSDVLCENFRP
FT                   GTLEKWGLGWDVLSKINPRLIMLRVTGYGQTGPYRDRPGFARIAHAVGGIAYLAGMPKG
FT                   TPVTPGSTTLADYMTGLYGCIGVLLALRHREQTGRGQYIDAALYESVFRCSDELVPAYG
FT                   MYRKVRERHGSHYNEFACPHGHFQTKDGKWVAISCATDKLFARLANAMGRPELASSSVY
FT                   GDQKVRLAHASDVNEIVRDWCSSLTRAEVLERCYATATPAAPLNDIADFFGDRHVHARR
FT                   NLVAIDAEDLGETLIMPNVVPKLSETPGSIRSLGPKLGEHTEEVLKEILGMCDEQINDL
FT                   RSKRVI"
FT   gene            complement(224515..225882)
FT                   /locus_tag="Caur_0179"
FT   CDS_pept        complement(224515..225882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0179"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rca:Rcas_0909 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33433"
FT                   /db_xref="GOA:A9WC40"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WC40"
FT                   /protein_id="ABY33433.1"
FT                   /translation="MAKASRLTRSTGQPTEVSEGQVTGTSEMPPTGEEPSGHAESKPPA
FT                   SDPMSTPGTGQEQLPLSGIRVIDVGNFLAGPYAASILGEFGAEVLKIEHPLGGDPMRRF
FT                   GTATARHDATLAWLSEARNRKSVTIDLRQQEGVALFLKLVAKSDILIENFRPGTMEEWG
FT                   LSWPVLQATNPGLIMLRVSGYGQTGPYRRRSGFAHIAHAFSGLSYLAGFPGETPVLPGT
FT                   APLGDYIASLFGAIGILIALRHKEQTGRGQLIDVGIYEAVFRILDEIAPAYGLFGKIRE
FT                   REGAGSFIAVPHGHFRSKDGKWVAIACTTDKMFERLAEAMERPELASPELYGDQRKRLA
FT                   ARDIVNQITIEWVGSLTRDEVMRRCLEKEVPVGPLNSIADMFNDEHFLARGNFACIEAE
FT                   GIGEVVVPNVIPRLSETPGRVTNLGPPLGNATYEVLRELLDISAEEIKRLRSRKII"
FT   gene            226187..227029
FT                   /locus_tag="Caur_0180"
FT   CDS_pept        226187..227029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33434"
FT                   /db_xref="GOA:A9WC41"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WC41"
FT                   /protein_id="ABY33434.1"
FT                   /translation="MSSADWMAWIGRTEQVEDDICLAQAIAAAATLEPPSGAPTADSPL
FT                   PPLWHWFYFLPRAPQSQLSSDGHPQRGGFIPPIPYPRRMFAGARIRFHHPLRIGQPARR
FT                   EGVIRNITQKSGRSGPLAFVTVGYQIYQHEMLCIEEEQDIVYREPGAPVPAPTPVELPP
FT                   VHDAITRTVVPDPRLLFRFSALTFNAHRIHYDRPYAQHEEGYPGLVVHGPLVAVLLMEL
FT                   ARHHTSRPIVGFSFRSQAPLFDLAPFRLLARPNGDRIDLEAQGPDGATALSATVELGG"
FT   gene            228787..230322
FT                   /locus_tag="Caur_0181"
FT   CDS_pept        228787..230322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0181"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: rrs:RoseRS_4179
FT                   protein of unknown function DUF224, cysteine-rich region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33435"
FT                   /db_xref="GOA:A9WC42"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC42"
FT                   /protein_id="ABY33435.1"
FT                   /translation="MEPEMQAFVDSLRHNLTAEDVVNLEACMDCKMCGEACAWYLVTGD
FT                   EKLHPTYKTGLIRQIYHRYMTVEGRIGGALGLVPTPTVADLREHMQYFWACTACGRCTL
FT                   ACPSGISIRRIVRLARAAYADSGLSLANPTIRSIIENTDRHRHSFGLTMPQVIGRVGLF
FT                   LRSEDLEVPVDVPGADMLFVCPAAGNTKIPDYGIKLIKILNAAGVSYTISPYVIDTGTE
FT                   IDHIAVHHNLSKQMLEDWEQEADRLGVKNILLVECGCDTRTLYAEASETLGRPFRYPIV
FT                   SVDALMLDLIKQGRLPVEKTHLKVTLHDPCYATRLSGLGDLFRELLNLVTDNFIEMTPN
FT                   REHNYCCNGGAGGMRLPENTATRRKISVLKANQIRATNATYVTSPCVVCTLSLEDTCQT
FT                   YGLAPQGERMALVLFEVVYAAMEQALAKRGELDRMRIPAELQNRDHEFFVAHSIEGRLS
FT                   MLMQLPEFPALLDWLEQDDIVRRFSKDHPHVYDLLRAWREVVTAPKQRSITAD"
FT   gene            230354..231175
FT                   /locus_tag="Caur_0182"
FT   CDS_pept        230354..231175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33436"
FT                   /db_xref="GOA:A9WC43"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC43"
FT                   /protein_id="ABY33436.1"
FT                   /translation="MLITLLNIVAPIAMTIFVVGVGLRLGRFVMALLTKRRFRGISPTF
FT                   ESPPPRLGFWQSLAAVLFGPYQHFYRRANPVWGRGYLAYHVAIITEVIGYSISALIVFG
FT                   NILLGRPIPDVALHLEHSFNYTPANLLAIIFGNGEELQSRFLFGDFAPYFVGITWVAVI
FT                   FAVIGNLHLMTVLLRRWSGAVVSDIDPPAHRIRTPGRRPFDRVLIRTIIFCIIWTELLA
FT                   RLQLVPGIVYVHSLLGLALFTLLPFTYLFHMVYNFLAVFYATRRRMARTIA"
FT   gene            complement(231269..232126)
FT                   /locus_tag="Caur_0183"
FT   CDS_pept        complement(231269..232126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0183"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: rca:Rcas_4385 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33437"
FT                   /db_xref="GOA:A9WC44"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC44"
FT                   /protein_id="ABY33437.1"
FT                   /translation="MITRASTRRRTILKVRDGRWQQTKDTVVVEEPLEIRLATAGNPQS
FT                   TALATVMRTPGADVELAAGFLFGEGIVRDRYDIVTIRYCVDADLDEEARFNTLIVTLRP
FT                   ELDLNLDHIRRLFFVSSSCGVCGKISLEALRLRGCTPLIDDPTLQVRCSVLAGIDQRVQ
FT                   QAQELFSRTGGLHAAALISLDGQIHALHEDIGRHNAVDKLIGDHLLGGRLELLRQSVLL
FT                   VSGRASFEIMQKALMAQIPIVAAVGAPSTLAVTLAQHFNMTLIGFLRGSSFNIYAGAGR
FT                   VEEG"
FT   gene            complement(232142..234382)
FT                   /locus_tag="Caur_0184"
FT   CDS_pept        complement(232142..234382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0184"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: rrs:RoseRS_4018
FT                   oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33438"
FT                   /db_xref="GOA:A9WC45"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC45"
FT                   /protein_id="ABY33438.1"
FT                   /translation="MKRRGWNPATWVSLVPNGLGHVKPNHYWEIVRTIWENRDNLGKAW
FT                   RILHEGVCDGCALGTAGLRDFTMKGVHLCTVRLNLLRLNTMPPLDIHRLHDVADLQRLN
FT                   GRELRALGRLPYPMLRRRGEAGFRRISWDDALNEIAARLRNTDPHRMAFYLTSRGITNE
FT                   TYYVAQKVARFLGTNNVDNAARLCHAPSTTAMKQALGVAASTCSYRDWIGTDLLIFIGS
FT                   DAPNNQPVTTKYLYYAKQHGTRILVINPYREPGLERYWVPSVFESALFGTRLADRFFQI
FT                   HTGGDIAFLNGTLKHLIERNWLDWDFISAHTRDFERVQVALAQQSWDDLERASGATRGE
FT                   MLAFAEALAQAKSAVFVWSMGITQHEYGVENVKAILNLALARGFIGREYCGVMPIRGHS
FT                   GVQGGGEMGCTATTFPGGKPITPDTAHWLGEQWGFAVPAWKGLSCGDMLDVAYNGELDV
FT                   FYAVGGNFLDTMPDPAYIRTALARPALRVHQDIVLTTQMLVEPADTVILLPAATRYEQR
FT                   DGGTETSTEREIIFSPYIAPPPAEARSEWEILLSVAERTKPEQAHLIHFADGQQIRNEI
FT                   ARIVPEYNGIQHLHQTGDHIQWGGRILCRDGRFGTPDGKAVFTPLKPPVTTLPPAMFVL
FT                   KTRRGKQFNSLIHDERDPLNGALRDDVLINPVDAATLGVREGDWVILRSAVGEMRARIK
FT                   FAPLKSGNIQVHWPEGNVLIDAHQRDPGAGVPSYKALVSIHPITEAVLQEQR"
FT   gene            234848..235422
FT                   /pseudo
FT                   /locus_tag="Caur_0185"
FT   gene            complement(235459..235869)
FT                   /locus_tag="Caur_0186"
FT   CDS_pept        complement(235459..235869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33439"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC46"
FT                   /protein_id="ABY33439.1"
FT                   /translation="MRVVIREVLNVGGFFAGETVTLAVQPWPDHGPEQTITIDDAAFVN
FT                   ITARHLLAPGMVLDLLFAGDRVEQATLLGAADHAGLRTALRPQPISPTPVPRVLSFHCP
FT                   HCNLWVPASGDPSGCGICGTPAPTLSLAVQST"
FT   gene            complement(235921..237333)
FT                   /locus_tag="Caur_0187"
FT   CDS_pept        complement(235921..237333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0187"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rrs:RoseRS_0683 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33440"
FT                   /db_xref="GOA:A9WC47"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC47"
FT                   /protein_id="ABY33440.1"
FT                   /translation="MLRIAYCSPVNPAPSGISDYSEELLPYLAQYAALTLFVEDGLRPT
FT                   NPHLAKHFPIKPIRQLERMARRGQFDAIIYHMGNSPAHAGIWRMAQRVPGVIVLHDFVL
FT                   HHFMLWYAANVQRDVQRYVAMMRARYGADGDHMAQLMIRSRFSEAAFAFPCNEDVLAAA
FT                   KAVIGHSHYLLRRVTATRPDLLCGYVPMGVPLPPLIDRIAARQRLGLPLDQPLLASFGH
FT                   INAWKRIEPTLRAVAGLRREGIDVHCLLVGSVSPNYDLKGVIQRLGLQEAVTVTGYVAR
FT                   AQFEDYVAATDVCLNLRYPTAGETSASLLRLLGAGKPTLVSAVDAFCELPPDVAAQVDV
FT                   DESETDLIIAYCRRLLTDPALAAALGARARAYVATEHTLAGAAQAMIEFLAKVYGWAPP
FT                   QRIRPDPLWDPTPVVEAETTPSPPSPQPAAPASLLLQTAAQAMAEIGLTEDDTGALQSV
FT                   ATKIAELQGKHP"
FT   gene            complement(237333..237857)
FT                   /locus_tag="Caur_0188"
FT   CDS_pept        complement(237333..237857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0188"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG:
FT                   rrs:RoseRS_2580 ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33441"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC48"
FT                   /protein_id="ABY33441.1"
FT                   /translation="MRLAGKQIAILLAEGVEDLEFYVPLMRLQEEGAEVLAAGLDLRPV
FT                   RGKNGLEITPTTTIAELRADDLFGLVLPGGWAPDKLRRYQVVTDLVRAMDAAGKVIGII
FT                   CHGGSIAISAGIVRGRPATGSTGIKDDLINAGALWVDEAAFRDGHLVWGRVVADIPVFC
FT                   RELVAALVERA"
FT   gene            complement(237972..238892)
FT                   /locus_tag="Caur_0189"
FT   CDS_pept        complement(237972..238892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0189"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: dar:Daro_3508 PAS:GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33442"
FT                   /db_xref="GOA:A9WC49"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC49"
FT                   /protein_id="ABY33442.1"
FT                   /translation="MASAVSFLPIITTDNALITQLSARLGSGWQIVPASTVTPGQPNLI
FT                   DLREQIPEGLAAYAEQVPLVGVVVDTAGAAHVLQIGVHEVLTVAELQPLCLTRAITSAT
FT                   IRWQIDQTRRQHLAEARAQVQALTVRLQNEQIRDPLTGLYTRRYLNETLDRELRRADRE
FT                   QIVLSVALIDIDQLEQVNWQFGRALGDAVLQHLAGLIGRQVRGGDIFCRYGSDELLLVL
FT                   PRVMPETAFQRAEQWRLSVAESIIRPGTLDLQVTISIGLASFPRDARNAVELMSRVGEA
FT                   LYAAKAAGGNCVRQWPGADRLLSQA"
FT   gene            complement(239302..240213)
FT                   /locus_tag="Caur_0190"
FT   CDS_pept        complement(239302..240213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33443"
FT                   /db_xref="GOA:A9WC50"
FT                   /db_xref="InterPro:IPR025645"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC50"
FT                   /protein_id="ABY33443.1"
FT                   /translation="MDRLKRFRVAFVIGIIVLLVGGAVVLFGQPGAMMSEQTSFVAMPT
FT                   PAPMLSGAPVPAQRDTASFAGGVSSGESAIGSEVAVQRLIIKNASIALEVADVLAAEQA
FT                   LRQKAEALGGFVASVETYGSGEDLRATIVLRVPVEHFEAVLRDAEGLASNVLRRSVSGS
FT                   DVTEEYVDLEARLRNLEATNARLLDLLSRAQNVNDALMVNQALTEIQEQIERIKGRMQY
FT                   LEQSAAMSTITVELLPVPPPTPIIEEDAWQPLEVARIALRNLIQLGQTLANAVIVFLVW
FT                   TPVWLPLVLIAVWARRRLSQRT"
FT   sig_peptide     complement(240127..240213)
FT                   /locus_tag="Caur_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.929 at
FT                   residue 29"
FT   gene            complement(240860..241345)
FT                   /locus_tag="Caur_0191"
FT   CDS_pept        complement(240860..241345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cya:CYA_0515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33444"
FT                   /db_xref="InterPro:IPR040890"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC51"
FT                   /protein_id="ABY33444.1"
FT                   /translation="MTTPCECSPTESATCGLNTPRRQTVSCPVCGASGKRVGLQTVKAL
FT                   VSISLRQVQGSSFWFCRSQHCPVVYFAADNGQTLTVDQIRERVYQKEPERPDVLVCYCF
FT                   QYRVGDIQQASPEARAAVIADIKAGIAADQCACDVRNPQGSCCLGNVQQVAKQVKLT"
FT   gene            241621..243909
FT                   /locus_tag="Caur_0192"
FT   CDS_pept        241621..243909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0192"
FT                   /product="PAS sensor protein"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: gme:Gmet_2788 histidine kinase; TIGRFAM: PAS
FT                   sensor protein; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33445"
FT                   /db_xref="GOA:A9WC52"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC52"
FT                   /protein_id="ABY33445.1"
FT                   /translation="MAALPFVMIYLIPAIIATGLAIVMWQRRYYRGGRPFTLLLAAIAW
FT                   WNLCHALSIADTTFEGTLFWSLLQNVGIVLIGPCWLLIALAYSGEWWRVDRRIRRGIFI
FT                   PELIALIFALTNNLHYLWWSTVVADTSRPFLWLSVTRGPAFWFHSIYAYVCLAIGIIIL
FT                   FRASAHAPPVHRYHSRLMLAAALIPAVGNIAFLSGLKVPWNDDPTPILLLISAALAMYT
FT                   TMRYQLYDLAPLAEQEVIAGLPDGLIVLDSRGLVAEINQHAPRLLGIQQGRWIGRSLTS
FT                   LIVNSPFERDLQRLLNTPVTGPSRPVICENGTQAIEVRLRPLQSAAGITTGSLLLIRDV
FT                   SERMRAEQERARHIAALRLINSIARSANTAQETSTLLKTIAHIIVQEGHWERVSIGLID
FT                   NAQNIHVTIDYTTAGYGRLHDQVISGVAASALIERIQHGRPELINLSELTVTDPLAETM
FT                   QQEGLQSLLLAPLRHDQHAAGILGLASSETKSMTPTLTELVIAIGELITDALIRIRLYE
FT                   EVQRADRLKTGFLATVSHELRTPLTTIIGYTDMLRRGVLGELSPEVQETLHYMRQASLN
FT                   LMRLISDILEFSRMEAGQLIIDIEPVPVSVIVQNVVGQMQPQIREHQLHLMVNIPPDLP
FT                   MIQANAGRLEQVLINLLSNAIKFNRPQGLIEIKAETRGEWVRISVRDTGIGIAPADQER
FT                   IFEEFERVKQKNGHSVSGVGLGLAICRRLIQHMGGKIGVKSTPGEGSTFFCDLPVVPVS
FT                   RTVGAEADV"
FT   gene            complement(243930..244271)
FT                   /locus_tag="Caur_R0002"
FT   ncRNA           complement(243930..244271)
FT                   /locus_tag="Caur_R0002"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 52.89"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(244924..246468)
FT                   /locus_tag="Caur_0193"
FT   CDS_pept        complement(244924..246468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0193"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /note="TIGRFAM: nicotinate phosphoribosyltransferase; PFAM:
FT                   Nicotinate phosphoribosyltransferase-like; KEGG:
FT                   ttj:TTHA0617 nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33446"
FT                   /db_xref="GOA:A9WC53"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC53"
FT                   /protein_id="ABY33446.1"
FT                   /translation="MNNVQQRTATGILFTDQYQLTMAQLYFRMGIHERMAQFDHFFRQP
FT                   PNYGLHAAGYCIAAGLEWLLDWMETACFGPAELEVLRNQRNRVGNPIFAEDFLTYLSRH
FT                   GHFGGMTLWAVPEGRVVHAQAPMTIVRGPLLMAQILETALLNHLNYQTLVATKASRIRE
FT                   ASGASTVLEFGLRRGQGMGANAGTRAALIGGADFTSNVGLAHTVGQTAKGTHAHAMVQA
FT                   FLALGMSELDAFRAYAEVYPDDCLLLVDTIDTLNSGLPNAIRVFEELRAKGHKPVGVRL
FT                   DSGDLAYLAIQTALMLDRSGFPDTVIVLSNDLDELVIWQIQSQIVQEAPRYNADANAII
FT                   RRLVYGVGTRLVTSHGEGALGGVYKLVALHDGREWQPAIKIAESAAKLTNPGLKRVWRL
FT                   YDSRGKATADLIALEDEDPTQEELIRLRHPSDHARQRVVVRAELTGIEPLLEPAMLAGR
FT                   RLIEPQPIEQMRARRYADVERLDLGVRRIMNPHIYHVSLSQRLWDMKQELLNRFQM"
FT   gene            complement(247214..248317)
FT                   /locus_tag="Caur_0194"
FT   CDS_pept        complement(247214..248317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0194"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: rca:Rcas_1721
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33447"
FT                   /db_xref="GOA:A9WC54"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC54"
FT                   /protein_id="ABY33447.1"
FT                   /translation="MSPQLEVQLIAVIIAAACTLPGVFLVLRRMAMLSDAISHTVLLGI
FT                   VLAYLISGNLSSPLLFAGAVAMGVLTVWLVELMSGSRLMHEDAAIGLVFPALFSLAVLL
FT                   ISRFAGNVHLDTDSVLLGELAFAPFDRIELFGLSLPRALVVGSGTLMLNLILLVLFYKE
FT                   LKLATFDPALATTLGFAPALIHYGLMTSVSLTAVTAFDAVGSILVIALMVAPPATAYLL
FT                   TDRLPRMILLSVAIGIASALSGYWLARWFDVSIAGTMATMTGIAFLLAFLFAPRRGIVA
FT                   QRRQQQINRERFALQMLTLHLLNHEGTRDANVECHPRHLIEELHWPAAFAGAIVRQAEQ
FT                   HGLVQRRGDMLVLTEQGRLFAAEASVR"
FT   gene            complement(248330..249205)
FT                   /locus_tag="Caur_0195"
FT   CDS_pept        complement(248330..249205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0195"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: rca:Rcas_1722 ABC-3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33448"
FT                   /db_xref="GOA:A9WC55"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC55"
FT                   /protein_id="ABY33448.1"
FT                   /translation="MELFTDYTFRNVTLGAMLIGAISGFLGSFAVLRRQALLGDAMSHA
FT                   ALPGIALAFLITGQRDPFSLLIGAAVAALVAALWLLAVVRTTRIKDDAALALTLAVFFG
FT                   FGLVLLSYLQRQPHAAQAGLKSFLFGQAAALIERDLWAMLAIGLPALALVLIFWPQVKL
FT                   ISFDPDFARSLGVPVRRFEVLLTGIIVVAIVIGLQTVGVVLMSAMLIAPAVAARQWTNR
FT                   LEYMVVLAAGFGALASLIGAWISTLGEGLATGPLIVLVMSLFTMISLLLAPERGLIWRH
FT                   IRRQRVIAFD"
FT   gene            complement(249226..250002)
FT                   /locus_tag="Caur_0196"
FT   CDS_pept        complement(249226..250002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0196"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rrs:RoseRS_3069 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33449"
FT                   /db_xref="GOA:A9WC56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC56"
FT                   /protein_id="ABY33449.1"
FT                   /translation="MEVAVDIKDLTVAYGDKPVLWDVDLQVPRGVLMAIVGPNGAGKTT
FT                   LLKAMLGLVRPAAGSVRVFGRPYHQQRHLIAYVPQRSSVDWDFPTTVLDVVLMGRYGHL
FT                   GWFRRPGRAERDAALAALAQVQMADFAHRQIGQLSGGQQQRVFLARALAQAAEIYVMDE
FT                   PFQGVDAVTERAIINVLRDLRAAGKTVVVVHHDLQTVTEYFDHVALINVRRIAAGPVAE
FT                   VFTEANLRATYGGRLALLHTPTDTAPAARPTPAPGD"
FT   gene            complement(250016..250933)
FT                   /locus_tag="Caur_0197"
FT   CDS_pept        complement(250016..250933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0197"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   rrs:RoseRS_3070 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33450"
FT                   /db_xref="GOA:A9WC57"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC57"
FT                   /protein_id="ABY33450.1"
FT                   /translation="MILRCSLITILLLILTGCTAPVTDGRLRVVATTGPIGDAVQAIAG
FT                   DRVTLHTLLGPGIDPHTYIATESDLFALQEARLILYNGLHLEANLERVFQAIKRSGTIP
FT                   VVAVAEAVPVEMRLRWEDDEKAYDPHVWHDPQRWRYAVIAIRDALIDLDPDGREVYQQR
FT                   SEQYLNDLQALDADLRALAEQVPPERRILVTAHDAFNYFGQAYGFRVEAVQGISTASEA
FT                   SAATIRDLTTLVVTERIPAIFVETSVSPRTIEAVQSAARAAGHEVRVGGELYSDSLGDA
FT                   NGPAGTYFGMMRHNMQTIVAALMP"
FT   sig_peptide     complement(250862..250933)
FT                   /locus_tag="Caur_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.436 at
FT                   residue 24"
FT   gene            complement(251566..252552)
FT                   /locus_tag="Caur_0198"
FT   CDS_pept        complement(251566..252552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0198"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bce:BC2064 ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33451"
FT                   /db_xref="GOA:A9WC58"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC58"
FT                   /protein_id="ABY33451.1"
FT                   /translation="MHSHGQGWTVGHVGANSRCGVTHTLSPNLTLQYDRCLAGDTAAER
FT                   IINNHMTLDIAIIPAADWPALVELFARCNRADNIELPVYLDGDWTPTMAAARIGETLVG
FT                   GVVMYGYFAIEAVIAVDPAWRRRGFGRQLIEQIERWAYARGGNWIALADEAGSCVAPFV
FT                   AALDLHRLNVEVELQLDPAQLPPLPEAPDDWQVRLAEKDDVATLTSIIVSAFGDPVEQV
FT                   SAFVSDRITHPRHRFVIAEMAGHPVAALRLLRAEQTIIITTFGVCRDLQGRGYGKLLLL
FT                   TTLHRLQAAGYQDIRIEVEEQNTAAYHLYRSSGFVPRRRLGQYGRPR"
FT   gene            complement(252795..253025)
FT                   /locus_tag="Caur_0199"
FT   CDS_pept        complement(252795..253025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33452"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC59"
FT                   /protein_id="ABY33452.1"
FT                   /translation="MRNGTFEQLTVEEVLQTFGPEARAFLRENRIDRSNLRFADACAAA
FT                   SVTPDEFFAQLDAGMRRRAARAARHSVAEYA"
FT   gene            complement(254264..255088)
FT                   /locus_tag="Caur_0200"
FT   CDS_pept        complement(254264..255088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_4132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33453"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC60"
FT                   /protein_id="ABY33453.1"
FT                   /translation="MIGRNRVQVVTEAITLQYANGKSMARPIGGKRFTPYIGFHIEVGR
FT                   DDELDARLGIAGIPQIEIKHQRQGGAEIVRHWALGETILFYPVTSGPVAQTVAGSLGRN
FT                   AAATAAAGIGLRWGINDRSRMAVRGYLDLLVRVEMARLVQLSVRSRMSDVLLNVLLDHG
FT                   RVCEAADHLIDRSSHPDLVTFHELALPLGPGEEEEWGKGETTTVVPFKSLHPAQIDRDY
FT                   IQRIWRPESVHQAALRDWAGIQAWASEYALQNDERVTGERNDVVETSHEIGR"
FT   gene            complement(255295..259257)
FT                   /locus_tag="Caur_0201"
FT   CDS_pept        complement(255295..259257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0201"
FT                   /product="autotransporter-associated beta strand repeat
FT                   protein"
FT                   /note="TIGRFAM: autotransporter-associated beta strand
FT                   repeat protein; PFAM: Ig domain protein group 1 domain
FT                   protein; Ig family protein; KEGG: spu:761405 hypothetical
FT                   protein LOC761405"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33454"
FT                   /db_xref="GOA:A9WC61"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC61"
FT                   /protein_id="ABY33454.1"
FT                   /translation="MQFWRGAMNRPIPRALLSTLAVILLLIWSLVFSPVFAATSTWIGG
FT                   NGSWSDPTKWSGGVPSSRHDVAVFPYTPFPLAIDLDGTFEIGEVRFDSPMPYLLMTNSN
FT                   GSLYFPPAGAGAIRVLSGNHVIYVPIELQKIISFDIAADSSLLIFSPNNLLRGSGGITK
FT                   TGEGELYLLAANEHRGRTTINGGAIVIAHNQAFGTSKLELLSGRLINAGSDRIITNEIS
FT                   QLNNNFTLDSGDYRLSFSTPWSLPGNREITVEGDVIFAKITDPAASRNLRKNGAGDLTI
FT                   NLTASGSNIGSFVRNQGSGRLNLYGSGTVGAIVYNPTSGGGEIGVGDQRDLNTGAVIRG
FT                   RGTLSIAGNGDGVRLHSPNISLHFEIGPGGDKLVLINTSNNSTRNASIELVGTGNPAGA
FT                   TLSLALVPGYTPVAGDIWTILEHASAGSGGILGTFQGLPNGAVIDVDGYPFQIVYTSKT
FT                   VSLVALPPLVVEQRGGNNQSAVVDTDFAQPLEVWVGDENGNPLSGVYVSFTAPASGASA
FT                   VFPAGNGAVSDANGLVQVPVRANNVAGTYTVTASVANASTDFTLTNIAAAPSPTPSPSA
FT                   TASATPEPTASVTPEPTASVTPEPTASATPEPTASVTPEPTASATPEPTASVTPEPTAS
FT                   ATPEPTASVTPEPTASTTPSPSATASVTPSPSATASVTPSPSATASATPEPTASTTPSP
FT                   SATASTTPEPTASTTPSPSATASTTPSPSATASATPEPTASTTPSPSATASVTPSPSAT
FT                   ASTTPSPSATASVTPSPSATASMTPSPSATASATPEPTASTTPSPSATASVTPSPSATA
FT                   STTPSPSATASTTPSPSATASATPSPSATASVTPEPTASTTPSPSATASATPEPTASVT
FT                   PSPSATASVTPSPSATASVTPSPSATASTTPSPSVTASTTPSPSATASTTPSPSATAST
FT                   TPSPSATASTTPSPSATASTTPSPSATASTTPSPSATASATPEPTASVTPSPSATASTT
FT                   PSPSATASVTPSPSATASVTPSPSATASTTPEPTASTTPSPSATASTTPSPSATASTTP
FT                   SPSATASTTPEPTASVTPSPSATASVTPSPSATASTTPEPTASTTPSPSATASATPEPT
FT                   ASTSPVSTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTT
FT                   SPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTETPSPVPTPGEAPH
FT                   LELSLPPSIAVGSLVQTQLNASGGSGSYVYQSTGQLPSGLVLLADGRLEGQVTQVGTYT
FT                   FTIIVTDSNGQTASYTYEIVVEPMRIFVPVIMRAAP"
FT   sig_peptide     complement(259144..259257)
FT                   /locus_tag="Caur_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 38"
FT   gene            259575..260486
FT                   /locus_tag="Caur_0202"
FT   CDS_pept        259575..260486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0202"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   mms:mma_3532 transporter of the DMT superfamily,
FT                   chloramphenicol-sensitivity protein (RarD family)"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33455"
FT                   /db_xref="GOA:A9WC62"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC62"
FT                   /protein_id="ABY33455.1"
FT                   /translation="MTNKTTLQGISAAIAAYALWGLLPVYWKALNGASATEILAHRMIW
FT                   SLLFLLGVLAIRRQWEWITVIRQQRRLRLTYLASAILLAANWGIYVWAVQINRVVEASL
FT                   GYFINPLVSIALGVLVLRERLRPAQWLAIGIAAAGVAWLTYSAGALPWIALALALSFGL
FT                   YGLLRKQTPLGSFEALTVETLWMFPPALLWLSWLAGANGGIHHDTGLWMLLISTGVVTA
FT                   APLLFFGAATRRIPLTTIGILQYLAPTLQLVLGVLVYGEPFSTAQLIGFGAIWTALAIY
FT                   TLDSFIAVRHYRAKLSQEAIQR"
FT   gene            complement(260447..261064)
FT                   /locus_tag="Caur_0203"
FT   CDS_pept        complement(260447..261064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0203"
FT                   /product="protein of unknown function DUF121"
FT                   /note="PFAM: protein of unknown function DUF121; KEGG:
FT                   rxy:Rxyl_0959 protein of unknown function DUF121"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33456"
FT                   /db_xref="GOA:A9WC63"
FT                   /db_xref="InterPro:IPR002835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WC63"
FT                   /protein_id="ABY33456.1"
FT                   /translation="MIGIVIPIKRLHLAKSRLIDLLDPADRQQLVVTMVRHVITTARQA
FT                   VSYLSIPARIWLVSPEPTLATDSEGIEWLPDNQEELNAALTEARQRIQAAGVQIMMVLA
FT                   GDLPFVTVRDLILLSEALTDNDVVVAPDQHGQGTNALGLHLPSQLPFGFGPDSAGYHLR
FT                   TAARLGLRASLISTPTLAFDLDDGERLQQYYRCIASCDNFAR"
FT   gene            complement(261061..262017)
FT                   /locus_tag="Caur_0204"
FT   CDS_pept        complement(261061..262017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0204"
FT                   /product="LPPG domain protein containing protein"
FT                   /note="TIGRFAM: LPPG domain protein containing protein;
FT                   PFAM: protein of unknown function UPF0052 and CofD; KEGG:
FT                   rca:Rcas_3979 LPPG domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33457"
FT                   /db_xref="GOA:A9WC64"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010115"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC64"
FT                   /protein_id="ABY33457.1"
FT                   /translation="MIVVLSGGVGAARFIEGLAAVVAPERIAAVVNTGDDMVLHGLYIS
FT                   PDLDIVTCTLADVIDRNQGWGIAGDTDACMQWLARLGAPTWFKLGDRDLALHIYRTARL
FT                   QAGATLSQVADEIRQALGVAVSIIPMSDDPAPTHVLTDQGELHFEEYFVRERCQPVVHG
FT                   VRLHAAGPVRPAPALLPLLMSAEVIIIAPSNPVVSVGPILAIPEVRTTLTTTNTPVVAV
FT                   SPIVGGAAIKGPAVPLMKAVGLTPTALGVAETYADLIDGIVIDTIDAELAPAIQSRGIA
FT                   TLVTDTIMRGMPEKMALARATLELASLIAPSTARSLV"
FT   gene            complement(262084..262935)
FT                   /locus_tag="Caur_0205"
FT   CDS_pept        complement(262084..262935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0205"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: rrs:RoseRS_1818
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33458"
FT                   /db_xref="GOA:A9WC65"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC65"
FT                   /protein_id="ABY33458.1"
FT                   /translation="MITGVSNKANPATAQAVVIDVTEATFEREVLQRSQQTPVVIDFWA
FT                   PWCGPCRVLGPTLERLAREAGGTWVLAKINVDENPRLAQMFRVQGIPAVKAVYQGKIVD
FT                   EFTGALPESQVRTWLKRIVPDRNADLLAMAQALEATNPVEAIARYRLILGQDPNNEAAL
FT                   FHLGRLLALRGDPEGITTLKQVPAGGPFGGRAIAGLAIADLVNAPAEPADGSEGLYRQA
FT                   AIAVRSGDYATAIEHLLTLVARDRAFRDDGARKALLALFALLGDDHPLVGPARRRLANL
FT                   LF"
FT   gene            complement(263035..263784)
FT                   /locus_tag="Caur_0206"
FT   CDS_pept        complement(263035..263784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33459"
FT                   /db_xref="GOA:A9WC66"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC66"
FT                   /protein_id="ABY33459.1"
FT                   /translation="MMTSTTSPRVHRLLRGWWIAKHLFALIIFVTLITLGFWQLDRLAQ
FT                   RRAANAARLAALSQPAIPLTPATDPATVIGRRVVVSGTFRNEESVVLRGRRSDSGVDGV
FT                   HLLTPLQIAGSDQAVLVDRGWIPSAQGAATAYAVTRPVTIEGIARAPQVRPDSPLAGRD
FT                   LPLPGETRINAWLRVDVPAIQQQVGAPLLPLFIEQLPDGSSALPRPPDPYRLDEGPHLS
FT                   YALQWFTFAGIVGVGYIFLLRQELQRR"
FT   gene            264040..264711
FT                   /locus_tag="Caur_0207"
FT   CDS_pept        264040..264711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0207"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   6-phosphogluconate dehydrogenase NAD-binding; KEGG:
FT                   cyb:CYB_1337 K+ transporter, trk family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33460"
FT                   /db_xref="GOA:A9WC67"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC67"
FT                   /protein_id="ABY33460.1"
FT                   /translation="MARKPSRLEFAVIGLGRFGRSVALNLIERGHTVLGIDRDPNIVQQ
FT                   LADRMTQVVALDSSNEDALRAVDIMSFDTVVVAIGSQFEANLMTTVALKSLGVKRVVCK
FT                   ALNERQQYILTRVGADMVVLPEHEAGARLAWQLSEPHVLEHLNLGSGFSVAEVRVPAPL
FT                   VGQTLMQSGLRRRYGINVLAVKHNGKMIVTPPPDYVFSRDDRILIIGADSSISTFCDLS
FT                   S"
FT   gene            264708..266084
FT                   /locus_tag="Caur_0208"
FT   CDS_pept        264708..266084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0208"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: cation transporter; KEGG: rrs:RoseRS_2088
FT                   H(+)-transporting two-sector ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33461"
FT                   /db_xref="GOA:A9WC68"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC68"
FT                   /protein_id="ABY33461.1"
FT                   /translation="MTALVTGRNLARLRRKPIPPPLRLVGGLALLIVIGTLLLLLPISS
FT                   TRPLTFMEALFTAASALSVTGLSVITPVQDLSLVGQILLMLLIQIGGVGFMVVAVIIFR
FT                   LLGRRISFTDRIALSDSLGLLSPAAIVTLTRRVLITVVTIEAIGAMLLYIHWRTDPRLS
FT                   EGQAFFYALFHAVSAFCNAGFDLFTGTPGFENGIPRDSITLFIMGMLILTGGLGIPVIA
FT                   DLISYANERKLSLHTRITLLVVSFLVGIGTFGLWLSEGFDADGTLHGQPLDRQLIVTTF
FT                   QSISARTAGFSGMDSFESLTPASQLLLIALMFIGCAPASMGGGITTGTFAVLSISLWSY
FT                   ARGLPTAQFAGRSLATGMVRRAAAVLTISLFVVLLASWLIVATHDATLDQVVFEVVSAF
FT                   ATCGLTLGFTSELNTFGQLIIIAVMFWGRLGALTIITAIARQSATPQQITYPEEQILIG
FT                   "
FT   gene            266088..267269
FT                   /locus_tag="Caur_0209"
FT   CDS_pept        266088..267269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0209"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: rrs:RoseRS_3875 putative oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33462"
FT                   /db_xref="GOA:A9WC69"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC69"
FT                   /protein_id="ABY33462.1"
FT                   /translation="MRHLYLHIPFCHRRCSYCDFNTYANMEHRIEAYVDALCQELAMLR
FT                   DQLPPLPASPEAAALRPSIFFGGGTPSMLSPAQIERILQAAAEIVPLTGAEISLEANPG
FT                   TVLGRDYLRDLRSLGINRLSMGVQSLHDPTLRMLGRIHTAAEAYASFNDARAVGFESIN
FT                   LDFIFGLPGQDIEQWRATLTEIIRWEVDHIALYSLILEENTPLYAQVTAGRLQIPDDDL
FT                   TGAMYELAMEMLGAAGYRHYEISNWVRPSVSDRPDAPPALACQHNLAYWLNSDYLAAGA
FT                   GAHGHVFPQRYANLRPIDSYITAVQSGRRPIAETTLLTSADLAAETMFMGLRLDIGVGF
FT                   AHFAARVGQSLLDYYGPTLEQLSQQGLIECSAQRVYLTPRGRMLGNQVFAHFV"
FT   gene            267365..268417
FT                   /locus_tag="Caur_0210"
FT   CDS_pept        267365..268417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0210"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; dihydroorotate dehydrogenase;
FT                   KEGG: rrs:RoseRS_0864 putative TIM-barrel protein, nifR3
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33463"
FT                   /db_xref="GOA:A9WC70"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC70"
FT                   /protein_id="ABY33463.1"
FT                   /translation="MNNNITLEEIARLPTSYQVAHIRIEPNIILAPMAGVTDSIFRRMI
FT                   LRLGGCGLVSTEMTNAASVSPKALRRHRLLDYLPEERPLTMQISGNDPDLVANAARVVE
FT                   QLGADIIDINCGCPSPKVTGGGHGSALLRDLPKMERLLRAVREAVQIPVTLKFRAGWDE
FT                   QSLNFIEAGKRAEAAGVSALALHPRTREQGYKGQADWSRVAALKQAVSIPVIGSGDVTS
FT                   AHDALIRLRDSGADGVMIGRGAMANPWIFRQIADLRRGVTPYVPTPADKRNLLIEYMTI
FT                   CAEELPERLALNKIKQLIGQFHVGLPGSNHLRVAVHTSTSLAEARDAIERFFAPFLESD
FT                   RVVQEMVAAD"
FT   gene            269002..271686
FT                   /locus_tag="Caur_0211"
FT   CDS_pept        269002..271686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0211"
FT                   /product="polymorphic outer membrane protein"
FT                   /note="TIGRFAM: polymorphic outer membrane protein; PFAM:
FT                   Polymorphic membrane protein Chlamydia; KEGG: rca:Rcas_2873
FT                   polymorphic outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33464"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR026457"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC71"
FT                   /protein_id="ABY33464.1"
FT                   /translation="MKRFLIRFWVFLLIVTLLRVDQPMHVVQAAGFVVNSLADDTVDND
FT                   LCTLREAILTSNNIPPNDDCGPGSADDDVITFSVSGTIVLNTPMVNITSGQGALTIDGG
FT                   RNIVISGNNLAIFTVAVGADLTLSNLTVTDGNATLGGAINNLGGTVNIINSTFSNNDAS
FT                   NLGGAIYNTGGIVTITSSTFTNNSSATLGGVIYNTGGTVTITNSTFSNNNAALLGGTIY
FT                   NVSGTINLYNTIVANSGSSGDCVNLGTIGAAYNNLIEDSTNACGLINGVNGNIIGSDPD
FT                   LGPLTGAPAYFPLNTGSPAIDNGSNAYCAATDQRGVLRPQDGDGNSSVVCDIGAYEVDI
FT                   ATRTVVNITRAGADPTNAATATFTVTFSEPVTGLDSADFSLTTTGSISGASVGSVSGSG
FT                   ASYTVTVTTGSGDGTLRLDIPTAATITDLAGNTVGGLPFTGGESYTIDKTTPTVVNITR
FT                   AGADPTNATTATFTVTFSEPVTGLDSADFSLTTTGSISGASVGSVSGSGASYTVTVATG
FT                   SGDGSLRLDLNPSGTGITDSAGNAISGGFTGGESYTIDKTTPTVVNITRAGADPTNATT
FT                   ATFTVTFSEPVTGLDSADFSLTTTGSISGASVGSVSGSGASYTVTVTTGSGDGSLRLDL
FT                   NPSGTGITDSAGNAISGGFTGGESYTIDKTTPTVVSITRAEADPTNAATATFTVTFSEP
FT                   VTGLDSTDFSLTTTGSISGASVSSVSGSGAAYTVTVTTGSGDGSLRLDIPTAATITDLA
FT                   GNAVGGLPFTGGESYTVDRSLLTVTINQAPAQTDPAISSPIRFIVIFNKPINPTTFTAS
FT                   DITLGGSAPGTLTVTITEIAPNNGTTFEVVVSGMSGNGTVIASIPVNVVQDLAGNGNTA
FT                   STSTDNEVTYQPEIRIYLPVIMR"
FT   gene            271968..272450
FT                   /locus_tag="Caur_0212"
FT   CDS_pept        271968..272450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33465"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC72"
FT                   /protein_id="ABY33465.1"
FT                   /translation="MHDGYLFTLGICGSAEEDDPGPVMLNSLLAALPPVKRAAFLGTIP
FT                   SDQPDQLIAEIITDMRDAELIVIVTPATTPQLPNRLNNLLRAAYAAGVGGRFATLIAVG
FT                   PYAAAVLPALQAAAATCGLRIASTCAANTDDEPPLADVQAAYATARAALAPHALPH"
FT   gene            272460..273275
FT                   /locus_tag="Caur_0213"
FT   CDS_pept        272460..273275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0213"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   rrs:RoseRS_2705 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33466"
FT                   /db_xref="GOA:A9WC73"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC73"
FT                   /protein_id="ABY33466.1"
FT                   /translation="MQAMTTPRIPANKIWIADEAIYYLLARPALKRSFDHVWFAQYGPR
FT                   PDPRHGPYIFYLNHSAWWDGYMMMLIHRAIMHRAFDSYVMMEERQLRAYRFFTWCGAFS
FT                   IERRDPDDAQRSQLYAANLLRERRDRALYIFPQGRIEANDYRPLTVYPGIARIAALVGD
FT                   VTLCPIALRYEFLGQQWPHAFVQIGPAHPPASRDDIEAIRRDVAMRLTDAVDRLRTDVI
FT                   EQRLGRFQPLLSGRWGIDRTWDAVRGWFRRRGGDDGPAAVAANRLRARS"
FT   gene            complement(273196..274053)
FT                   /locus_tag="Caur_0214"
FT   CDS_pept        complement(273196..274053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0214"
FT                   /product="protein of unknown function DUF422"
FT                   /note="PFAM: protein of unknown function DUF422; KEGG:
FT                   rrs:RoseRS_2706 protein of unknown function DUF422"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33467"
FT                   /db_xref="GOA:A9WC74"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC74"
FT                   /protein_id="ABY33467.1"
FT                   /translation="MFSDQSILQNLRRAVVTLFAVYLFIYPFAIVLVALDKVPVWGTWM
FT                   GGALLILQGTLMGFWLTVRYRWWGAIAAGLILVVSWAVEHVGATTGFPFGSYSYTDVLQ
FT                   PQIFGVVPLAIPFAWLLIVVAAVGVAERIGHRDGKPVNDHQLNPTRVLTAASFALLLDV
FT                   TIEPFAVYINRYWVWSSAEGGVYYGIPASNFIAWWVTSLILSWVLLHQRRSAARRGHTP
FT                   QPFMIWLPPVLYLTNLTMFVVVNLARGQVLPALIGGLIMIVLAGDWLLPRLARRLRRVA
FT                   ETNP"
FT   gene            275167..275586
FT                   /locus_tag="Caur_0215"
FT   CDS_pept        275167..275586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0215"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rca:Rcas_1967 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33468"
FT                   /db_xref="GOA:A9WC75"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC75"
FT                   /protein_id="ABY33468.1"
FT                   /translation="MVNTNGHPVRILLVEDDNNIGRIIELAMRSINTPYEFESVLSAEE
FT                   ALERWEAQPFDLLISDYNLRGMNGVRLVKTLRERGYYPATLMVTAYDSAEVREAVKEAA
FT                   IDSYMTKPFFIDELIENIKQLLPGSKQMRERIING"
FT   gene            complement(275669..276721)
FT                   /locus_tag="Caur_0216"
FT   CDS_pept        complement(275669..276721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33469"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC76"
FT                   /protein_id="ABY33469.1"
FT                   /translation="MSAWATIADLTEDRVIYRDLQPCDASLPGLPALRTLLGLPANATP
FT                   RKRDTAYARVILALARAAQALRNGPPLTHVVVIGDTENDRLLTLHLQALAEVAAYGFIG
FT                   VDRPVAPATLDWEGVVATATRWALVHEWAATLTARGVPWAQTAVLIDIDKTLLGPRGRS
FT                   DGAIDDARAEAALIVATDLLGDRFDRTVFRQYYTTLCRREWHAITLDNQDYTVAMALFA
FT                   TVDVFDLPAIEVQLAAGLSPTLLELLIAAQQVPVELQALRRQLIEQIEAGNPTPFTQFR
FT                   RAELVTTAARMADGRLTLSNELFTLGRRLQAQGALLMAASDKPAESALPSPEQQTAGLL
FT                   PLHRTPALLD"
FT   gene            complement(276718..277767)
FT                   /locus_tag="Caur_0217"
FT   CDS_pept        complement(276718..277767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0217"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: mka:MK1389 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase NAD -
FT                   binding; Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33470"
FT                   /db_xref="GOA:A9WC77"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC77"
FT                   /protein_id="ABY33470.1"
FT                   /translation="MATIPVAVLGATGAVGQRFIQLLEGHPLFQVVALTGSERSAGKKY
FT                   HEVCRWVLDTPMPAAVANLTVLDADADLPAQLVFSALPSTVAGPIEQRLAAAGHIVCSN
FT                   ASNHRMEPDVPLIIPEVNPDHLALIPVQRRRRGWSGAIVTNPNCTSTPATMVLRPLLDT
FT                   FGVRRMLLVSMQALSGAGYPGVPSYDVVDNVIPYIGGEEPKLEIEPQKMLGRLEGETIV
FT                   PAGFTTSAHCNRVPVLEGHLVCLSIELERKADPAEIATVLSNFRALPQELRLPTAPEQP
FT                   IIVRHEPDRPQPRRDRDAGRGMATVVGRIRPCSLFDIKLIALSHNTIRGAAGASILNAE
FT                   LMHAQGWLA"
FT   gene            278042..278425
FT                   /locus_tag="Caur_0218"
FT   CDS_pept        278042..278425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33471"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC78"
FT                   /protein_id="ABY33471.1"
FT                   /translation="MIDPLVQRLLEQVLDTPTKLHMLLMFHEHPRCELTAAAIAERLFR
FT                   DIWSVEQALEDLTAAGFLSVAQVTGGQPVYRYTPPPEWHEAIRRLVRSYNDPIERDMIQ
FT                   RTIRDLSVYASFRRSELERFEFV"
FT   gene            complement(278675..279451)
FT                   /locus_tag="Caur_0219"
FT   CDS_pept        complement(278675..279451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0219"
FT                   /product="Rare lipoprotein A"
FT                   /note="PFAM: Rare lipoprotein A; KEGG: rca:Rcas_2307 rare
FT                   lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33472"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR036749"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC79"
FT                   /protein_id="ABY33472.1"
FT                   /translation="MQWSAGRLQIALVICLTGFFWLIANPVFTQPPYRVHLPLVVRPAQ
FT                   NPLLSGEATFYLEADGSGSCLFDPIPGDKMVAAISYLNYGNADYCGAYVEVFGPQGSVV
FT                   VRIVDMCPDNPGCGQNHLDLSPEAFDRIAPRAWGRVPITWRVISPPLSGPVQFHLKDGS
FT                   NPWWLAFQVRHHRNPIARMEYRTPQGQWVQLNRTTYNYFIRQCQCANGELGPFTLRITD
FT                   IYGNVLTETVQFTTLSRSSNSPGELVSGTGQFPYGP"
FT   sig_peptide     complement(279362..279451)
FT                   /locus_tag="Caur_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.910 at
FT                   residue 30"
FT   gene            complement(279577..281388)
FT                   /locus_tag="Caur_0220"
FT   CDS_pept        complement(279577..281388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0220"
FT                   /product="oligoendopeptidase F"
FT                   /note="TIGRFAM: oligoendopeptidase F; PFAM: peptidase M3A
FT                   and M3B thimet/oligopeptidase F; Oligopeptidase F; KEGG:
FT                   dge:Dgeo_1084 oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33473"
FT                   /db_xref="GOA:A9WC80"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC80"
FT                   /protein_id="ABY33473.1"
FT                   /translation="MQTVKERSAIPDQYKWDPYSIFPSQEAWEAAITETDAMIASAAQF
FT                   RGRLQEGPQVIGEFLALSEDILRNVGQITVFATMFYTVDTNDREASAMRDRAIGLQARA
FT                   SAALAFGEPELLAIGGDQLLAWAERDEHLNTYYHYFERLIARAAHIRSAEVEELLGQVR
FT                   DPFAAASAVHGVLANAELRFPPAYDSNGEAHEITQGTINALITHPDRTLRKNAWEGYAD
FT                   AHIAVENTMAQCLAAGVKQNVFIARARRYASALEAALKPNFIPLEVFHNLIATFERHLP
FT                   IWHRYWRVRRAALGVDELHVYDTKAPLATPLVVPYEQAVDWICEGMAPLGQEYVQIMRR
FT                   GLREQRWVDVYPNRGKRAGAFSTGAPGTHPFIMMSYNDDIFGLSTLAHELGHSMHSYYT
FT                   RRTQPVIYTNYGLFLAEVASNFNQALVRDYLFKTLTDRNAQIAIIEEAMSNFHRYFFIM
FT                   PTLARFELAIHQRAERGQPLTATIFNDLMADLFAEGYGTEVVVDRARVGNTWAQFSTHL
FT                   YANFYVYQYATGIAGAHALAAPIIAGEAGAAERYINEFLKAGGSRFPLDILRRAGVDLA
FT                   SPEPVERTFAVMASYVDRLEQLVASAD"
FT   gene            281835..282563
FT                   /locus_tag="Caur_0221"
FT   CDS_pept        281835..282563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0221"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport protein; Ion transport 2 domain
FT                   protein; KEGG: vco:VC0395_1082 putative potassium channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33474"
FT                   /db_xref="GOA:A9WC81"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC81"
FT                   /protein_id="ABY33474.1"
FT                   /translation="MSSEQRATLLHRFERISELPMLLLSFGFLIIFLLVESNVFEATIT
FT                   LVLDGLLWLIWGIFLAELVAKLYLAPDRLHYLRSHWFEVIIIVLPFLRPLRLLWLPIVL
FT                   ARLWKQSQRALRRKMPAFIGVSSLVMVLITATLMFIAERGSGGPITSFADAIWWALATI
FT                   TTVGYGDTYPVTALGRGIATFLMIAGIALFGLLTANVAAFFVEEDTVDRSQADLAMINE
FT                   RLARIEQLLAEIVQREARER"
FT   gene            complement(282569..282644)
FT                   /locus_tag="Caur_R0003"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(282569..282644)
FT                   /locus_tag="Caur_R0003"
FT                   /product="tRNA-Arg"
FT   gene            complement(282707..283801)
FT                   /locus_tag="Caur_0222"
FT   CDS_pept        complement(282707..283801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0222"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rba:RB5051 conserved hypothetical
FT                   protein-putative thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33475"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC82"
FT                   /protein_id="ABY33475.1"
FT                   /translation="MHYEELPLTAEHDVAIVGAGPIGLEVAVCLKQAGVDYIQFDAHQI
FT                   GYTMTWWPRNTSFFSTTERLAIAGVPIQNNHQQRITGEEYLAYLRSVVELFDLHIQSYE
FT                   PVSDLIPDHEGFTLITRPHSGERRYRARRVVLAIGDMHYPHRLNIPGEDLPHVSHYFRD
FT                   PHDYFRRRLLIVGGKNSAVEAALRCWRAGAQVTLAYRRSQLDAQRVKHWLLPDFLAQVE
FT                   AGTIRFLARTTPVAIDSGGVVLAHTDEDGQPTTDHFYHPTDFVLLATGFRGDQRLLEQA
FT                   GVVLQGPNRVPLYNPATMETNVPGLYLAGTVAAGIQQRYTLFIENSHEHAGKITQALTG
FT                   RWPSRLGDVATRNYQLSFEQIAAN"
FT   gene            284138..284686
FT                   /locus_tag="Caur_0223"
FT   CDS_pept        284138..284686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33476"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC83"
FT                   /protein_id="ABY33476.1"
FT                   /translation="MMLTTADIPQADVLWDVARVAEAIARGRMTAEEIGAYLGAKGQRQ
FT                   GLYYMQAARIIGLIEISEQTETAQLTKFGLAFTRYNRADQRSALRRQLLRYEPTRSVIA
FT                   ALRNAPEGLSRNDVARILQQLAPLAESTAQRRASTVTAWLTEIGLADWRDDRLYYCGPS
FT                   LPLPLPATPHNSASFAPGV"
FT   gene            complement(286667..287926)
FT                   /locus_tag="Caur_0224"
FT   CDS_pept        complement(286667..287926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0224"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rrs:RoseRS_2506 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33477"
FT                   /db_xref="GOA:A9WC84"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC84"
FT                   /protein_id="ABY33477.1"
FT                   /translation="MTSSSEAVLARYARRNFWLNVLDGSAFTFGISLVSRFTVLPLIVE
FT                   RLTDARWVQGLIPAIFFAGWLLPGLFTAPLVAAQPRRKPWVLIATIGERLPFLALGIIL
FT                   LTMPDLPASVLLVIVLSLYAIFATSAGLTSIAWQDLIARIIPAQRWGVFFGLQAGLGGL
FT                   FGIGGGALAAAILAQQPFPQSAGILALICFAAMVVSYVFLALTVEPAQAPIPTRPFHVF
FT                   LRGLGPLLRRDVAFRRYLFCRAAIAFGLTGHSFLTAAALERFHVPAADIGLFTGVMMAA
FT                   QAVGNIGLGALADRWGHKQVLVLSAGMGMAALVLALLAPVSTWFFIIFALVGAAQAGYQ
FT                   LSGFTLVFAFSPPAERTTYIGVANLALAPVAAAGPVLVGVLATFTGYGMIFVLLAIVGL
FT                   IGMAMLHWQVAAPVRAEQVA"
FT   gene            288301..289482
FT                   /locus_tag="Caur_0225"
FT   CDS_pept        288301..289482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0225"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; SMART:
FT                   Rhodanese domain protein; KEGG: rca:Rcas_1187
FT                   beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33478"
FT                   /db_xref="GOA:A9WC85"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC85"
FT                   /protein_id="ABY33478.1"
FT                   /translation="MTFTPEQSTVTEISPRDLYARLLSAQPLFILDVRNEEEFKRMPVE
FT                   GHATLRTLNLPYFDFIEDEEAALARLPKDVEEFIVICAKGGASQYVAEVLNNHGYRAVS
FT                   LSEGMIGWGNYYDVRDVVKADWGRIVQIARPARGDLSFAVISDGQAALVDPLRHIQVYR
FT                   ELIENAGARLTAILDTHVHADHISGGPALSKETGAPYYIHPYDAIHPIDMLPAVIAYEP
FT                   LRDGQTFQIGQVRITTIWYPGHTLGQVNFLAETPDGGRYLFTGDGIFLRSFGRPDLGGK
FT                   GEAWTPILYRSMFEWLPRHLTDDTVILPAHFSTLDEDAGNGIFAAPFAQVRAQNDSLQP
FT                   RSLEEFTSYVLSHLPVFPPEYVEIKRVNIGLVEACEGKASELELGKNICALAG"
FT   gene            289565..289813
FT                   /locus_tag="Caur_0226"
FT   CDS_pept        289565..289813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0226"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: rrs:RoseRS_0815
FT                   SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33479"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC86"
FT                   /protein_id="ABY33479.1"
FT                   /translation="MPHFDQTLDVKGAKCPMPLVKSRKAITELPVGQVLQVISTDRGSV
FT                   ADFQGWAKTAKNVELIAQETVQENGQELYVHYLRRTA"
FT   gene            289865..290440
FT                   /locus_tag="Caur_0227"
FT   CDS_pept        289865..290440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33480"
FT                   /db_xref="GOA:A9WC87"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC87"
FT                   /protein_id="ABY33480.1"
FT                   /translation="MTTPMTETVDTQALLSRIAELEQRVAALEQSPAQSIEDRLAMVVF
FT                   SGDLDKAIAAFIIATGAASMGLEVSMFFTFWGISAVKKQKVFSGKNLLEQGFTAMLPGK
FT                   LGELGLSQMNFFGAGAQIIRNLMKQHDVASPEELFAMARELGVRMVVCDMSRELLGIKD
FT                   EELVDGLETGGVATFLGDAARAKVTLFI"
FT   gene            290538..290900
FT                   /locus_tag="Caur_0228"
FT   CDS_pept        290538..290900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0228"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   rrs:RoseRS_2962 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33481"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC88"
FT                   /protein_id="ABY33481.1"
FT                   /translation="MFRQLFRRDVVQNHIATMTVQELKTQLDARAPMVLIDVRQPEEFA
FT                   YDGHVSGARLLPLPVLASRLNELPKDQPIVCICRSGNRSQVACEMLQRHGFTNVTNVVG
FT                   GMVAWQRAGYPVSRQH"
FT   gene            290928..291437
FT                   /locus_tag="Caur_0229"
FT   CDS_pept        290928..291437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0229"
FT                   /product="protein of unknown function DUF442"
FT                   /note="PFAM: protein of unknown function DUF442; KEGG:
FT                   rrs:RoseRS_0813 protein of unknown function DUF442"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33482"
FT                   /db_xref="GOA:A9WC89"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC89"
FT                   /protein_id="ABY33482.1"
FT                   /translation="MDTTMQHQAICNTLQHQTEVAPLRSYVVTENVLLAAQPQPEDWQR
FT                   FVEAGYQTVLNIRSDPERAAQQAANARAAGLRYIHAPWPAYELEPEHLAEFARIVEDPA
FT                   TGKLVFHCRSATRVGLIWMLYRMVHQGWSREQAEAELRAAGYDDDAIETFDFCAGDFFE
FT                   RVGSQA"
FT   gene            291449..293215
FT                   /locus_tag="Caur_0230"
FT   CDS_pept        291449..293215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0230"
FT                   /product="sulfate transporter"
FT                   /note="TIGRFAM: sulfate transporter; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS;
FT                   Xanthine/uracil/vitamin C permease; sulphate transporter;
FT                   KEGG: rrs:RoseRS_0812 sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33483"
FT                   /db_xref="GOA:A9WC90"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC90"
FT                   /protein_id="ABY33483.1"
FT                   /translation="MTPVSAHRPDVQAALLAMIYRYLPFLNWLRHYRREHLPSDVVAGI
FT                   VTAIMLIPQSMAYAQLAGLPPQIGLYASVAPLIVYALLGTSGQLSVGPVAITSLLVFSG
FT                   VSSLAEPGSARYIQLVLLLAFMVGAIKLTFGVLRLGAILNFISHPVLTAFTSASALIIA
FT                   VGQLKYILGYRIGGEHIHETIGQAIAGLSQTNLVTLTIGLVSIGLLVFFRQGLRPLLRR
FT                   TGLPPLAITLIVSGAPLLTVILGILVAQTLFLDQTAGIAVVGAIPAGLSPISVPAFSMA
FT                   DAQALLPTALTIVLVSVVESIAVAKALASKRRQAIDPDQELVALGAANITASFFSGYPV
FT                   TGGFARSVVNAQAGAITGLASLITALGIAVILLFFTPVFYYLPQAVLAATVIVAVIGLV
FT                   DLREPRRIWRTNRGDAFTWLITFLAVLTLGIETGIFVGVASALILYLWRTSRPHIAIVG
FT                   RLGDSEVYRNVERYQVKTWPHVVAVRVDESLYFANTRYLESALLQIVAERPSVKHLVLI
FT                   GSAINFIDSSALHTLEHLIDELRDAGVEFHLADIKGPVMDRLKQSELIDKIGHDHIHLT
FT                   THTAMLALGCQD"
FT   gene            293305..293715
FT                   /locus_tag="Caur_0231"
FT   CDS_pept        293305..293715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0231"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   rrs:RoseRS_2962 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33484"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC91"
FT                   /protein_id="ABY33484.1"
FT                   /translation="MKYRFLLLLMIGLALLTACGTTTASTSTTSTPANITVARLKSMLD
FT                   QNETFFLLDVRTPAEFVQDGRIAQATLIPLQELEQRLSELPTDKTIVCICRSGNRSSVA
FT                   CNLLKERGYQAINVTGGMNEWKAAGYPTVFGQ"
FT   sig_peptide     293305..293379
FT                   /locus_tag="Caur_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.835 at
FT                   residue 25"
FT   gene            complement(294090..294485)
FT                   /locus_tag="Caur_0232"
FT   CDS_pept        complement(294090..294485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0232"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   rca:Rcas_0984 protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33485"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC92"
FT                   /protein_id="ABY33485.1"
FT                   /translation="MKIARHWRDRVPRYRLEGQRHRYTGEIRFPPHPPALDEDPNDWEP
FT                   YQLSGRGEIYSFSVLRQAPEGFASFGVYPVALVRLEEGPLVTAQLTDCDEADLAIGMPV
FT                   EMVTRRLMDSGEDGVLVYGYKFRPRLV"
FT   gene            complement(294482..295108)
FT                   /locus_tag="Caur_0233"
FT   CDS_pept        complement(294482..295108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33486"
FT                   /db_xref="GOA:A9WC93"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC93"
FT                   /protein_id="ABY33486.1"
FT                   /translation="MIQEMVNGSIAVLTRPSVQSFEQHERDNLVWALIYAVIASVINGI
FT                   LAAITAPLRVGELRAQLETQGVPPDAIEAAIAQQGNPIIAIFAGIFGTIIGSLIIWGFI
FT                   YLLGRAFGGTGSFGELAWGLSLFSSPLAVAQSIVSVIPLVGDILLLGLSIYGVYLTYLA
FT                   IQSGMNLPSQKALYIAIILLVITLLFLCVTVGLAAIVGLIGGLAP"
FT   gene            complement(295186..296352)
FT                   /locus_tag="Caur_0234"
FT   CDS_pept        complement(295186..296352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0234"
FT                   /product="acetyl-CoA acetyltransferase-like protein"
FT                   /note="KEGG: rca:Rcas_0983 acetyl-CoA
FT                   acetyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33487"
FT                   /db_xref="GOA:A9WC94"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC94"
FT                   /protein_id="ABY33487.1"
FT                   /translation="MTNVYIAGIGATAVGEHYRRGLADLVSEAARAALASAPEIAPHQI
FT                   GALYVGSAFSEELYGQSQAGAYLASILGLSPSIPAYRVEAAGASGALALYQAVQAVQNG
FT                   VAVALVIGVDKVTDHLEDEIEAAQAMAADSTEEALHGVTLTAQWAMLMRRYMHEYGYTA
FT                   DAFAPFPINAHANGVHNPLALYRFAIDANKYRKAAQIASPLNMLDCSTLADGAAALIVV
FT                   GEQIARELDRPRIRIAGSAVATDHPALHRRRNPLDLSAARASAHIALGRAHLGVGDVQV
FT                   WELTDPHGIAATLALEAIGCYEPGTAPRYAAEGAITPTGKTPIATFGGYKARGDVGGAS
FT                   GVYQVIELTRQLSGQAGPTQVSNARIGLSQSLGGIGATAVSHVLIRES"
FT   gene            complement(296371..297420)
FT                   /locus_tag="Caur_0235"
FT   CDS_pept        complement(296371..297420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0235"
FT                   /product="hydroxymethylglutaryl-CoA synthase"
FT                   /note="TIGRFAM: hydroxymethylglutaryl-CoA synthase; PFAM:
FT                   Hydroxymethylglutaryl-coenzyme A synthase domain;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; KEGG: rca:Rcas_0982 putative
FT                   hydroxymethylglutaryl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33488"
FT                   /db_xref="GOA:A9WC95"
FT                   /db_xref="InterPro:IPR004656"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC95"
FT                   /protein_id="ABY33488.1"
FT                   /translation="MMKPQHPVGIVGYGAYIPRYRIAAREIARVWTDGQSGTPIEAKSV
FT                   PGPDEDTITMSIEAARNALARAAIPATALGAVWIGSESHPYSVKPSGTVVADALGAGPW
FT                   VSAADWEFACKAGSEALTAAMALVGSGMQRYALAVGADTAQGRPGDALEYTASAGAAAL
FT                   IVGPASEALATIDATLSYVTDTPDFYRRADRPYPVHGNRFTGEPAYFHQIQSAATELLR
FT                   HLNRTAADFTYAVFHQPNAKFPQAVAKRLGFTDKQIAPGLLSPQIGNTYSGAALLGLCA
FT                   ILDVAQPGETIFMTTYGSGAGSDAYALTVTEAVLERRERAPLVAAYLQRAVMIDYAIYA
FT                   KWRGKLVMG"
FT   gene            complement(297617..298936)
FT                   /locus_tag="Caur_0236"
FT   CDS_pept        complement(297617..298936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0236"
FT                   /product="hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /EC_number="1.1.1.88"
FT                   /note="TIGRFAM: hydroxymethylglutaryl-CoA reductase,
FT                   degradative; KEGG: rca:Rcas_0981 hydroxymethylglutaryl-CoA
FT                   reductase, degradative"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33489"
FT                   /db_xref="GOA:A9WC96"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC96"
FT                   /protein_id="ABY33489.1"
FT                   /translation="MGTKSSRLQGFYQLNPFERLQMVKSFDGLVDEDLRALHGGHGGAL
FT                   TIERADKMIENVIGTYNLPLGIATNFRINGRDYLIPMVVEEPSIVAGASYAARMVRDGG
FT                   GFETSSTEPLMIGQVQLVNVRDPDQARQTILSRKEEILALANAQSRSLVSLGGGARDVE
FT                   VRFFPTSPMGPMLVVHLIIDCRDAMGANAVNTMAEAVAPLLAEMTGGKVYLRILSNLTD
FT                   RRLARARCVVPAASLARDGLSGEEVVEGILWAYAFAAVDPYRAATHNKGIMNGIDPVLV
FT                   ATGNDWRAVEAGAHAYASRNGHYTSLSHWERDAQGDLVGTLEMPLAVGIVGGATKVHPT
FT                   AQAALKLLGVRSAAELAEVCVAAGLANNLAAMRALACEGIQQGHMSLHARQIAMAAGAS
FT                   GTLVDEVARRMVAERNIKLARAEEIIAELEGRTIGNPTHN"
FT   gene            299078..299800
FT                   /locus_tag="Caur_0237"
FT   CDS_pept        299078..299800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33490"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC97"
FT                   /protein_id="ABY33490.1"
FT                   /translation="MLTYGTIEYVIYKRLFAFIISLFYLSACATTPLPPLLSDLLTRSP
FT                   SGTQEMIAFLYYDEQGARLVSSLSVSADRPLPLDPPERQVWIGGLDPPADIPLTNEAGV
FT                   QYGLVIAQGNWQSAGNYGPGGQWPYTLVTPSFQSITPDRVELAQLFNDNRYEGRLVQMR
FT                   AALLLADGTSLLVDSIGAGGIPAAGARQVKLLHGESDQAALSQLQARGNVRYGYVDVIG
FT                   VWRQGRLEPLLIRPLPSE"
FT   gene            complement(299778..301706)
FT                   /locus_tag="Caur_0238"
FT   CDS_pept        complement(299778..301706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0238"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: sfu:Sfum_1007 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33491"
FT                   /db_xref="GOA:A9WC98"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC98"
FT                   /protein_id="ABY33491.1"
FT                   /translation="MPDDTILLLLANAANRELLRDWLGHHYQTIIADSEADLQRSFQLC
FT                   IVDGPALATFEAAIQARRAAAYPIFLPFLLVTTRGDVKYHTHHLWQTVDELVISPIQKV
FT                   ELQARIEILLRARRLALEVSRLQQAMLSSTQTWLQLAVQSAQIGLWEWDLQTNRVFFSP
FT                   EWKAQIGYAADELVDSLTVWEELIHPDDRERCLNLLYRYLHRPWPDFALEFRLRHKNGS
FT                   YRWIRSQAALIYDQHGRPTHMLGAHFDLTERKQMEEEQQQLAEQLFQSQKLEAIGALTS
FT                   GIAHDLNNLLVPIIGFAEMGMLEVTPDNPLYSDFDQIRAAGIRATALTRRILTFSRQQR
FT                   MEMKPIHISRVISDFVAILRRIIGERIDIQLQLASDLPPVQADVSQIEQILLNLVINAR
FT                   DAIEGNGTITITTAFVSPEDTDFPWPADVPPGDYIALQISDTGCGIDSAIRSRIFEPFF
FT                   TTKPSGKGTGLGLATVAAIVKQHHGYIDVQSLPGQGATFTVYLPALKDGAAVSEDVAFS
FT                   KDQLFGHETVLVVEDEPAVLHLIASALRLHGYQVIEATDAQYGLGLAASHQGTIDLLIT
FT                   DVMLPTLNGDELYRQLRGLYPQARVLYISAYVDSEHVGPDVTPILAKPFTLQRLLQQVR
FT                   AILTAAV"
FT   gene            complement(301866..303314)
FT                   /locus_tag="Caur_0239"
FT   CDS_pept        complement(301866..303314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0239"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: rca:Rcas_0671 putative circadian clock
FT                   protein, KaiC; PFAM: Circadian clock protein KaiC central
FT                   region; KaiA binding; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33492"
FT                   /db_xref="GOA:A9WC99"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:A9WC99"
FT                   /protein_id="ABY33492.1"
FT                   /translation="MEQAATQRLATGIPGLDEICGGGLVPRYAYLVRGGPGTGKTTLGL
FT                   HFLAAGAANGETTLFISLEETESKIRWNAAQTGINLNQVHILDLSPSSDFFANTQIYDI
FT                   FSPAEVEREPITRQIVETVQRLQPTRVFLDSITQFRYLTPDTFQFRKQVISFLRFLAEQ
FT                   RTTVVFSAENSAAFPDDDLQYIADGIISLELTNTGRYLTVSKMRGSSFVSGRHAMRLTT
FT                   QGLQVFPRIIPTPLVAGHAFTLIPSGVPELDELLNGGVERGTITLITGPSGVGKTTLGF
FT                   QFMKEAASRGERSMVFSFEEEIEIMQQRCEAVNIPVRAMQKQQLLRIEKIEPLQYNPAE
FT                   FAQHVRYFIEQEQIKVVMIDSVTGYRLCMHGEDLISQLHALSKYLQSRGVTVFLIMDTT
FT                   DIVGDFKVTEIGASYLGDNIIFLRFLEIEGELRKAIGVLKKRLGDFEKTLREFAISRYG
FT                   IKVGKPLTNLRGILSGMPTWVDKA"
FT   gene            303685..304764
FT                   /locus_tag="Caur_0240"
FT   CDS_pept        303685..304764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0240"
FT                   /product="peptidase M24"
FT                   /note="PFAM: creatinase; peptidase M24; KEGG: sth:STH1865
FT                   Xaa-Pro dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33493"
FT                   /db_xref="GOA:A9WCA0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCA0"
FT                   /protein_id="ABY33493.1"
FT                   /translation="MTNRLQQLRATLAARELPAMLLTAPTSRRYISGFTGSAGALLISA
FT                   EAAFLLTDGRYLIRAAAEAPHFTLREVRPPARPMTALIADLASELGIKRLGFEAAVMTV
FT                   AEHRQYTAALGNAIELVPTENIVEELRMVKDEEEIALLRRAAAITDAALAAVLPALTPT
FT                   MTEREAAWRLEVALHDLGAEGPSFPIIVAAGRNSARPHHTPGDDVLGEGQPIIIDMGAR
FT                   LDGYHADLTRTIVLGQPDDTFRAVYAATLKAQQAAMQALRPGLPWSEADAIARRVIGEA
FT                   GYAEGIAHSLGHGVGLVIHEAPWLRITAPDAPPSPPLQAGMVTSIEPGIYLPEWGGVRI
FT                   EDLVLITTNGYEVLSQAPK"
FT   gene            305149..307278
FT                   /locus_tag="Caur_0241"
FT   CDS_pept        305149..307278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0241"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: rca:Rcas_0877 DNA ligase, NAD-dependent;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM:
FT                   helix-hairpin-helix motif; BRCT domain protein; zinc-finger
FT                   NAD-dependent DNA ligase C4-type; NAD-dependent DNA ligase
FT                   OB-fold; NAD-dependent DNA ligase adenylation; SMART:
FT                   Helix-hairpin-helix DNA-binding class 1; NAD-dependent DNA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33494"
FT                   /db_xref="GOA:A9WCA1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WCA1"
FT                   /protein_id="ABY33494.1"
FT                   /translation="MSHTTVADRINELRSLIRRYDYHYYVLDDPIVSDAEYDALMTELR
FT                   ALEAAHPELITPDSPTQRVSGTPASQFAKVQHPQPMLSLGNAFTKADLLAWRDRVLRLL
FT                   GPDAIVAYVVEPKIDGLAVALTYRDGRLVQGATRGDGEVGEDVTANLRTIGSIPLTLQA
FT                   TSTPQDDDLPTTLPTTIEVRGEVYMRTADFETLNDRLAAAGEKIFANPRNAAAGSLRQK
FT                   DPTITAARPLRFFAYGVGVVEGISLSSQWQTLRYLRALGFPVNQDVRRFTDFAEVLAYC
FT                   EAWMAKRDDLPYEADGVVIKIDDFAQQRELGVVGRDPRWAIAFKFPAREAITRLLDITV
FT                   NVGRTGVVTPNAELEPVQIGGVTVRNASLHNADYIAQRDIRIGDYVIVKRAGDVIPYVV
FT                   GPVIARRDGSERPWQFPTHCPACGSPLEREEGEAAWRCNNFSICPAQLVRRVEHFVSRS
FT                   ALDIVGMGERQAELFVQRGLIRDVADIFFLKADQLAELEGFGPKRIANLLAAIDAARQR
FT                   PLDRLLVGLGIRYVGTVAAQTLVAALGSLDAIMAARQEELEQIPGIGPVVAASIVDFFS
FT                   RPANRALIEKLRAAGVQMGGVSGPTRQSDTLAGKTFVLTGTLPSLSREQASALIVAHGG
FT                   KVTDSVSKKTSYVVAGANAGSKLAKALQLGIPVIDEAGLLALIGTTAEPPPSPPPPPPE
FT                   TNTDGNQLLLPLDGE"
FT   gene            complement(308385..309560)
FT                   /locus_tag="Caur_0242"
FT   CDS_pept        complement(308385..309560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33495"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="PDB:3CMN"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCA2"
FT                   /protein_id="ABY33495.1"
FT                   /translation="MAGNQNDLRRFGTALLLGVAAGFAARYYLETRARNSTRPASGLID
FT                   WEQARQAALRLSQWEQAPVDNRAFRREQYARMVALSEPLIADYLGVRLPEPVSRIFVFD
FT                   RREWLEANIVSFSQLFRPIEEMYEKNGGGRGALGVLMNDVSSKLLGVQIGGLLGYLAQR
FT                   VLGQYDLSLLSAEATGGSLYFVEPNIARVQQQLGLSDEDFRLWITLHEMTHAFEFEAYP
FT                   WVRTYFRELLEQNFALVSGQMLSSGNSLVDMLMRLLQGIGSGQHWIETVLTPEQRAVFD
FT                   RIQALMSLIEGYGNHVMNAVGRRLLPSFNQIEQQIAQRQRQRTMLDQMVFRLTGLDLKL
FT                   AQYQQGEAFVNAVVAARGIQFASRVWERPENLPSMDEIRNPGQWIVRMDRQ"
FT   gene            complement(309663..311531)
FT                   /locus_tag="Caur_0243"
FT   CDS_pept        complement(309663..311531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0243"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: mta:Moth_2503 selenocysteine-specific
FT                   translation elongation factor; TIGRFAM:
FT                   selenocysteine-specific translation elongation factor;
FT                   small GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   Elongation factor SelB winged helix 2; Elongation factor
FT                   SelB winged helix 3"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33496"
FT                   /db_xref="GOA:A9WCA3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCA3"
FT                   /protein_id="ABY33496.1"
FT                   /translation="MQEFLAMFVIGTAGHVDHGKSTLVKALTGIDPDRLREEQQREMTI
FT                   DLGFAWLTLPGGREVSLIDVPGHERFIKNMLAGVGGIDAVLLVIAADEAVMPQTREHLA
FT                   IIDLLAIRHGIVVLSKVDLVDADWLELVREEVREALAGSTLASAPIVPVSARTGAGLAE
FT                   LLLTLDRLLDTLPARDQVRGVPRLAIDRSFTITGFGTVVTGTLRDGVLSVGQEVELLPP
FT                   GLRARIRGLQSHQRPIDQGKPGMRVAVNLAGVHHRDIRRGHVLTLPGALTPTTLLDARV
FT                   RVVSDVAPIAHNAALDLFIGSSEAPCRLTLLDTDELSAGTEGWVQIRLTVPVVAAVGDR
FT                   FILRTPSPSRTVAGGVVIDPHPPRHRRFRSEVIAALTLRSQGSPAERLRQTLADGRPRL
FT                   RTESLAAAGITDTEAEAVLVALVTEGHLVVLGDDVLISSAGWASLRATLRDLLASYHQR
FT                   FPLRRGMSREEVRQRLQLTPRLWQSVLATTMAEGWLSADETTVRLTNFTPQPTADQQRA
FT                   LNRYISALAHMPPAPPPAELDSELLAWACDNGLLVKIASDLYLLPATCTAMTMWVRTTV
FT                   ETQGGVTVAAFRDHFGVSRRYAVAFLEYLDEQRITRRVGDTRILVR"
FT   gene            311572..312168
FT                   /locus_tag="Caur_0244"
FT   CDS_pept        311572..312168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0244"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /EC_number="3.2.2.21"
FT                   /note="PFAM: HhH-GPD family protein; KEGG: sus:Acid_6307
FT                   DNA-3-methyladenine glycosylase II"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33497"
FT                   /db_xref="GOA:A9WCA4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCA4"
FT                   /protein_id="ABY33497.1"
FT                   /translation="MEHALQHLRNVDPTLGHWIEQIGPYTLQRQPHGFATLAYAIISQQ
FT                   LSLVAARTIRDRLNERLGSLAPETIIAADETVLRAAGLSAQKSSYLRDLAERVMSGQLD
FT                   LNLLPTLDDETAITHLMTVKGIGRWTAEIYLMFALERLDVLPAADLGLRDAVRLIYDQP
FT                   RLPKPQELRTFGERWRPYRSIACWYLWQARRIMIS"
FT   gene            312240..312992
FT                   /locus_tag="Caur_0245"
FT   CDS_pept        312240..312992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0245"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: rrs:RoseRS_2001 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33498"
FT                   /db_xref="GOA:A9WCA5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCA5"
FT                   /protein_id="ABY33498.1"
FT                   /translation="MMRIDGRSPDQLRPISIEIGAAPYAEGSALIAYGKTRVLCTATVE
FT                   DGVPAWMRGQQSGWVTAEYAMLPRATLQRTRRERNGPSGRTQEIQRLIGRSLRAAIDLN
FT                   ALGERTITIDCDVLQADGGTRTAAISGGYVALALAVDYLVRSGVLETRPTLTPVAAVSV
FT                   GMLQGVLLLDLCYEEDSQADLDCNVVMNSAGGYIEVQATAERSAVTRDQLNALLDLAGR
FT                   GIQQILDAQAAALATALPNNAMSQVQSP"
FT   gene            313069..314322
FT                   /locus_tag="Caur_0246"
FT   CDS_pept        313069..314322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0246"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   rrs:RoseRS_1999 tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33499"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCA6"
FT                   /protein_id="ABY33499.1"
FT                   /translation="MTDETRRVAGRRHLRYGLAFERTQHPEAAVDQFRRAIAADPTLRD
FT                   AHNALAFHYQQQGLLAKAADAFAAVASLADDYFAHFNLGFVLIELERYDEAEREFRRCL
FT                   ELDPGDVAAQLELAYIYAARGDYETALNFLTIPRQHYYDDWGVFHLLGRCLFHMQRFDE
FT                   ARQAWQQSLALAPTPETQLELLSCLQSIERRREFHATISHKDELYIHEGVICLGSAMDD
FT                   GFTIRPLSNYRFSELDVARTIQRFLALARSSEWRFGGVTTPELMSKPLALTLAQLLNLP
FT                   LLSLHHLPQLSEPILIVMAVGHSADLLTIARERLPVPGPGFCLAVNWTRQSKLLPEIIG
FT                   VIVEGQCTVPWEEELQSLDTAGQTDHIKHIAGRLIQMVQTLPGEDNLPRQIRYYTRHHR
FT                   RLAINALLHTSPPDHPAE"
FT   gene            314703..315731
FT                   /locus_tag="Caur_0247"
FT   CDS_pept        314703..315731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0247"
FT                   /product="UV damage repair endonuclease-like protein"
FT                   /note="KEGG: rca:Rcas_2319 UV damage repair
FT                   endonuclease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33500"
FT                   /db_xref="GOA:A9WCA7"
FT                   /db_xref="InterPro:IPR004601"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCA7"
FT                   /protein_id="ABY33500.1"
FT                   /translation="MKAIDHPIPGTSHDLAPLYQRASRQSKHAAIRSSGQQYDTTHPGI
FT                   RLGFAVRTVSQPGLISGSPPHLSILLTHLGDALRYLERTNIRFYRFALPRHFNLSDLAE
FT                   CQTQLALLNQHISTRNLRLGVHLDPHLSLSHSDEQVADATIRTIEATCQLLAALDHAQT
FT                   INHTLVIHPGAADPAAQQRFIQRWVKLSIQARRRTTIEHTGAGFSLGQLLVLAARTGIP
FT                   IVFDYLHYRLHNPERLSLALALGLTLATWPHQIRPEVHLSSQRSEAHLLPGRNGTTRVI
FT                   PPRAGQHADFVVAHDAIALLEAGRGLPPFDLMIEAKAGDLALLRLRQELAHYAPEWAAR
FT                   LA"
FT   gene            316267..317016
FT                   /locus_tag="Caur_0248"
FT   CDS_pept        316267..317016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0248"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: rrs:RoseRS_2438 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33501"
FT                   /db_xref="GOA:A9WCA8"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCA8"
FT                   /protein_id="ABY33501.1"
FT                   /translation="MSNERPSTTSNPLAGLVAIAILLIVLGFVAGLLISRSGTPIVVPT
FT                   AAPAPTNPPAPTEPASVPTPITGSMPILPTATTYQYSSPPPMSIDPAKKYTATIYTPRG
FT                   EIVIELLPDIAPQTVNNFVFLARQNFYNGLTWHRVLPNFMAQGGDPRGDGTGGPGYTIP
FT                   AEFTDKILFDQPGIVAMARSSDPNSAGSQFFITTAPAPRLNEQYTIFGRVIQGQEIVDG
FT                   IPLRDPSNPADLATPGEMILGIAINEE"
FT   sig_peptide     316267..316380
FT                   /locus_tag="Caur_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.759) with cleavage site probability 0.315 at
FT                   residue 38"
FT   gene            317293..319125
FT                   /locus_tag="Caur_0249"
FT   CDS_pept        317293..319125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0249"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: rca:Rcas_2308 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33502"
FT                   /db_xref="GOA:A9WCA9"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCA9"
FT                   /protein_id="ABY33502.1"
FT                   /translation="MQSPEPVVNEFAITAATVNGSGSQTANMVLMRAIFKMGIPVSGKN
FT                   LFPSNIQGEPTWYTLRVSQAGYTARPAETPILVAFNPRTANDDLSQLPPGGICLYPADG
FT                   PWQPSRTDIIPFAIPVRQLLDQVGVNQRLRTYAANMTYVGALAALLGIEDAALVAALKQ
FT                   QFRGRLSAIELNLAVIRAAYAWAAAEPSPAHGRFRIARMQATDGMMLIDGNTAAAIGAI
FT                   TGGVGVVAWYPITPSSSLIESLESYLPRLRPPTDGATCAIVQAEDEIAALGIVIGAGWA
FT                   GARAMTATSGPGISLMSEFAGLGFFAEIPAVIWDVQRVGPSTGLPTRTAQGDLMAVYYL
FT                   SHGDTRHVILLPGTMEECFSDAQTAFDLAEQLQTPVFVLSDLDLGMNIWMSKPFTYPEQ
FT                   PLQRGKVLSAEELSRLTNYARFADVDGDGIGYRTLPGNPHPLAATLSRGTGHNERNVYS
FT                   ERPEDWQRNMARLWRKHETARRLVPRPVIDDHPEATIGLIGFGSTAPAISEARDLLAAA
FT                   GIPTSSMRVRALPFGPEVTNFIARHQICVVIEQNHDGQLRQLLQLHCPAYASRLGSVAW
FT                   CDGLPLTAPFVRDQVLHCLESMRETMMIGIGTGN"
FT   gene            319155..320180
FT                   /locus_tag="Caur_0250"
FT   CDS_pept        319155..320180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0250"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: rca:Rcas_2309 thiamine pyrophosphate
FT                   protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33503"
FT                   /db_xref="GOA:A9WCB0"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCB0"
FT                   /protein_id="ABY33503.1"
FT                   /translation="MTQVNAIGLSKADYRGAPSTLCAGCGHDSVASQIIAAAFELSLQP
FT                   HTVIRMSGIGCSSKSAAYFLGRSHGFNSLHGRMPSVTTGAHLANHTLRPLAVSGDGDTA
FT                   SIGLGQFIHLLRRNVPIVYIVENNGVYGLTKGQFSATADEGQELKHAGVNHLPPIDVCA
FT                   EAILAGCGFVARSFAGDARQVRELIKAAFNVHGSAVIDVISPCVTFNNHDRSTKSYTYG
FT                   KTHETPIHDISFIPHYDEVTVDYEPGEVRDVQLHDGPVIRLRKLNRDHDPTDRSAALAL
FT                   LEQARANNEFVTGLIYLNERRPTLAETLGIGSTPIAALPEDRLRPSREAFAAVMAELVD
FT                   G"
FT   gene            complement(320681..322705)
FT                   /locus_tag="Caur_0251"
FT   CDS_pept        complement(320681..322705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33504"
FT                   /db_xref="InterPro:IPR006230"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCT5"
FT                   /protein_id="ABY33504.1"
FT                   /translation="MELVRAILAVEIGSLITRVSLIDEVDGESRLIGQTETLTSRELPY
FT                   RNVFFAVQEATAQLADLTGRQLLRDGRLLMPRISTGDGIDAVIVVTSALEPLRVVVAAI
FT                   ASDVSARSALHAVRGVPSVVLAVVTLDDVSARSTTGVMQSWLERQLETLLPLLPDVVVL
FT                   AGGVEGGTVEAMKRLAHLINLKLSFTAAIRQPLPTIIYAGNTSVQPQIQAALGGHNCEL
FT                   ITVANVRPALDQEVLTPLRQALLACYARQLTDVPGIDQLSAPDQTTLRTVAESQYVMTR
FT                   FLAERQQQAVLYVDVGATTTTLIAAAPDQIAATLHGVCGTAFGVGALLSEVGPAAIARW
FT                   LPFAIEEQELIERLLNRMLRPQTLPATREDCYLDLALAREALALGVAALRDEQTPLAYE
FT                   RLLAGGGVLTHAPHPGMALLALLDGLQPANELPGLLLPIHLDMLSLLSVCGGIAALSTD
FT                   AAISIFDHDLLNNTPLATCIVLQGGSRIGEPVADVELITVGGDSERVQVRHGELIRLPL
FT                   SVGRYAQVKVKPAATVRVGQAAPGEAVESDPAEVHGSLLGLIIDARGRPLTLPADGAER
FT                   RRLLWSWLRAVGAEHSDSPYPEPVISLPEMPAPVVAAPSTAPKPRRSWFKRAPQPAKTS
FT                   EATLPTTETVPASPDDDIAQLRQQVSKPARRSWFGRRKP"
FT   gene            complement(322747..323394)
FT                   /locus_tag="Caur_0252"
FT   CDS_pept        complement(322747..323394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33505"
FT                   /db_xref="GOA:A9WCT6"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCT6"
FT                   /protein_id="ABY33505.1"
FT                   /translation="MDIAINLIPILLTLLVFSRVLGDTPAFRLVQYLFVGVALGYAFVV
FT                   IYHQVLRPAVIDVLAAGDQPVLLTLRLTPFFLAALLLTRISGQQTSSWLANLPLALVFG
FT                   VGAALVVGGAVVGTILPQVLDATRSDLSSPVAILGSIVLLIGSIATLLSFSLTRSSNPN
FT                   RQRWIDLVASVGRWILLLAFGFFLAGSIVSYLAALNERLLFIIDWIRAIAGM"
FT   sig_peptide     complement(323326..323394)
FT                   /locus_tag="Caur_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.737) with cleavage site probability 0.730 at
FT                   residue 23"
FT   gene            complement(323394..327809)
FT                   /locus_tag="Caur_0253"
FT   CDS_pept        complement(323394..327809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2219 putative FHA domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33506"
FT                   /db_xref="GOA:A9WCT7"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCT7"
FT                   /protein_id="ABY33506.1"
FT                   /translation="MSMEHLPPWLRNVPLPPPPTDAADETPAWLRGIDSFTPPAPTPAT
FT                   DHPPAWLTEPEPASESAAESASVPDWLAELQAEVADPLADTGSAAEWLGGVEAEPPAER
FT                   PSTFGATGWLQGLGGETSTGPVTPSEPPPTTSSRLRMPVGPTDWLRSMGHEDEVEPASA
FT                   EQSPEPAPPDPNAGVPDWLRELSEEDVSQALASLPPAETTPPVEAKEASEKTPTDWLDE
FT                   LARLASEDDWARAGAANAETVVATDSPDWLSSAQPPPVDPSAPALPAWLQDVAGDEPPA
FT                   APGSVRLDLPSWLLEDESSLSPTSPAIAPDAPTLLADSRAVVPGQEGVDLSAPSRLTPA
FT                   GSEPEASADIPTWLREAEVPAADEWPAAAASEAPAWLQEEGTPAERAGDIPTWLREAEA
FT                   PAADEWPAAAASEVPAWLQDEAAPAEREGDIPTWLREAEAPTADEWPAAASEAPAWLQD
FT                   EAAPAEREGDIPTWLREAEAPAADEWPAAASEAPAWLQDEAAPAEREGDIPAWLREAEA
FT                   PAADEWPAAAASEAPAWLQDEAAPAEREGDIPTWLREAEAPAADEWPAAAASEAPAWLQ
FT                   DEAAPAEREGDIPTWLREAEAPAADEWPAAASEAPAWLQEEGTPAERAGDIPTWLREAE
FT                   APAADEWPATAASEAPAWLQDEAAPAERAGDIPTWLREAEAPAADEWPAAASEAPAWLQ
FT                   EEAAPATGSDVPAWLREEAAPAEREGDIPTWLREAEAPAADEWPAAASEAPAWLQEEAA
FT                   PAAGSDVPAWLREEAAPAAGSDVPAWLREEAAPAAGSDVPAWLREEAAPAAGSDVPAWL
FT                   REEAAPAAGSDVPAWLQEEAAPAAGSDVPAWLREEAAPAAGSDVPAWLREEAAPAAGSD
FT                   VPAWLREEAAPAAGSDVPAWLREEAAPAAGSDVPAWLREEAAPAAGSDVPAWLREEAAP
FT                   AAGSDVPAWLREEAAPAAGSDVPAWLREEAAPAAGSDVPAWLREEAAPAAGSDVPAWLR
FT                   EEAAPAAGGDVPAWLREEAAPAAGSDVPVWLQEESAPAAGSDVPDWLQQASTAPVDTPD
FT                   WLTADVSAEAISWLQSAPAENAPIAEPSLTTSSTSDEFFSGAELPPWLRASTERAVEPA
FT                   ITPLSDWLERLRHREAEEEEEVVAGPDVVVVKPPPPAPAQRTDDQIAAAALLERLLQSP
FT                   LPAILPVERPVIVRRRLPTLEQWLAVVLLIAVLIGIAIPGLTATFTNRAQPSPVAVALN
FT                   EQLAGLSSEDVVLVAYEWGAQRVAELRPLEDVLLTRLTADRTKLIIVSTDLQGSLLAFD
FT                   VIGPLRSAGYNNENGVIFGGRDYVLLGYRPGGELALRSMAIDLRAELRRDYTGQDATAG
FT                   LLATRSDGTPRIQSLRDLAMIVVMADQVQDVQAWMEQIHSAAPQVPIAFLLPQEVYPQV
FT                   LPYTRLPNVYAVAGQRGASDLLAAGKADNLATPELSYQTWATIAFVGVLLLGAFIVGIG
FT                   QLRRLARGRG"
FT   gene            complement(327833..328501)
FT                   /locus_tag="Caur_0254"
FT   CDS_pept        complement(327833..328501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33507"
FT                   /db_xref="GOA:A9WCT8"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCT8"
FT                   /protein_id="ABY33507.1"
FT                   /translation="MSSPLRNPRQLITVLIAGVSGLIVLLDFVGAGPAVSTIAVVLVRW
FT                   AALITAIAVAIGVLSVFFVHLRRARSRSAEAGYSLVLLAGMIVVIVAGIFYPTRTATGL
FT                   SLPTTLADPPIRTVFRLIYEPLAASLLALLSFFALSAMLRAMRSGRIEAVFVVAVALIA
FT                   LIIQLPPLTLVPIIGQTVQWVNDYLVAAGARGLLLGSAIGALVAGVRLLIGFDMPYADR
FT                   "
FT   gene            complement(328506..329300)
FT                   /locus_tag="Caur_0255"
FT   CDS_pept        complement(328506..329300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33508"
FT                   /db_xref="GOA:A9WCT9"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCT9"
FT                   /protein_id="ABY33508.1"
FT                   /translation="MTLPAIFLIVTLIFVVALVWLHHARALSGRLPERRSLPALDMLRS
FT                   ALARSAETGRPVHLSPGASTIGAGEGQRASTAELLAGLSMIGQAASQAAAGGAAIEVSS
FT                   ADAVAHLALRGVVRQAYQTLGQSQSFDPRQIELWAHADAMAYATAVAAHYRQAQLEASV
FT                   LSGAFGQEVLLAAETGAQRAIPQVLGSTHPSALGLMIITTPHVLAGEELYAAEAHLTTA
FT                   PAPQARLLTHDTLRTIVIWLMLIAFGYGLIRVAFGWPALPGW"
FT   gene            complement(329432..329617)
FT                   /locus_tag="Caur_0256"
FT   CDS_pept        complement(329432..329617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33509"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCU0"
FT                   /protein_id="ABY33509.1"
FT                   /translation="MPVAMLLHIAAPFDVVCSQIVQAFVPLLHGTRWAVIADTLTVPDH
FT                   WPALRDLVQSRLQRED"
FT   gene            complement(329634..330122)
FT                   /locus_tag="Caur_0257"
FT   CDS_pept        complement(329634..330122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33510"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCU1"
FT                   /protein_id="ABY33510.1"
FT                   /translation="MIRYEIAATTVTTAPPERVLAVLDDFGNWPRWMPSLERVRIELPP
FT                   NEHPRQGYRFKLHGLLVHADMEVIDYTPLSRATRFRISFPPFQGVNRCRLIPLGDGRYR
FT                   IERLDQLELPDLVAHLIDSTQRKRFEKLAMEFLQALRREVEQPPHATAASAATTGRSD"
FT   gene            complement(330163..331233)
FT                   /locus_tag="Caur_0258"
FT   CDS_pept        complement(330163..331233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0258"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="PFAM: phosphofructokinase; KEGG: gme:Gmet_1640
FT                   phosphofructokinase, pyrophosphate dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33511"
FT                   /db_xref="GOA:A9WCU2"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WCU2"
FT                   /protein_id="ABY33511.1"
FT                   /translation="MASKKQRIGVLTSGGDAPGLNAVIRAVVKSASGLGWEVIGIHDGF
FT                   EGLLGTKSYRVLTNADVQGLLPRGGTILRTTNKGHFGPRRSDELSEADPYVRAVKAIEE
FT                   MGLRALITIGGEGTQRIALELHKLGAPVIGVPKTIDNDLAGTDRTFGFDTALQVATDAI
FT                   DRLHTTAASHNRVMVLEVMGRHTGWIALHAGLAGGADVILIPEIPFSIERVAEKVMARD
FT                   QQGSSFSIIVVAEGARPRGGSEMYIAEGRLGGIGHWVGEQLEKLTAKEVRVVVLGHLQR
FT                   GGSPSPYDRLLSTRYGAAAVQAAARGIYGEMVALRGQDIVTVPLAEACGHLNRVRPHSD
FT                   LVLCARSLGIAFGDEL"
FT   gene            complement(331528..331713)
FT                   /locus_tag="Caur_0259"
FT   CDS_pept        complement(331528..331713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0259"
FT                   /product="ribosomal protein L28"
FT                   /note="PFAM: ribosomal protein L28; KEGG: deb:DehaBAV1_1073
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33512"
FT                   /db_xref="GOA:A9WCU3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCU3"
FT                   /protein_id="ABY33512.1"
FT                   /translation="MATCELCGKKPSFGHNVSFSKRRTNRIWRPNIQKTTLTVPGGQSV
FT                   QVRICTRCMRTLAKTR"
FT   gene            331817..332671
FT                   /locus_tag="Caur_0260"
FT   CDS_pept        331817..332671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0260"
FT                   /product="DegV family protein"
FT                   /note="PFAM: DegV family protein; KEGG: rca:Rcas_0603 DegV
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33513"
FT                   /db_xref="GOA:A9WCU4"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCU4"
FT                   /protein_id="ABY33513.1"
FT                   /translation="MATMKVITDGASDIPFEVAHELEIEVVPLLARIDDRLYRIGIDIS
FT                   EDQVYDQLFSGNQRVEIVKPNATTFEQLYRSLLGRYDYVFSIHLSRHLGEIYSEALAGR
FT                   SRLPASSTRIEIIDSKLAGMGLGSVAIAAARAIRDGMTPAEVNERIGQTIRHTHTAFFV
FT                   DTMEYLEQSGLLTFSGSLIGSMQRIKPLMILDEGEIVPYERTRTRAKAIEGLFTFVEDF
FT                   PHVEDVIIHYATTPEDVEKLLEKLDPIFSRDRVQVSRMGPAIAACLGPGAMAVTAFEGF
FT                   DEA"
FT   gene            332668..335286
FT                   /locus_tag="Caur_0261"
FT   CDS_pept        332668..335286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0261"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: rca:Rcas_0601 ATP-dependent DNA helicase RecG;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG; PFAM: helicase
FT                   domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33514"
FT                   /db_xref="GOA:A9WCU5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCU5"
FT                   /protein_id="ABY33514.1"
FT                   /translation="MTEAERQQVIALGRLLAAERRDGCADRVTTDGLVAYLNQWSAAAG
FT                   SAARLPAVQRALGCLVGYDGMTLVERDQALAEAIEILRSLFRTAPTAPVETTVPPSPAV
FT                   DPTANAGHVPVTKRNTSARQSRKRAANVDQRPLAELNLDAPLEQIAGIDWRLVGGFRRL
FT                   GVRTIRDLLYHFPRRYDDVRNRRSISELQVGAEETVIGEVTDVRTIGAGPKLRVRVEVS
FT                   DETGSIEAIFFNQRWIAQQIRVGQTIALSGKVTTFGGKRQFSSPRWERYTPDPDALLHT
FT                   GRLVPIHPLTQGLHENQVRRFIKQVVDTMAPQVEDHLPPVRLQHARLLPLGEALAQIHF
FT                   PTDHTSLAAARRRLGFDEFLFIQIGVLQRKRLWQQEMGYAFTIDSQVHAELQRLLPFQL
FT                   TTAQQRAIEEIFSDLRRPSPMARLLQGDVGSGKTVVAAAALLQAVANGFQGALMAPTEI
FT                   LAEQHAKNLKQLLSRVRVPRKTTSATASSAYQQADWRSLLDPEEAAQLAEIISILGMSP
FT                   EEDMGGHGVRVALLTGSLGTRERRRVLEGIARGEIDLVVGTHALITETVQFAQLGLVVV
FT                   DEQHRFGVEQRLRLKNKGYNPHMLVMTATPIPRTLTMTIYGDLDVSVLDERPPGRQEIR
FT                   TKRVGRAERAKVYRHIRKQVAEGRQVYVICPLVEESEKLDLPSAEEMYERLQHEVFPDL
FT                   RVALLHGKLSAREKDDVMRAFRDHQYDILVATAVIEVGIDVPNATTIVIEGAERFGLAQ
FT                   LHQFRGRVGRGHHQSYCILISDSDNQQSKERLAALEQTTDGFKLAEIDLQLRGPGEFFG
FT                   TRQSGTPDLKMAQQGDTRLLAEARALADAILADDPELKRPEHDLLRRKVNDFWAAATQS
FT                   G"
FT   gene            335304..336581
FT                   /locus_tag="Caur_0262"
FT   CDS_pept        335304..336581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0262"
FT                   /product="E3 binding domain protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; catalytic domain of components of various
FT                   dehydrogenase complexes; E3 binding domain protein; KEGG:
FT                   rrs:RoseRS_1675 catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33515"
FT                   /db_xref="GOA:A9WCU6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCU6"
FT                   /protein_id="ABY33515.1"
FT                   /translation="MQVHTISIPPALGEATLLEWLVAVGESVTPTTPLARVLTAHAEWV
FT                   IPAQYVGIVAEHVVAAGATIPVGGELARCTPPPRVRATPLARRLATALGVDLTALAGSG
FT                   PGGRIMRADVVKAVDVASGSSDSLPPPAVVGDTVHARAVADATVGTIVSSTTELRIVDA
FT                   QPVPLAGATVAAVDVASDLSDSLPPPAVVGDTVHARAVADATVGTNTSSTIRLRIVDAQ
FT                   PVPLASATIAIDLQSVLHQCRVQNATFARYGLQATPQSALIAAAAGLFPEHPLINAAWT
FT                   ETAIVLRHRYHVAAGLTDGRWVLIRDAGDLNERGIARALTGTGHDLGMATCAIAVTADW
FT                   WQITPPLPGTVAALTLSEAQLKPVALGDTTIAVGAVAHLSLCYDARVLDHPTAMAFLNA
FT                   LCRRLGVRPLAEPQEDEVGLVSSGIA"
FT   gene            complement(336935..337735)
FT                   /locus_tag="Caur_0263"
FT   CDS_pept        complement(336935..337735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0263"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: rrs:RoseRS_4154 phosphate ABC transporter,
FT                   ATPase subunit; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33516"
FT                   /db_xref="GOA:A9WCU7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCU7"
FT                   /protein_id="ABY33516.1"
FT                   /translation="MTVHDLDHNNPNALEARNMSVYYGSFRAVKNVNLAIEKNRITALI
FT                   GPSGCGKSTVLRSFNRMNDLVPSARVEGEILFHGENIYAPGVDPVNVRRRIGMVFQKPN
FT                   PFPKSIYENVAYGPRINGWRLSKREMDELVERSLRGAALWDEVKDKLNQNGLSLSGGQQ
FT                   QRLCIARALAVEPEVILMDEPCSALDPISTLKIEELMFELRQRYTIVIVTHNMQQASRA
FT                   SDYTAFFLMDSDRAGQLIEYGPTSQIFQNPKDERTEQYISGRFG"
FT   gene            complement(337755..338690)
FT                   /locus_tag="Caur_0264"
FT   CDS_pept        complement(337755..338690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0264"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: sru:SRU_2295
FT                   phosphate ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33517"
FT                   /db_xref="GOA:A9WCU8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCU8"
FT                   /protein_id="ABY33517.1"
FT                   /translation="MSAQEQIRVSAQTAEPIVDRGGGNLKWRHFKGTLLTIFGWLSIIF
FT                   GLGVLLILILDVINRATGIFSGGTNWLTWDFFNNFDSRFPQRAGAKAAIVGTLYTISLT
FT                   ILFAFPLGVAAAIYLEEYARDNWFSRLVEINISNLAAVPSIIYGLLGLQVFARWLLLGR
FT                   SILTGALTLALLVVPIIIVASRESIRAVPLSLRQASYALGATRWQTVWHVVLPQSIGGI
FT                   LTGSILAVSRAIGETAPLITIGALTFVPFLPRNILDIFTVLPIQIFNWTSRPQDEFRAL
FT                   AAAGILVLLTILLTINALAIYLRNRYQKRY"
FT   gene            complement(338690..339604)
FT                   /locus_tag="Caur_0265"
FT   CDS_pept        complement(338690..339604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0265"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: syf:Synpcc7942_2443
FT                   phosphate ABC transporter, permease protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33518"
FT                   /db_xref="GOA:A9WCU9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCU9"
FT                   /protein_id="ABY33518.1"
FT                   /translation="MAVFDLRRQPNQARAIGEKIIQILLTIAATVSILTTAGIVFSLLF
FT                   ETIAFFREVSIVEFLTETEWTPLFSIKKYGIWPLVSATVLTSAIAMVVAVPLGLIAAIF
FT                   LSEFASDRIRRTVKPLLEILAGIPTVVYGYFALTVVTPFLKNFIPTLSIFNSLGAGLVM
FT                   GVMLIPFVASLSEDALSAVPNSLREAAYGLGSTRFEVATRVVAPAAISGIVASIVLAFS
FT                   RAVGETMIVAIAAGQNPRFTFDPTVPVMTMTSYIVQVSLGDTPYGSLSYYTLYAVGFTL
FT                   FLFTFVLNIFSYWMVRKFREVYD"
FT   gene            complement(339712..341760)
FT                   /locus_tag="Caur_0266"
FT   CDS_pept        complement(339712..341760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0266"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; KEGG:
FT                   rrs:RoseRS_4157 phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33519"
FT                   /db_xref="GOA:A9WCV0"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCV0"
FT                   /protein_id="ABY33519.1"
FT                   /translation="MVGNPKRWIYGLMLIALIVPVIAACGPQPAAQPTAAPAQPTAASA
FT                   QPTAPASELASLSGDIIIDGSSTVYPPTAAAAEEFSRLAPNVRVSVGISGTGGGFKKFC
FT                   NGETDISNASRPIREEEQAICAQNGIEFIELPVAYDGLSVVVNPQNDWVTCLTVAELKK
FT                   IWEPAAQGVITNWNQVREGFPNRPLVLLGAGTDSGTFDYFTEAIVGEAKASRGDYQATE
FT                   DDNVTITGVSGDLNAMGYLGYAYVVENQGKIKPIAIDNGNGCVEPSFETIADASYQPLS
FT                   RPLFIYVNKEAAERPEVQAFVNFYLSPEFTPIIQTPQVGYVKLSDELYAAIAKRFNDRV
FT                   LGTMVRPGEEVGLTLDRYLTGEMPPLPSSAPTFDYATLSGDIIIDGSSTVYPPTAAAAE
FT                   EFSRLASNVRVSVGISGTGGGFKKFCNGETDISNASRPIREEEQAICAQNGIEFIELPV
FT                   AYDGLSVVVNPQNDWATCLTVAELKKIWEPAAQGVITNWNQVREGFPDRPLVLLGAGTD
FT                   SGTFDYFTEAIVGEAKASRGDYQATEDDNVTITGVSGDLNAMGYLGYAYVVENQGKIKP
FT                   IAVDNGNGCVEPSFETIADATYQPLSRPLFIYVNKEAAERPEVQAFVNFYLSPEFTPII
FT                   QTPQVGYVKLSDELYAAIAKRFNDRVVGTLVKPGEEVGLTLDRYLGK"
FT   sig_peptide     complement(341665..341760)
FT                   /locus_tag="Caur_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.669 at
FT                   residue 32"
FT   gene            complement(343090..345027)
FT                   /locus_tag="Caur_0267"
FT   CDS_pept        complement(343090..345027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0267"
FT                   /product="polymorphic outer membrane protein"
FT                   /note="KEGG: rrs:RoseRS_2393 polymorphic outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33520"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCV1"
FT                   /protein_id="ABY33520.1"
FT                   /translation="MNLHRWLHLASLLFAMVGFLWPSIPVQAAPKVVGTGTPASCTATA
FT                   LVNAVTGGGEVSFNCGPNSHTIVLNSPLIINAPQTLIDGGGLITLQGGGGRIIDHFTYG
FT                   NIGPSRLELRNLTITGGRASGGGTDQSAVDGSGGAIRSYFAAANSAFTPTLVIDRVIFR
FT                   DNQTTLTAVPPGRDAYDYGGGAIYSRGGAVIVTNSRFENNHANNGAGGAIHLLQSSLSV
FT                   EDSVFLGNTAIGARPQDSFGGAISADGLGGPDRRLRVVRCRFEQNQTYNSGGAIHANLY
FT                   EDSSRLEVIDSSFIANAVVGGQRAQGGAIGGGGTAIGTGTGNPEILISGSLFHANRARR
FT                   TPGADGNPREDGSGGAIAFPQQVRLRIVNSTFVANRAEGTGFNANGGALYVLNNRPEPF
FT                   VIESSTFAENYAGWVGGAISHSGNGSVSNSLFAYNTAGNGGNGWNIQQHCSRELTHDGR
FT                   SLQYPPRLTGASFWNDVTCFAGKSAPSQTGDIQFRDPLLKPLAAYGGLTMTMAIPADSP
FT                   ARDAGSGCPPTDQRGVARPQLNACDLGAFELQVFLVATPSLLARNQLPPPLILHGVDFS
FT                   NATQAFIDGQPRSTTFLDSQRLRLTLTMTDVADLGPLTVTLSGPGSAVGSTQVQVVEAV
FT                   YSIYVPQISR"
FT   sig_peptide     complement(344941..345027)
FT                   /locus_tag="Caur_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(345099..347018)
FT                   /locus_tag="Caur_0268"
FT   CDS_pept        complement(345099..347018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0268"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   KEGG: rrs:RoseRS_2175 N-acetylmuramoyl-L-alanine amidase,
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33521"
FT                   /db_xref="GOA:A9WCV2"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCV2"
FT                   /protein_id="ABY33521.1"
FT                   /translation="MPDFPTEGSPPFINRMLTIAEWREYVASYDFGKLTPTRLVLHHTY
FT                   RPDETSWRGLTTMRGIQKFYAGKGWTAGPHIFAAPDGIWLATPMSQIGIHAGAGNGSLA
FT                   KGWYSIGLEMVGYFDKVLPSGKVWEHSLAVMGELSRRLKIPPRQLISFHRDYTNQKSCP
FT                   GWAVTKEWVWSQVEAYLNNSTPPTIPPGQIGTPTPDDERLIEALLEEGYKHKTNGQGYN
FT                   ADWAFHAYALEHQLGMPMGPSARLTVAGKEYNYQPFARDTLYCEVPNWGDVKTLSELLG
FT                   GSIPPSGLGRALLDATYQAGGSPFRPDWAFHQYAVARRLGPPVGKSAQITVDGKQYAYQ
FT                   AFAVDTLYNLVPNWSDVRQLSQIGTATDPATVRLRDALLTETFKQAGTTYRPDWAFHQL
FT                   ARQWAIGAPLANSYQITLEKTTYALQPFALDVLYNVVPNWADVKRLSDLARQHGMPVLG
FT                   MAMAIAPLVSAESLTPPDDGGFSITQVTPPAMAFGERHGERVSMVVLHAVPGAVAETIA
FT                   AMTDFNARFATHYLIGLDGRIYRLIDEAKAAWHAGFATGGGVRYNLNRISIGIALERPA
FT                   GWPATRDAGDTDAQIRALRWLLRQLDARYRLSPDAIVLWTSLAGSDDEALSGLPLGALR
FT                   EALS"
FT   gene            complement(347037..347996)
FT                   /locus_tag="Caur_0269"
FT   CDS_pept        complement(347037..347996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0269"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   gvi:glr4409 putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33522"
FT                   /db_xref="GOA:A9WCV3"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCV3"
FT                   /protein_id="ABY33522.1"
FT                   /translation="MDITLWAWIGFHAIVFLVLALDLGVFHRRSHKVSIREAGLWTLVW
FT                   VTLSLIFNGIIWLWRGPEDGLNFLTGYLVEYSLSVDNIFVFILLFSYFRVPAQYQHRVL
FT                   FWGILGALIMRGTMILLGSALIEQFEWILYLFGAFLLVTGVRLIFHDDEPEVDPQRNLL
FT                   VRLARRLLPITPDMRGDRFFVREADRFSATPLFLVLLIVESTDLLFAVDSIPAIFGITH
FT                   DPFIVYTSNICAILGLRSLYFLLAGVMESFYYLRFGLAIILSFIGVKMLTPLVTGWFLG
FT                   GHSVHIPTTISLGVIVVTLLASVVASLIRSRRLASATD"
FT   gene            complement(348026..350029)
FT                   /locus_tag="Caur_0270"
FT   CDS_pept        complement(348026..350029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0270"
FT                   /product="GAF domain protein"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase
FT                   dimerisation/phosphoacceptor; KEGG: rca:Rcas_4451 signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33523"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCV4"
FT                   /protein_id="ABY33523.1"
FT                   /translation="MKDATVRSMYEVLTSQPPDLVGVLRETIPSIGMLIDALEQQSDPT
FT                   LRLSLLRQIGAEWYACGGMAEVLTELGLHLAARLPMAQGIVVSELLLAFGAAQEEQRTR
FT                   EWEARLVARATQLDGLHRIISAANSTLDLDTSLQTVVETVAQVMNVEACSIYLYDKHRD
FT                   DLVLRATHGLNRAAIGQVVARLGEGVTGWAAQLGYPVAVSDVYKDPRYHREPQLGEEMF
FT                   RSMLAVPIVLFSAERFQFSADKLQGVINVQTIAPREFTQEEISFVETAAGELAFFIANA
FT                   QLYQQTDERLHQKLRELTTLQQVSKLIAEQIGLHDVLNLIVEKAVHLSKVDRAAIFQMG
FT                   EDGQLKLVASYGGEGDGVRDLVIQTVRDGRPLAVMNAYQDARFPQLPAVARAENFHSLF
FT                   CMPLRARGRTIGGICLYRREPHLFDYEQVRLLNTFADEAAIAIENARLYEESLRALRIK
FT                   SALLQEMHHRVRNNLQTIAALLSMQLRRLDPASPGAKALRESAARIQAIAAIHNLLSRD
FT                   DIGVTTVGAVARQVIESVQSTLFESDIRVDFAILGDEVRIGSRDATVLALVINELVDNA
FT                   LTHGLAVEGGRIEVEAVLEHGQVLVELRDDGPRHPPPPSRHSSGLGLQIIETLVNSDLN
FT                   GSFSLIRDEEAGWMRARIRFPQRIIDEDRIEV"
FT   gene            complement(350256..351056)
FT                   /locus_tag="Caur_0271"
FT   CDS_pept        complement(350256..351056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0271"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rca:Rcas_0420
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33524"
FT                   /db_xref="GOA:A9WCV5"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCV5"
FT                   /protein_id="ABY33524.1"
FT                   /translation="MIMLRWEPIKVIIAKEWLELRRSRGLLLSMLLPPIFLPLFALGLI
FT                   FVMGLVSDPDTADIPAAAVDPALANLGLEALAQVIFGRQFSTLFLLLPMIIPNVLASYS
FT                   IVGEKNRRTLEPLLAAPIKVSELLLGKVLAAIIPGIVLTWGCAIVFAVGLAIVVVDPQV
FT                   PALVLQPGWVATLLLSSPLLAIISVALTVMISSRVNDPRSAQQIAGVLIVPVMLLFFGQ
FT                   MLGLFVLNVVVALIFALVLALIAAGLIWLATNVFQREEILTRWR"
FT   gene            complement(351341..352273)
FT                   /locus_tag="Caur_0272"
FT   CDS_pept        complement(351341..352273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0272"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rrs:RoseRS_4617 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33525"
FT                   /db_xref="GOA:A9WCV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCV6"
FT                   /protein_id="ABY33525.1"
FT                   /translation="MNAIECYQLSRRFQTITAVDNLDLVVPAGTIFGFLGPNGAGKTTT
FT                   VRMLCALIAPSSGSARVAGFDVQTEADSVRANTGILTETPALYDTLSALENLTFFARLY
FT                   GLSATQASERAAHYLRLFELWERRNDPVGGFSKGMRQKLAIARALLHDPAVLFLDEPTS
FT                   GLDPAASRSVRDVIKSLRASGRTIFLTTHNLAEADELCDLIGVFRTRLISLDTPANLRT
FT                   RLFGRSVRVVLAGPAAPLAPLVQQLSFVMNVTVDDERTLLVQLTDPEKDNPVLVRALVA
FT                   AGADVCYIEPFTPSLEAVYLELIQEPVAG"
FT   gene            352841..353362
FT                   /locus_tag="Caur_0273"
FT   CDS_pept        352841..353362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0273"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="KEGG: rrs:RoseRS_0741 adenine
FT                   phosphoribosyltransferase; TIGRFAM: adenine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33526"
FT                   /db_xref="GOA:A9WCV7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WCV7"
FT                   /protein_id="ABY33526.1"
FT                   /translation="MTRQDLASLIRNIPDFPIPGIQFKDITTLIGNGQAFSEVIDRLHE
FT                   RYQNQQIDAVVGIESRGFIFSAPLAYRLGVGLVPIRKPGKLPAATYQIEYQLEYGTNRL
FT                   EIHRDAFQPGARVLVIDDLLATGGTIAAACDLIEMAGGQVAELAFVIELTFLNGRERLR
FT                   ERPVFSLIQF"
FT   gene            354152..355486
FT                   /locus_tag="Caur_0274"
FT   CDS_pept        354152..355486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0274"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: rca:Rcas_3710 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; SMART: AAA ATPase; Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33527"
FT                   /db_xref="GOA:A9WCV8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCV8"
FT                   /protein_id="ABY33527.1"
FT                   /translation="MTVAELETKTLADLREMARKLDISGISSLKKRELIDKLIQAQTAT
FT                   QTQTITVTEPPALPDLNPIETTTVDRTSIEFSTIYSDGILDIMAEGFGFLRGNRMLPSP
FT                   EDVYVSQSQIRRFALRSGDRIWGQIRPPKESERYYSLLRVEKINDQDPETARKRPFFDQ
FT                   LTPIFPNEQIKLETEPNLLHTRLVDLIAPIGRGQRGLIVSPPKAGKTMLLKAIANGITT
FT                   NYPDIILMVLLIGERPEEVTDMRRSVRGEVISSTFDEPVENHTKVAEMTLERAKRLVEI
FT                   GHDVVILMDSITRLARAYNVAMPPSGRTLSGGIDPVALYPPKRFFGAARNIENGGSLTI
FT                   IATCLIDTGSRMDDVIYEEFKGTGNMELHLDRKLAEKRIFPAIDIQRSGTRREDLLLSP
FT                   DTLRQVWTLRRMVSMLGENEGTELMLTRMAKTKSNAEFLQTLSKS"
FT   gene            355566..356513
FT                   /locus_tag="Caur_0275"
FT   CDS_pept        355566..356513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0275"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   rca:Rcas_3709 protein of unknown function DUF124"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33528"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCV9"
FT                   /protein_id="ABY33528.1"
FT                   /translation="MNCPQCGAPVAPNARFCTNCGARLTPAAAAPSSFIPPSGESVSMA
FT                   DVYDNRPGERLDLPEPTIVGTGVGASGLRYKIIGTTMQAVVLEVPAGQTIFSERGGMSW
FT                   MSANVQMQTNMEGGLGGAFKRMFSGESIFMVNFTPQGGPGIIGFSAELPGKIVPLNLAP
FT                   GQTMICQKDSFMCAERSVSLDIHFRRKLGAGFFGGEGFIMQKLTGPGLAFVELDGEVVE
FT                   YTLEANQMLKVDTGHVAMYEPTINFDVEMVRGFKNILFGGEGLFLTTLRGPGRVWLQTM
FT                   PAMNLAKKLAQYMPTTSSSSGSGGINLGNLFTND"
FT   gene            complement(358297..358665)
FT                   /locus_tag="Caur_0276"
FT   CDS_pept        complement(358297..358665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0276"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   rrs:RoseRS_0746 roadblock/LC7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33529"
FT                   /db_xref="GOA:A9WCW0"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCW0"
FT                   /protein_id="ABY33529.1"
FT                   /translation="MASRTEEMVRHLKALSMNTPDIEASAVVSVDGLIMASALPADVEE
FT                   DRVSAMSAAMLSLGERIASELRRGQLDQVFVRGEDGYVILMAIGEEAVLTALAQSRAKL
FT                   GLVFLDMRRTANELVNLV"
FT   gene            complement(359276..360508)
FT                   /locus_tag="Caur_0277"
FT   CDS_pept        complement(359276..360508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0277"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rrs:RoseRS_0747 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33530"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCW1"
FT                   /protein_id="ABY33530.1"
FT                   /translation="MLTACSVLPSTAPVRTSERVVLRLWHAWPAADSRVLQSLVDQFNQ
FT                   THPESQIVIQSRPAVSLPSDVATTISEGGGPHLVIVQSHMLGMLVQAGVLRSLDDMLSN
FT                   SEVNSLLPAAVGAAQVSVSGQPVLFGVPITFDTLALYYNRANVLQPPSSTEEMLLTARA
FT                   LTNRNQTPPVWGLAYNLSLDRTIGYLYAFGGRVFDENGAVVLGSSGRAGTERWLTWLSQ
FT                   LYRDEQLLATLDGVLVDRALQAREAIMTIDWAHAQAEYRAIWNDQLGVTPLPVLSAEDR
FT                   VPQPYVQADVIALNARLDNQAEQAAAQAFIRFMIDVNSQRALLAAGRQPTQLALQLSDN
FT                   DLADSVQLAAARAFRLQAQNGLPMPADRVAHEIVWTTLVEMQLNAVRGLLTPEQAVTLA
FT                   DEFLRSRLASP"
FT   gene            360997..362346
FT                   /pseudo
FT                   /locus_tag="Caur_0278"
FT   gene            363255..363833
FT                   /locus_tag="Caur_0279"
FT   CDS_pept        363255..363833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0279"
FT                   /product="phosphoheptose isomerase"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG: wsu:WS0681
FT                   phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33531"
FT                   /db_xref="GOA:A9WCW2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCW2"
FT                   /protein_id="ABY33531.1"
FT                   /translation="MSFQQQLDEAITVLQACTTLAPAIDRITELVADAILSGHTLYTAG
FT                   NGGSAADAMHLAEELIGRYRHNRRPLPAICLNADVGAMTCIANDFGYDEVFARQLTALG
FT                   KPGDVLIVFSTSGNSPNIINALSTARARGMINIALLGKDGGMARNLADHALIVPSQNTA
FT                   RIQEVHTLFLHAICEQVEQRLASASEPYV"
FT   gene            363843..365420
FT                   /locus_tag="Caur_0280"
FT   CDS_pept        363843..365420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0280"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="KEGG: rrs:RoseRS_0271 D-3-phosphoglycerate
FT                   dehydrogenase; TIGRFAM: D-3-phosphoglycerate dehydrogenase;
FT                   PFAM: amino acid-binding ACT domain protein; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase catalytic region;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33532"
FT                   /db_xref="GOA:A9WCW3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCW3"
FT                   /protein_id="ABY33532.1"
FT                   /translation="MNRILVTEKIAAEGLAVLRQAGTVDVRLDLDKPTLISIIGEYDAL
FT                   VVRSATKVTAEVIAAGERLRVIGRAGTGVDNIDVEAATRRGIIVVNAPASNNVAVAELT
FT                   IGLLISLARRIPQAHASLQSGRWARNDFVGWEVRGKTLGLVGLGRIGSEVARRARSLEM
FT                   EVLAYDPVVSFDRAEQLGVSLVTLDELVQRSDVISLHVPLIESTRNLFDQQRIMQMKRG
FT                   AYLINASRGGIVDEVALVEALNSGHLGGAALDVYNQEPLPADSPLLGHPKIITVPHIGA
FT                   STTEAQLSAGTEMAEGVVTALNGGTPRYAVNAPFVAPEAWNVLQPYLNLGRLLGTLVMQ
FT                   LVQEPVRSYDLELGGELADMDTQPVRLAVLQGLLAASSSERITPVNAPIIARERGVRMT
FT                   ERVSPEAENYAGLITLHVQTAERTRTFSGTVLRGEPHIVQMDGYFVDFVPQGSLLITYH
FT                   HDQPGMIGKVGQLLGAADVNISGMYVGRRAPRERAVMVLTLDEPAPPQVMEQIATIPGI
FT                   QAAFSVEL"
FT   gene            complement(365477..366610)
FT                   /locus_tag="Caur_0281"
FT   CDS_pept        complement(365477..366610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: wsu:WS0992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33533"
FT                   /db_xref="GOA:A9WCW4"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCW4"
FT                   /protein_id="ABY33533.1"
FT                   /translation="MNCKALIFLVPHPNTPIVTFDSIAALWAKTDVTGQMLLLIALAGV
FT                   AIFAIRHLQSLIWNLSEFSRFRRSSAYLQLRETNGAVMLMALPLTLAMTINVAFVSGAV
FT                   FVPGLWNVVEYLFPFAMTAFLLVGVLALRTFADIFGRALANGHFDCTRNNNLTQLLAAF
FT                   AFAMVGVGMAAPAAMSTVKLTIGLSMLGTIFFITAAVVIALILLVLGARAMLTNGLAVE
FT                   AGPSLWMPIPLLTLIGIAMLRISHGLHSGFELHIEAPHRLLITAVFFSLQLLAGLLGLS
FT                   VLRRVGYFRTYLNGPARSPGAYGLICPAVGLFVFGMFFLHVGLVQNGLIEKFSPVYFVA
FT                   LAALAVVQVLGIITMFRLDRRLLAQPARSPAEAERVA"
FT   gene            complement(366863..367246)
FT                   /locus_tag="Caur_0282"
FT   CDS_pept        complement(366863..367246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0282"
FT                   /product="helix-turn-helix Fis-type"
FT                   /note="PFAM: helix-turn-helix Fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33534"
FT                   /db_xref="GOA:A9WCW5"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCW5"
FT                   /protein_id="ABY33534.1"
FT                   /translation="MAHRETSRDEVIAALHANRGLIALAARDLGVSRQALYARIKRDPE
FT                   LLACIEHEREAIVDLAEQKLFEALDKGERWAVMLVLTRLGRHRGWADAPASGGPEGRVA
FT                   KALEQASLDDLMLSLTTLNGQRR"
FT   gene            complement(367288..368313)
FT                   /locus_tag="Caur_0283"
FT   CDS_pept        complement(367288..368313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0283"
FT                   /product="zinc finger CHC2-family protein"
FT                   /note="PFAM: zinc finger CHC2-family protein; KEGG:
FT                   fra:Francci3_3307 zinc finger, CHC2-type"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33535"
FT                   /db_xref="GOA:A9WCW6"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCW6"
FT                   /protein_id="ABY33535.1"
FT                   /translation="MTLTTAPTIDLPALIERLGVRLHRYGRSYRCACPLHAGDNELAFS
FT                   IYQSRSGQWRWHCFSGDCGDGDAIAFVRRYYGVGYREACQMLGVTPASAPSGPRSPQPP
FT                   PVEPPSAQWQHTVGRLVDQAVQALWSPAGQAARAYLYQRGLTDALIRRAGLGYHPAATR
FT                   IRAETLGLDGDNPYYPAGIVIPYWVEGDLWRVQVRRLSNTEPRYLSLAGSSGAPPYLIA
FT                   PITSAKPLVLAEGPVDVLAIMQAAGDLVTAIGTGATGCRAVRWIARCAVAPLVLAAHDA
FT                   DEAGDAAAAYWCDALQPRCTRWRPTLHDPAEMLQLGGLALVRQWIEQGLASAEGDGYNR
FT                   R"
FT   gene            complement(368429..370912)
FT                   /locus_tag="Caur_0284"
FT   CDS_pept        complement(368429..370912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_0087 toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33536"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCW7"
FT                   /protein_id="ABY33536.1"
FT                   /translation="MKKHTSTSSYHNGSPASTPPDHLIAEALRALAGPDDAAAQQAAQT
FT                   DCGPWNHVRDALATARASGGQPAAQRALAALQHQYPDLTTLLASAQALDLDDDDEPASD
FT                   APSPLPLGGLPGWVREMVRHTAEAVQVPVDLAHALALGALSVATAGAMRVQLTSDWNEE
FT                   TCLYVMPALPSGERKSAAFALLIGPIEQWEDDERNRRAPEYTTSQARKRVLDKEIERLT
FT                   AEAAKEQDASRKKQLEWALATAITEYERVALAAPFRRLLQNATPEALTSALVAHQRIAV
FT                   VSPEPDSMQVLIGAGRDGPPMLEAILKGYNGERLIIDRQTRQSQRVAAPALTMVLAAQP
FT                   HAVRDLIRNRALIERGVLARYLILLPPSRLGARAIAPPVIPELVKATYATHLRWLLDTC
FT                   QPPAPEQRHTVTLSAEALHAVHAMQAMIEPRLHEQRGDLAGHPLLRAWAGKLTGHVVRI
FT                   AANLHAAHCAARKVLPWAEPISGEVMRAAVAYCEPLIAHMRAVLGDAVMSDADRVARRV
FT                   RAIIARYAAHGQITERMIYQAMRTESREMIERALQTLLKDGDLEGPLKVTGRKGGRPSK
FT                   VYRVLIAPNATSAATTTPPGASYAAPEPAPEPAPEPAPEPAPEPAPEPAPEPAPEPEPV
FT                   PPAAPPSAATNAAAPASKRVISMPPTPPAWYDVVKPLTQRLPATLSAEMGAPAGQPLGI
FT                   LIRRNDRPASSPDATLYIAPFDLPEGVSRAEAIAAGVQHVLAELRRRWPDAHPASAEGA
FT                   EGAEGDEGDEGDNDLPPLPAGVKPSAWRAVNWRYVMHLATKRPADWERGVRTHAVLKGI
FT                   PPEALLAAAQARAGL"
FT   gene            complement(371491..372018)
FT                   /locus_tag="Caur_0285"
FT   CDS_pept        complement(371491..372018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33537"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCW8"
FT                   /protein_id="ABY33537.1"
FT                   /translation="MTNDTTPMSNVDQRRIRAALRIIVLASLYAERVAREHIPDSDALD
FT                   ELQGYIALIRDAAAIAGAELDGFESQLIAETVTHLNAHEVVRLFAEHHAAFFAKVAIAV
FT                   ANAAADRALCDIRPGRKPGPAIEEEKLQAALDYYERNAGCITLEEAATRHCIAPRTLSR
FT                   YRSQRRKQANNQ"
FT   gene            complement(372098..372427)
FT                   /locus_tag="Caur_0286"
FT   CDS_pept        complement(372098..372427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33538"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCW9"
FT                   /protein_id="ABY33538.1"
FT                   /translation="MTPPELPATGPEQPGDAPAAPARALVRAHRLIGYVVGHITLDGVD
FT                   HAIIHTQPHRYEVAPAHLVQPADADAALMDIRLALADAVALARWRGIEPATVLAALTAI
FT                   IAQAE"
FT   gene            complement(372641..373387)
FT                   /locus_tag="Caur_0287"
FT   CDS_pept        complement(372641..373387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33539"
FT                   /db_xref="GOA:A9WCX0"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCX0"
FT                   /protein_id="ABY33539.1"
FT                   /translation="MKRHIGLAIHGGLALVIVGWSLWGAYTFWQFVFLTPWAAVGALLL
FT                   IEAFALAGFALHVLGIPTPVAAARHLLPVASAAPALHSIHALAKGVGDLEAWALAGIVT
FT                   LVLMLASYAVWRGLEALLLDRALLVQAEVEARAKHAEVAVQRIAAEAAAMVRIITAMRN
FT                   AVQAHERAALPPAADLVLARVASYPEPQPAAPDSSPSATARTSDAAPRYQCPHCGAPLA
FT                   NLGQYGAARKHGYCRQCRPGTEARNG"
FT   gene            complement(373384..374895)
FT                   /locus_tag="Caur_0288"
FT   CDS_pept        complement(373384..374895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr9504 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33540"
FT                   /db_xref="GOA:A9WCX1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCX1"
FT                   /protein_id="ABY33540.1"
FT                   /translation="MSNLTINRIGPEAQADSAWHDEDVEAARFAALDVRPAPARWRGRD
FT                   ALGVALAGLVALGGWLALVIVFWVAARITESAYPPAPGWVLFWQVLLGITASAPAWLGI
FT                   LAASVWVYERRIYARRANVIRDKLMNPVPAHLINQLTLPSYYALFERAAALEREVAPYR
FT                   AYRGVESLSLSASAAKPSGEEARKALESVVTPAIERLDDWVTDVAAREAHILVSGKTAS
FT                   GKTTTGAALLARRIDAGDAICVIDPHHEPGKWWGIDAIGAGRDYAAIGAALDALDAEMT
FT                   ERYRRLADGEPPGQRLTVLIDEAPAIAAALERRWKALATRLGSEARKVGIALIILSQSP
FT                   LVEDLMMNSVMRRNYTIIGLDMASIRVMLRDARNARDILATLEGRPYPALREVDGEFRI
FT                   CDRTGIHQVRPQRSPNVWRLPVCDEAASGPAQTDRRADAETIERLKAFIRAGITRDEAR
FT                   AQGVAFDNSDWTRARREVEAETELLNGLLVASPRDGLRATTEVQG"
FT   gene            complement(375155..375367)
FT                   /locus_tag="Caur_0289"
FT   CDS_pept        complement(375155..375367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33541"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCX2"
FT                   /protein_id="ABY33541.1"
FT                   /translation="MISEEARRLALAIWAEQAASGIGPAMVEAERLAEWLANRTYPLTL
FT                   LERAANGDVTALLAVRIEAGLPAIV"
FT   gene            complement(375521..375757)
FT                   /locus_tag="Caur_0290"
FT   CDS_pept        complement(375521..375757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0290"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="KEGG: xau:Xaut_0314 putative transcriptional
FT                   regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33542"
FT                   /db_xref="GOA:A9WCX3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCX3"
FT                   /protein_id="ABY33542.1"
FT                   /translation="MNSHLRILIAQKELRERRRLSVRVIAEESGASRSAIERLMNNTIR
FT                   EVPLDDLARLCVWLDCQPGDILRLEPLPEEPAR"
FT   gene            375923..377446
FT                   /locus_tag="Caur_0291"
FT   CDS_pept        375923..377446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0291"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   bja:bll1959 DNA invertase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33543"
FT                   /db_xref="GOA:A9WCX4"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCX4"
FT                   /protein_id="ABY33543.1"
FT                   /translation="MHAVIYARVSTEEQGDNFSIPAQLAACREYAERNGLQVVAECIDT
FT                   MSGARLDRPGLQQVRDLVSQQLVQAVIVYHQDRLSRNLAHFLYLRDEFQNARIALHFTT
FT                   LGQARDTPEDKLIQNMIGSFAEHERLRIIERTKQGRRARLLSGKPLGLGNHPAYGYHWH
FT                   GTKHDRHLHINEAEAAIVRRIFAWALEGVPTQRIAKLLTDMGVTPRGRAGRPPRPEWDH
FT                   TTVAGMLRNPVYKGQYYSAAHNLFVPVPAIVDAETWEAVQEQLTRNQAMAKRNAKRVYS
FT                   LRGRIRCGICGNRMSGNGAGTRASGKTYHYYMCHAAKGALIASCNHGTSYRAERLEALV
FT                   WQWVIETVLDETRLVRAIEAARANEAGQREALEHERAAYARQIAEAGTRTARLIELYTA
FT                   GVCTLDEVAATKKQYELQRQSAQRELDRIDAQLAALNSHHANRDALLAMARALKAALQI
FT                   EATPEEQMKVYEALDVQVVVRENNIDVRAVLTGDAGTFLIAGEPISSTR"
FT   gene            complement(377436..377510)
FT                   /pseudo
FT                   /locus_tag="Caur_0292"
FT   gene            complement(378519..379559)
FT                   /locus_tag="Caur_0293"
FT   CDS_pept        complement(378519..379559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0293"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="PFAM: Vitamin K epoxide reductase; KEGG:
FT                   rrs:RoseRS_0493 vitamin K epoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33544"
FT                   /db_xref="GOA:A9WCX5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCX5"
FT                   /protein_id="ABY33544.1"
FT                   /translation="MRTRWLWVGLLSSLLVIVEWLSLPDALAQSPVARAVLFFSPTCPH
FT                   CHVVLDEVLPPLQARYGDQLHILTIDVTTPDGMALYEAAITTFAVPRERFGVPALFFEQ
FT                   VHLVGSTEIPAQLPGLIEQALTTGGSRWPPIPGLEPYITRLEAGTPSLPSASASTSPFS
FT                   RDPANTLALLVLTGMVIVIFITIRRLRWPFDRSLPASSNRLIPVFAVVGLVLAGYLAVV
FT                   ELSQQSAVCGPIGDCNLVHQSPYARIAGIPVGLVGVAGYLAILGAWMINYVRDWRVARQ
FT                   LLVGFVLVGTLVSLYLTFLEPFVIGATCLWCLLSAITMTTLLWLVALPVDRPVMRGRRS
FT                   LSAAKR"
FT   sig_peptide     complement(379473..379559)
FT                   /locus_tag="Caur_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.636) with cleavage site probability 0.570 at
FT                   residue 29"
FT   gene            379922..381352
FT                   /locus_tag="Caur_0294"
FT   CDS_pept        379922..381352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_4725 polymorphic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33545"
FT                   /db_xref="GOA:A9WCX6"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR026457"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCX6"
FT                   /protein_id="ABY33545.1"
FT                   /translation="MERHNTVLSLPTLRGLVGKLVYTSGSHAFSRSILKGRRYAQDRWG
FT                   SFIESRSWGWIMLMIVAGVVGGWLLLHNARPTLSAGSIVVTTTDDELNSDGDCSLREAI
FT                   QAVNTQSPVDACPTGSGNDTITLPAGVYTLNIAGAGEDNNTTGDLDIFATASAVTRTLI
FT                   IQGNGASTTVVDGNQLDRVFHLVARAPVRFQDDLLVLRDLTVRNGRLPAATREGGAGLL
FT                   SWGRLELYNVIIENNATTGTSSSDVGGGFCIGCGPGTGSGYLENVIVRNNAAQRGGGVF
FT                   SNRPLTITASSIISNTAVARGAIENYGALTLINVTVSNNFASNNTGGIGHFAGSLSVLN
FT                   STISHNTSRGILFDAPATLKNTLLAYNTPGGNCFISTPPTSQGYNLSNDNSCASLLTAS
FT                   GDLNNVDPQLGPLQNNGGFTPTRALALTSPAVNAGTNSDCPATDQRGVTRPQDGTCDIG
FT                   AYELQVQRVHLPLVLKQS"
FT   gene            381515..382009
FT                   /locus_tag="Caur_0295"
FT   CDS_pept        381515..382009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33546"
FT                   /db_xref="GOA:A9WCX7"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCX7"
FT                   /protein_id="ABY33546.1"
FT                   /translation="MITKLFSHLTGGFIMIIFGAIFVGVGLFARDWMVPSSHLSASGVV
FT                   VDLDEVRSSRGSTGYKAVVEFTTSTGQVVRFQDPTSSNPPAYRRGQEVTVLYDPENPEF
FT                   AVIDSPFTWLPSTVFIGFGGLFVVLGIFALLNWLLILLKLGGILGVLGLLLRRSRSPVS
FT                   H"
FT   sig_peptide     381515..381604
FT                   /locus_tag="Caur_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.740) with cleavage site probability 0.724 at
FT                   residue 30"
FT   gene            382247..383155
FT                   /locus_tag="Caur_0296"
FT   CDS_pept        382247..383155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33547"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCX8"
FT                   /protein_id="ABY33547.1"
FT                   /translation="MPITRFVLIAVILALSACSSGGSSTVEPSPVAVNPTPTVQPSPVA
FT                   ENPTPTVQPSPVAANPSPTVQPSPVVENPTPTVQPSPVAENPTAPVPPVAAAGQCQNPY
FT                   YPVVQGATWQYQISGASSDTFVRTITQVREDGFDDQDVFSSGATRQGSWQCQQGNLIGL
FT                   SAGSNPSVALSDQMNFTFTVESNTGISFPADPQPGAEWTQTIVYGGQSDIGGTTVALRN
FT                   TMQLSCKAIGVERVSVPVGNLEALRVDCTTRFDISFAGATALSTTTTGSAWYASGVGLV
FT                   KSRDSSDTGVTEIVLLSYSIP"
FT   sig_peptide     382247..382324
FT                   /locus_tag="Caur_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.708 at
FT                   residue 26"
FT   gene            383184..384170
FT                   /locus_tag="Caur_0297"
FT   CDS_pept        383184..384170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr7467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33548"
FT                   /db_xref="GOA:A9WCX9"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCX9"
FT                   /protein_id="ABY33548.1"
FT                   /translation="MWDFSIGKAFSLLIRTTPFIGFRFAIYFGITLAYIVATGGGAGIG
FT                   YLIGSVLGDAETAGGSAFWGGLFGFGFVSGALYFAREYLMYIVKAGHIAVLVRLMDDQP
FT                   IPEGTGQIAYASQIVKARFAEASLLFGLDQLIKGIIRTVNSTLLTISSFLPIPGLTNAM
FT                   EFVTAVIRFSLTYVDEAILAYIIRTDQANSWASARDGVILYAQNYRLLLKNAVFLTIFA
FT                   WILSFVIFLIVIAPVAALVSVMPGLGGFWTLIIAIITAYALKAALIDPFAMACIVQVYF
FT                   QAIAGQTPSPEWVDRLNSLSAQFRELGEKAAAAMGGSSRLPISTWKG"
FT   gene            384353..386542
FT                   /locus_tag="Caur_0298"
FT   CDS_pept        384353..386542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0298"
FT                   /product="polymorphic outer membrane protein"
FT                   /note="TIGRFAM: polymorphic outer membrane protein; PFAM:
FT                   Polymorphic membrane protein Chlamydia; KEGG:
FT                   rrs:RoseRS_4272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33549"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR026457"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCY0"
FT                   /protein_id="ABY33549.1"
FT                   /translation="MTITRFPRMLALLIVMALIVGGLPVRSMYAAGFVVNSLGDTAMPT
FT                   AGDGFCTLREAIASANNAGNGDCGPNSAADDTITFSVSGTITLAAVLPFIAGGAGALTI
FT                   DGGGNIAISGGGSDQVLLINSDANLTLQRLTITNGYSLGFGGGIQNSGTLTVTNSVLSN
FT                   NAAGFGAGIDNTGTLTITNSTFSNNAATTSGGGIYNAGTLTITNSSFSNNAATISGGGI
FT                   SNDTNGTLTITNNTLSNNMADYGAGIYNDTNGTLTITNSTLSNNIASNSGGGMYNSGTL
FT                   TITNSTFSTNQTGAFDGGGIYNQGALTIANSTFSNNIATNGGGIYNANALTVTNSTFEG
FT                   NTVSSSGGGIYNDTVGTLAITNSTFSNNGAPNGGGIGSTGTLTLNNTIIANSFGGDCRG
FT                   SVASADHNLIENTGTNACNLTNGVNGNIIGQDPNLGTLAGTPAYFPLNTDSPAIDKGSN
FT                   AICAAAPVNNQSQNGVTRPQDGNGDSSATCDIGSYELDVTPPTVTSITRADPNPTNAAS
FT                   VSFTVTFSEAVTGVDSNDFSLNPTGGVSGAGITGVSGAGSSYTVTVNTGTGSGTLGLTL
FT                   VDNDSIVDVAGNPLAGLGAGNGNFTGESYTVDKGAPTVTAITRAGPNPTGAASVNFTVT
FT                   FSEAVTGVDSGDFSLTTTDSLSGVGITGVSGSGSSYTVTVNTGTGSGTLRLDVPATATI
FT                   TDPSGNSLSSLPFTTGESYLVRSSFVYLPLVVKAP"
FT   sig_peptide     384353..384436
FT                   /locus_tag="Caur_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.736 at
FT                   residue 28"
FT   gene            388020..390056
FT                   /locus_tag="Caur_0299"
FT   CDS_pept        388020..390056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aba:Acid345_2296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33550"
FT                   /db_xref="GOA:A9WCY1"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCY1"
FT                   /protein_id="ABY33550.1"
FT                   /translation="MPVGAPDTNNGYGSTSQWEVMTNHILRQTRWSAPERSHCCRHEEG
FT                   RQEMVQPLSGCSVAVPVRNLPYPTAQKERRMSNHSGHFFAGRQPTRHRLIGIAGVLLVS
FT                   VILMIGSVQAAPLGTAFTYQGQLQKNGSPYNGTCSFQFSLWDAVSGGAQVGSTLTQTGV
FT                   TVSNGLFTVTLDFGTGVFTGDVRWLQIAVQCSGDSGYTTLSPRHALTAAPYALGLRPGA
FT                   QVIGSVVDASLLVQNTAAGGFGYGVFVQTDSTSSDAAGVMGYAAATSGVTYGVYGRSNS
FT                   PNGTGVYGIHQASSGSAPGIHGVTRSTSNDAVAILGEVPFSSLPGATSTAVRGLNKGTG
FT                   GTGIGVWGSHDGGGWGVYGTSVSGIGVYGRTTTETGISTGVFGETTSTSGRGVYGLAVA
FT                   NTGTTYGVYGGSISPSGTGVYGVATDTSGINYGVRGKSNSSNGYGGYFENTSDGIALYA
FT                   EGNGNGRNKAALRVNNTDTGQGMAAYFTNNSGFHTAHFYNAQSGNVLYLQGSSTGTGDF
FT                   ITAVNNAETNTLFRVTSTGQVQSDVGFSTPAADFAEMLPAVSGLEPGDVLVIGADGRLA
FT                   RSTQPYQATVVGVYSTRPGFIGGQPVDGNLEGHIPLAVVGVVPVKVSTENGPIQPGDLL
FT                   VASATPGHAMRAGTNPPQGTVIGKALEGLDDGTGVIRMLVVLQ"
FT   gene            390067..390357
FT                   /locus_tag="Caur_0300"
FT   CDS_pept        390067..390357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33551"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCY2"
FT                   /protein_id="ABY33551.1"
FT                   /translation="MRGIRRLLVPGLIPLLLLLSALALASSGGPYNLNWWTVDGGGYTV
FT                   STGGSYALGGTVGQSDAGVLSGGSYTLRGGFWGGVEVTYQVWTPLIMRDSP"
FT   sig_peptide     390067..390144
FT                   /locus_tag="Caur_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.949 at
FT                   residue 26"
FT   gene            complement(390570..391142)
FT                   /locus_tag="Caur_0301"
FT   CDS_pept        complement(390570..391142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0301"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: Phosphoesterase
FT                   HXTX; KEGG: deb:DehaBAV1_1257 2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33552"
FT                   /db_xref="GOA:A9WCY3"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCY3"
FT                   /protein_id="ABY33552.1"
FT                   /translation="MSQTPPAEPTLRLFIALELPQPVRDELKRIQQRLQGHSRAARWTD
FT                   PTGMHLTLHFLGETPERLVEPLLTGLRSVSAPALSLTLDRLGCFPANGALRVVWVGLRG
FT                   DLAALATLHRSLATVIQSLGLPTETRPFVPHITLARARPNATAADLRALRTALDTVAPQ
FT                   SLTWQSDSPRLFRSQLTPRGAVYTVLG"
FT   gene            complement(391419..392201)
FT                   /locus_tag="Caur_0302"
FT   CDS_pept        complement(391419..392201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0302"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: rca:Rcas_3717 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33553"
FT                   /db_xref="GOA:A9WCY4"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCY4"
FT                   /protein_id="ABY33553.1"
FT                   /translation="MRVRLLVLIMLLSLTACTAATPVPSPTAIPRLPTVTPEPLSQSTP
FT                   TPRIIRLSESPLPVFTPTPIPTPVISADGITTASMAQLGISAEPYAILGDPNAPVTIIE
FT                   FTDFGCTFCRRHHVLTFPALREEFISSGQVFYVVRQLPVTSPHGDQAALAALCAGEQGK
FT                   YWEMHDQLFAAGDAWYSDATTARRRIIALATDLGLDSAVLQRCMEHPATQATLARHVSE
FT                   AHALRVFGTPTFFINNQLFAGAQPIARWRDVLEGGGRR"
FT   sig_peptide     complement(392142..392201)
FT                   /locus_tag="Caur_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.780 at
FT                   residue 20"
FT   gene            complement(392574..394946)
FT                   /locus_tag="Caur_0303"
FT   CDS_pept        complement(392574..394946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0303"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: rca:Rcas_2557 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: peptidase S16 lon
FT                   domain protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33554"
FT                   /db_xref="GOA:A9WCY5"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCY5"
FT                   /protein_id="ABY33554.1"
FT                   /translation="MNDPNPMQRPPMPEIPDVLPVLPINNAILFPGMFLPLVVSGEAWV
FT                   RLVDEAALSTKIIGVFRRIQSGAEFEPEMLAQTGTAALIVRMMRLPQGGVQLLLQGQAR
FT                   IKVQRWVTVKPYPQAHVTVALDPVDVSMETTGLARAVLAGFQQIVEQSPNLPDELAIAA
FT                   ANAPHPGMLADLIAANLNLNLDDQQKVLDTFDVHERLQLVLRLLEREREILLIGRKAQE
FT                   EVSKNQREYVLRQQLEAIKRELGETDDHAAEIAELRRRIEEANLPAEARQEAERELLRL
FT                   ERMPPGAAEYTVARTYLDWLLDLPWHTSTEDNLDITQARQVLDEDHYDLERIKERIIEY
FT                   LAVRKLRREEGADNEARGPILCFVGPPGVGKTSLGASIARALGRKFVRVALGGVRDEAE
FT                   IRGHRRTYIGALPGRIIQGLSRAKSNNPVLLLDEVDKLSIGFQGDPAAALLEVLDPEQN
FT                   VAFVDRYLDVPFDLSKVLFVCTANRADTIPPALLDRMELLELAGYTEQEKLEIARRYLI
FT                   PRQRREQGMTNRGPELTTAALQRLIREYTHEAGVRDLERRIGAIYRKMATRLASEQTLP
FT                   DQVDAADLDDLLGPPRFRSETILGDNEVGVVTGLAWTPTGGDVLFVEVSVIPGNGQLIL
FT                   TGQLGDVMKESARAALTYARSRASALGIDPEVFQKSDIHIHVPAGAVPKDGPSAGITIA
FT                   SALISALTRREVDKRIAMTGEVTLRGKVLPIGGVKEKLLAAQRAGVRKVLLPTENEIDL
FT                   RDVPAETKEQLEIVLVKHMDEVLHELGLEIAPQPVSE"
FT   gene            complement(394943..395350)
FT                   /locus_tag="Caur_0304"
FT   CDS_pept        complement(394943..395350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0304"
FT                   /product="molecular chaperone (small heat shock
FT                   protein)-like protein"
FT                   /note="KEGG: rrs:RoseRS_2779 molecular chaperone (small
FT                   heat shock protein)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33555"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCY6"
FT                   /protein_id="ABY33555.1"
FT                   /translation="MSDSSYIRILRTRLPYVQFDTRPWTPPLNVFETDREMILVIELAG
FT                   VDPATLQIEAYPELVRIAGARQLTLPTGLRRLHRMEIAAGVFQIEVPFERLIDPEQTSA
FT                   RSVHGLLEIRLPFAGRTLRQVVIPVLEGEQS"
FT   gene            complement(395369..395629)
FT                   /locus_tag="Caur_0305"
FT   CDS_pept        complement(395369..395629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33556"
FT                   /db_xref="GOA:A9WCY7"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCY7"
FT                   /protein_id="ABY33556.1"
FT                   /translation="MPIYSIDFRPFDYLTAELSALWWFYLSQGLALIALGVAVIIWPEL
FT                   LAFLAAAFFIAIGIVLLVLGWRVRQVKRRYELFKRSFIIEA"
FT   gene            complement(395749..396066)
FT                   /locus_tag="Caur_0306"
FT   CDS_pept        complement(395749..396066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33557"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCY8"
FT                   /protein_id="ABY33557.1"
FT                   /translation="MLVRRMSLEELAVAVGLPVPVLQYLTDMGYIHPVPELPAAEFAEL
FT                   RLIRRLINDLEVPSEAVDIILHMRRRMLEMQREIARLRAELAYRRAFEHSRNWIDAEWY
FT                   E"
FT   gene            complement(396085..397275)
FT                   /locus_tag="Caur_0307"
FT   CDS_pept        complement(396085..397275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0307"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: rca:Rcas_1750 2-alkenal reductase; PFAM:
FT                   peptidase S1 and S6 chymotrypsin/Hap; SMART: PDZ/DHR/GLGF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33558"
FT                   /db_xref="GOA:A9WCY9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCY9"
FT                   /protein_id="ABY33558.1"
FT                   /translation="MERQSGRGRWIVLFIELALLVVIAGAFVWTAFTGNRPATIVVAPS
FT                   PTPVVLPAPTVVPLTATDLEAQIAAVYREAGVSVVNITSRSISYDFFFNPVPRQGSGSG
FT                   FFYDDQGHIVTNYHVIADADELQVTLADGQTVPARIVGSDPSNDLAVIKVDLPTATIRP
FT                   LPIGDSTQVYVGQFVLAIGNPFGLERTLTFGIVSALGRVIESPNQRFIGEVIQSDVAIN
FT                   PGNSGGPLLDLSGRVIGVNSAILSPSGANAGIGFAISSRTVQRVVPVLIREGRYPHPSL
FT                   GVRVIELTPQRASLFERAGMQLPVTQGLLIAELITNGPAAQAGLRGPDRLVRVGNLNLP
FT                   VGGDVIVAVNDRPITTSQDLLVYLETETQVGETVQVKIIRDGREQVVPVTLAELQF"
FT   gene            complement(397414..398340)
FT                   /locus_tag="Caur_0308"
FT   CDS_pept        complement(397414..398340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0308"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: rrs:RoseRS_3094
FT                   chaperone DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33559"
FT                   /db_xref="GOA:A9WCZ0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCZ0"
FT                   /protein_id="ABY33559.1"
FT                   /translation="MEFKDYYAILGLSPDADEQAIKQAYRKLARQYHPDVNPGDKKAEE
FT                   RFKEINEAYQALSDPERRRKYDELRSYYQRWQRSGGRGDFNWSQWQAAPGQQVYTYNVS
FT                   PEDLEDLFGADSPFSDFFSSIFGQPQFRRASRAARGRDLEAPVTVSLEEAFSGTTRSLQ
FT                   VGDRRIEARIPRGVRTGTRVRLSGQGAPGIGGGPDGDLYLVVEVAPHPQFERDGDDLTT
FT                   TIAVDAFTAAVGGEVRVPTIDGSVTLKIPPRTQADRVFRLRGKGMPRLENPAERGDLFA
FT                   RVKLVLPEPLSDAELATLRELVRKRQR"
FT   gene            complement(398453..399634)
FT                   /locus_tag="Caur_0309"
FT   CDS_pept        complement(398453..399634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cya:CYA_1262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33560"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR041202"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCZ1"
FT                   /protein_id="ABY33560.1"
FT                   /translation="MIDREAVQQIRADLGALQPPVLSLYVEVDPTRPENERRAWVLRAR
FT                   NAVKALAVPAEVEQVVLAALEAEIAPEARTLALFAAAPATERKSATVAVTKVPLHITLP
FT                   LIDITNGKVEARWGEPYIAPLIYALDQYERTAVVWLRGEGWRFFEVFLGEIVEHTDVFR
FT                   SVEADLWQQVTEFDPRRLRDDLRAQAMGNRDRFARRMENIAARYLQRLAELTERALDHF
FT                   RIRRLVLLGREEATKQFADLLPRSVRQMVIAHVADLPHPDASPAHVLAKVLPALEQVEQ
FT                   SHEQALLEQVTRQPGVWGIDPTLNALQEGRLSVLIAPWQLDAQVWMASNGLLAGSREQI
FT                   ATLVPDGEAQPVALRDVLVDACAAFATRLEFVSGPAQDHLSRDFGGLAGLLRW"
FT   gene            complement(399655..399876)
FT                   /locus_tag="Caur_0310"
FT   CDS_pept        complement(399655..399876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33561"
FT                   /db_xref="GOA:A9WCZ2"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCZ2"
FT                   /protein_id="ABY33561.1"
FT                   /translation="MTELGRWLIGAGVILVVIGLVVLAAGRLPWLGRLPGDILIERDNL
FT                   TIFIPLGTMLVVSLILTVIANLIARWWR"
FT   sig_peptide     complement(399802..399876)
FT                   /locus_tag="Caur_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.872 at
FT                   residue 25"
FT   gene            400127..401062
FT                   /locus_tag="Caur_0311"
FT   CDS_pept        400127..401062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0311"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: rca:Rcas_2987 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33562"
FT                   /db_xref="GOA:A9WCZ3"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCZ3"
FT                   /protein_id="ABY33562.1"
FT                   /translation="MNQNRQPFPTSTMRGWSMSAAVGIVLLIMIAIFVVSNSVTTIEAG
FT                   TRGVLKTFGEITGVLDEGLHFRTPFITSVTVVEVRTQRYESNSSAASRDLQTVTTQVVI
FT                   NYRPDASQVDRLVREIGVDYERRVVDPAIQEALKAATARFTAEELITRRPEVSDLILNI
FT                   LSERLTPRGVIVESVSITDFNFSPEFARAIEAKQVAEQDALRAARELERARIEAQQQVA
FT                   RAEAEAKARLEIARAEAESLRLLGEVVSPQLLQLRFIERWDGILPRLVSGDNGLLTMLS
FT                   IPTDGMLGETPTAQPTPPNSEQPTGTTGGE"
FT   sig_peptide     400127..400243
FT                   /locus_tag="Caur_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.403 at
FT                   residue 39"
FT   gene            401713..403020
FT                   /locus_tag="Caur_0312"
FT   CDS_pept        401713..403020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0312"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   rrs:RoseRS_3086 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33563"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCZ4"
FT                   /protein_id="ABY33563.1"
FT                   /translation="MRRFLFRILALVLIHLLVACGNQQTSSPTLTAVPTNSTAAMTAPT
FT                   ATAIPTVVPTVAPTVAVLEPPTANLTDECVSEFDPEIDYFPEKVTLSDATGWTIEYFNH
FT                   YKVITVLNPWRNADTQFQYILVQCGTPPPPASDNALIIEIPVQRVIAMSTTQLPHLDGL
FT                   GVLDKLIGVDSFLYINNEAVRKKIDAGELVEIGSGGQVNVEQALDLEPDLIMTYGVGNP
FT                   EYDAHPKLLEAGLNVVLNSEYMEGSPLGRAEWIKFTAAFFNQEAKANELYTAIAQRYRD
FT                   IAAKARAVAEKPTVFANAPFRGTWYMPGGKSYVAQLLADAGANYLWADDTSSGSQQLSF
FT                   EEVFERAQNASFWLNPGSAKSLSELQQMDERFTQFAAFQNGAVFNNNKRLNENGGNDYW
FT                   ETGVTNPHLILADLIKIFHPELLPDHELFFYQQLTP"
FT   sig_peptide     401713..401790
FT                   /locus_tag="Caur_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.374 at
FT                   residue 26"
FT   gene            403030..403359
FT                   /locus_tag="Caur_0313"
FT   CDS_pept        403030..403359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0313"
FT                   /product="ferredoxin-like protein"
FT                   /note="KEGG: rrs:RoseRS_3087 ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33564"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCZ5"
FT                   /protein_id="ABY33564.1"
FT                   /translation="MSKPQMNPYVRHIFICTGRYCDPEGTAPQLYAQLAQLLGPLGNYH
FT                   NPCRVKRGTTPCLGVCSAGPIVVIYPEGIWYHHVDKTVLERIVREHLVQNRPVVEHIFH
FT                   QLHEQ"
FT   gene            403374..404462
FT                   /locus_tag="Caur_0314"
FT   CDS_pept        403374..404462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0314"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   rrs:RoseRS_3088 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33565"
FT                   /db_xref="GOA:A9WCZ6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCZ6"
FT                   /protein_id="ABY33565.1"
FT                   /translation="MSMTKTLSAAIQSTRWPRPGLQPLVLLAMVGVTLCIFLLSLSLGS
FT                   VSIPPEQVLSILLYQEAERKSWVTIIYDFRLPKALTAALAGAALGVSGLQMQTLFRNPL
FT                   ADPFVLGISSGASLGVAIVVLSVGAANTALLAVAGLLGNVSLVVAASLGAGMVMMIILT
FT                   LAQRVRSSITLLILGLMIGYVTSAVVSLLLYFSIAERIQAYIAWSFGNFGGVTWSQMQV
FT                   LAPTIGIGLILALLLTKVLNALLLGEAYARSMGMDIQLARCGIVLSSSVLAGTITAFCG
FT                   PIAFLGIAIPHLCRALFRTADHRILLPACMWIGATIALLGDLIAQVPGYSIVLPLNAIN
FT                   ALFGAPIVMWVVLQRYRGVFGL"
FT   sig_peptide     403374..403517
FT                   /locus_tag="Caur_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.723) with cleavage site probability 0.283 at
FT                   residue 48"
FT   gene            404459..405535
FT                   /locus_tag="Caur_0315"
FT   CDS_pept        404459..405535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0315"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rrs:RoseRS_3089 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33566"
FT                   /db_xref="GOA:A9WCZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCZ7"
FT                   /protein_id="ABY33566.1"
FT                   /translation="MSRSILVTEHLRIGYANRRGEARVVADQLNLTLNEGDVVCLLGPN
FT                   GIGKSTLLRTLIGMQAPLAGRVLLDGIDIATLKPRDIARRVSVVLTERIEVGQLSVYHL
FT                   VALGRYPYTNWIGKLTPHDEEVIQRALSAVQAEQLAGRFVHELSDGERQRVMVARALAQ
FT                   EPHVMVLDEPMAFLDLPRRIEMMRLLRRLAHEMRQAVILSIHDLDLAIRTADLLWLMTP
FT                   DGKIQAGAPEDLVLSGAFEKAFAGNNLVFDRFHGQFRLHEPPSRHAVLLGDGLIYKWTM
FT                   HALERAGYQCNQADDTAALHITIHGNEQNPLWLMQLNRQTVKNFHSLRDLVTFLRGMPY
FT                   PYQSQETSDDDHEPIFHR"
FT   gene            405504..406079
FT                   /locus_tag="Caur_0316"
FT   CDS_pept        405504..406079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33567"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCZ8"
FT                   /protein_id="ABY33567.1"
FT                   /translation="MTTTNQSFIVEEPGNGTLEIFPLQPDEAALTALMTELFRDHWDKI
FT                   HFGPLIQGAVFEIKVTQPPQRIGMLDGYLTVDFGVWHFHLCIGEHKGSKTRPVDPELAR
FT                   HRRTGRAEFYRRLNPDGTVGSWGIRLFNGKGENQIYIFLPNPFLTDEMKFRREPDWSRL
FT                   ELWDDLRQRYLGLPPDPKDRSGRTMFHG"
FT   gene            complement(406302..406709)
FT                   /locus_tag="Caur_0317"
FT   CDS_pept        complement(406302..406709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33568"
FT                   /db_xref="UniProtKB/TrEMBL:A9WCZ9"
FT                   /protein_id="ABY33568.1"
FT                   /translation="MCRKLTILARDSATRIVAQCEHGTIHLYWTRAALFLHPAELMPLL
FT                   ALVQCWKPEFDEARSEPFLIIRQPDGSLHLWYHEIGVCLSQSDLYDLAALLWHAAARLK
FT                   LLSPDSSPPPRHPLEPSRPVTCVLPRPEWRN"
FT   gene            complement(406719..407675)
FT                   /locus_tag="Caur_0318"
FT   CDS_pept        complement(406719..407675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0318"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: ana:alr2583
FT                   iron(III) dicitrate transport system substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33569"
FT                   /db_xref="GOA:A9WD00"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD00"
FT                   /protein_id="ABY33569.1"
FT                   /translation="MHRMVLFAILVLLLLSACTSSTSTAQSLEVVSTTDSYRLIRHVFG
FT                   ETQVPLNPSRVLALGEEGLLIDLIDSGMRPVAASVNLPDRVPLLSAEELAGIELFPSAG
FT                   DISLETLSTYQPDFIIGTEFFIDQIGYRQLSQIAPTVALSGATPLTQYIETLTVFGRAE
FT                   EALREVDALRAEIQRVAIARGTATQRVSLVTVYPGMNVALWFDGPSPIPLLVRALGLQI
FT                   RPDPTTTTDLNIRNGRAFISLEQLSMADGDMIFLLQTADVEGEASAVAEMMDHPLWQQL
FT                   PAVQAQRVVELDRIGFPGLRGQRVLLTMLEEILASGT"
FT   sig_peptide     complement(407598..407675)
FT                   /locus_tag="Caur_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 26"
FT   gene            complement(407692..408267)
FT                   /locus_tag="Caur_0319"
FT   CDS_pept        complement(407692..408267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33570"
FT                   /db_xref="GOA:A9WD01"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD01"
FT                   /protein_id="ABY33570.1"
FT                   /translation="MPRLDKSVPTTADPLRWLSRDWLLVGNIGLLSGLLLSGLFWLVLL
FT                   PLVHLWLGVIGLLPLVIGMALIWFPGALAAVAVGKPGAALAVQVPQAIVLLLLTPIDGE
FT                   VLLVCTFFALVAEPVIALCTRYRRLTPARLGWCGLFVGVGMVILFGWLFPFVFTSLPLS
FT                   AMIGCSAVGLTCLLGICAGWIGQRWLKA"
FT   gene            complement(408360..408932)
FT                   /locus_tag="Caur_0320"
FT   CDS_pept        complement(408360..408932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0320"
FT                   /product="flavodoxin"
FT                   /note="TIGRFAM: flavodoxin; PFAM: flavodoxin/nitric oxide
FT                   synthase; KEGG: cyb:CYB_2267 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33571"
FT                   /db_xref="GOA:A9WD02"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD02"
FT                   /protein_id="ABY33571.1"
FT                   /translation="MIAVVYGSSTDNTKGAASLIADMLRAKTTVPVDLIDVATVKRDLR
FT                   PLLRYWVWIIGCPTWNIGELQDDWYDAFPLLDQLDLQGTIVALFGFGDQQGYPDTFQDA
FT                   LGILGRKVRERGAMIIGRWPIDGYDFFHSLGVEDGMFFGLALDYENEDEKTIARLQAWV
FT                   DQLLSELAAHPEGIVRRDVSGTHLIHP"
FT   gene            409856..410476
FT                   /locus_tag="Caur_0321"
FT   CDS_pept        409856..410476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0321"
FT                   /product="restriction endonuclease R XbaI"
FT                   /note="KEGG: bcl:ABC0821 restriction endonuclease R XbaI"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33572"
FT                   /db_xref="GOA:A9WD03"
FT                   /db_xref="InterPro:IPR019036"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD03"
FT                   /protein_id="ABY33572.1"
FT                   /translation="MESVTDKIRSLASKYAQELQHKIETRTKELESDDQSHYLIYKVLG
FT                   IQDDEGRLIDLYQNKGRFLYKYAGAFLEEATFLCFKERFPHARRAQVENTSGQRPRQFH
FT                   IDCLIDREAIEIKWRDATTDGDHIIKEHARIKVIKDHGFYPVRVMFFYPNREQAKRIQE
FT                   TIKTVYQGIGGACYTGDDAWEYVRTRTGIDLKVILVNIAKDLQ"
FT   gene            410488..411690
FT                   /locus_tag="Caur_0322"
FT   CDS_pept        410488..411690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0322"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   bcl:ABC0822 adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33573"
FT                   /db_xref="GOA:A9WD04"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD04"
FT                   /protein_id="ABY33573.1"
FT                   /translation="MTVLCGDCRIVLQSINDSSIDLVYMDPPFFTQKTHALVNRDGNAS
FT                   YSFEDTWESIETYLAFMREVLIQCKRVLKDTGSIFVHCDRSASHHLRVLLDQIFGPEHF
FT                   QSEIIWTYRRWSNSKKGLLPAHQTIYFYSKTENFKFNVLFTDYSPTTNIDQILQARARN
FT                   EKGKSVYRRDQHGNIVAGKEKKGVPLSDVWYIPFLNPKAKERVGYPTQKPVLLLERIIK
FT                   IATDSGDSVLDPFCGSGTTLVAAKLLGRTYIGIDISREAVSLSEERLRQPIKSESQLLV
FT                   VGEEGFRMKSNYERNLLKALDAVPVERNSGIDGFLFIDEQPIPVRIQKDDEDIATARQK
FT                   LKAASRAKQCSSMILIRTKTENNLCLFETEDDDVLVIDAYDLIIRSWLHKRKYRKKTTV
FT                   S"
FT   gene            complement(412364..413473)
FT                   /locus_tag="Caur_0323"
FT   CDS_pept        complement(412364..413473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0323"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: hma:rrnAC0908
FT                   spermidine/putrescine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33574"
FT                   /db_xref="GOA:A9WD05"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD05"
FT                   /protein_id="ABY33574.1"
FT                   /translation="MNFSAEPALQLQNVTRRYGKVVAVNNVSLAAAQGECLVIVGPSGC
FT                   GKTTLLRLIAGLDVQDEGSIKIQNRIVSGKGVFVPPEKRRVGLVFQDYALFPHMTIARN
FT                   VAFGLHGRSKADVQRRVYEMLEMVHLAHMADRYPHELSGGERQRVALARALAPQPDILL
FT                   LDEPFSSLDAGLRTAMREQLQSLLKEINITTFFVTHDQEEALLLGNRVAVVNQGRIEQI
FT                   GTPEQVFHQPATHFVAEFFGYTVFISGRATADGLETELGFLPQRLSLDSGAEVNILVRP
FT                   DDLTVYPDETGQAYIARTGFQGMHCMYQIALPSGRTIYSLMPHTRIYAPGTRVRVELHP
FT                   GHDLVCFRNGRAVTDVGRGEGVEEIENRR"
FT   gene            complement(413496..415220)
FT                   /locus_tag="Caur_0324"
FT   CDS_pept        complement(413496..415220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0324"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hha:Hhal_1189
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33575"
FT                   /db_xref="GOA:A9WD06"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD06"
FT                   /protein_id="ABY33575.1"
FT                   /translation="MRSMIVPLTRRYWNVMLIKRQQLAGNWSLPDRWSIIAFLIAGLAL
FT                   LPIAIILRMLVQPAPDVWQHLWATRLAEFLSNTVVLLIRVGLGTTLLGTALAWLVTAYR
FT                   FPGQRLFDWALMLPMAVPSYVLAFVFMATFDYAGPVQKALRAWFGSSAWFPSIRSGGGA
FT                   IFVMTLTLYPYVYLLARAAFHEHGRGTFEVARTLGVTRLQAFLRVVLPMARPSLVAGLS
FT                   LVLMEVLTDVGTVRFLNFPTLSDGIFRIWHGMMDRDAALQSAAVLLLFAFGALLIERYT
FT                   RGRARYVQEGSRGHGLAQVPLTGWRALAATLVCSFVLATAFLLPVSQLIQWSVHELWHR
FT                   MPEGLLAIYWRHVRATLILAGAGAVISVLAAVLLAYGTHLSRSPVTRLAARGATLGYAI
FT                   PGAVIGLGVLLPLSWLDHTLNDVTYQWWGVLPGLIFTGSITGLIYAYVVRFMAVAHSSV
FT                   EASLEKISPGIEAAARTLGARPIRVLWHVHLPLIRAGMLTGAALVFVDVMKELPITLLL
FT                   RPFGYETLALWIWQNVAESLWSEAALPALTIVVADLLVVGILIRSATLRGRHSIERT"
FT   gene            complement(415261..416391)
FT                   /locus_tag="Caur_0325"
FT   CDS_pept        complement(415261..416391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0325"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: nmu:Nmul_A0732 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33576"
FT                   /db_xref="GOA:A9WD07"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD07"
FT                   /protein_id="ABY33576.1"
FT                   /translation="MLFTRRKKAGITLVGFILLVVSLVACTNQSASQTAPQTIRETVVV
FT                   TQEVPVRETVVVRETVEVPVEEPIVYVYSARHYGQMETAFAEFTKETGIEVRFTFGSDA
FT                   ELRERLKAEGRFTPADVLFTVDAANLWLAAQEGLLRPINSDVLESNIPDYLQDPSNQWY
FT                   ALSLRVRTIAYHPDRVNPEEIATYESLADPKWAGRICWRPSTKSYTQSLVSSLIVHHGY
FT                   DKAKEIVTGWAQNAKEYIDSDTRILQTIAEGGCDISVVNHYYLARLLSEDANYPVKLLW
FT                   ANQAEQGVHVNASGAGVTTYARHPENAIRLLEWLSTERGQRLFADSNFEYPANPNVAPH
FT                   ELIQQWGDFKRDTLQISEIGSLQADAIKLMNEAGYQ"
FT   sig_peptide     complement(416296..416391)
FT                   /locus_tag="Caur_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.310 at
FT                   residue 32"
FT   gene            complement(416608..417420)
FT                   /locus_tag="Caur_0326"
FT   CDS_pept        complement(416608..417420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33577"
FT                   /db_xref="GOA:A9WD08"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD08"
FT                   /protein_id="ABY33577.1"
FT                   /translation="MQQHNSAATTKPAPVRLRPIALPIEHGGWSMVGAPIALGLWLAPS
FT                   PAGFWLSLAALGAFLGRQPLKLAISDYRRGKRYPRTVWAERFVLGYGAITLIAVGMAWW
FT                   YAAFSFWPPIILAVPFAVVQLFFDLRKQSRALLAELAGAIAISALAAVIVMAAGWTLWS
FT                   ALGLWLLLSLQAVTAIVYVRIRLRLARNEPAHRAPALILHLAALVTVAGLLSIGWVSWP
FT                   VLLVFALLFMRCWIGLSPRSLATPTPLVGVQEVIVALLVVVGIRFGLS"
FT   gene            complement(417462..417782)
FT                   /locus_tag="Caur_0327"
FT   CDS_pept        complement(417462..417782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0327"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   rca:Rcas_0816 cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33578"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD09"
FT                   /protein_id="ABY33578.1"
FT                   /translation="MNPATVRHVLEQISIPDDSTISRTIYQDDQIKAVLFGFAAGQELS
FT                   EHTAATPAIMHFVQGEARVTLGQEVVEAKPGTWVHMPAHLPHSIQAHTPVIMLLLLLRG
FT                   TR"
FT   gene            419279..420406
FT                   /locus_tag="Caur_0328"
FT   CDS_pept        419279..420406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0328"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   afw:Anae109_2393 homocitrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33579"
FT                   /db_xref="GOA:A9WD10"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD10"
FT                   /protein_id="ABY33579.1"
FT                   /translation="MSLPERLFFVDTTLREGEQFASARFTTAQRIAIAEMLDAFGVEYI
FT                   ELTSPAASPQSARDLATIARRGLRARILTHIRCHMADARLAVEHGAQGANLLFATSEPL
FT                   RTVSHGRSLSEILAEAKRVICYLRDHDIEVRFSCEDSFRTDLADLIRIYRAVETMGVQR
FT                   VGLADTVGIATPRQVYDVVRAVRNEVQCDIEFHGHNDSGCAIANTFSAYEAGATHLDVT
FT                   VLGIGERNGIASLSGMIARIASIDPSRVQRYRLDLLPKIDETVATMLGIEIPFNQCITS
FT                   PTAFHHKAGMHTKAVLSDPRSYEVLDPNLFGRQRTIAIAHRLVGWHAVAERARELGITL
FT                   SEAQARAAAARIKALGDEHDLDGAMIDEILYSYAE"
FT   gene            420422..421678
FT                   /locus_tag="Caur_0329"
FT   CDS_pept        420422..421678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0329"
FT                   /product="3-isopropylmalate dehydratase"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: rca:Rcas_3474 homoaconitate hydratase family
FT                   protein; TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33580"
FT                   /db_xref="GOA:A9WD11"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD11"
FT                   /protein_id="ABY33580.1"
FT                   /translation="MPTMSEQILSRVAGRTVRAGDVVTANVDLVMVHDSLAPGIIRILH
FT                   QELGAERVWDPQRVAVVIDHVAPAASVQTAEKQQEVRRWVRAQGIPHLFDVGRGISHPV
FT                   LVEEGLAQPGMLILGSDSHSTAYGCVGAFGTGMGSTDIALALATGKTWLRVPETIVVRA
FT                   RGRFGFGVGPKDLALRAARLLRADGATYAAIEWHGVEFLSVMERMTLATLSIEMGAKAG
FT                   IVPPTGLNVTGPLLPTVTADAGYQEVVEIDLDQLEPQVSAPHYVDNVANLSDLGRVAVD
FT                   VVYLGTCTNGHYEDMAVAAQILAGRRLAPGVRMIVVPASAQALQRAAADGTLATLLAAG
FT                   ATIGTPGCGACIGRHMGVLAPGEVCLFTGNRNFRGRMGSPEAQIYLASPAVAAATALTG
FT                   YLTDPRTVMDGQPAIASRN"
FT   gene            421701..422201
FT                   /locus_tag="Caur_0330"
FT   CDS_pept        421701..422201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0330"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   rrs:RoseRS_1056 3-isopropylmalate dehydratase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33581"
FT                   /db_xref="GOA:A9WD12"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD12"
FT                   /protein_id="ABY33581.1"
FT                   /translation="MARVWLFGPDINTDQIVPGRYAPYMLKDESELRRYPFIEHRPDFA
FT                   ANVRPGDIIVAGKNFGCGSSREYAPLALRMVGIGAIIAPLFARIFFRNALNLGIPCFTA
FT                   DLTGELADGDEVELDLEQGRITTADGRVIHLPPPPLFLREVWAAGGIVPFYRTYGRFPG
FT                   EVA"
FT   gene            422201..423199
FT                   /locus_tag="Caur_0331"
FT   CDS_pept        422201..423199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0331"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="PFAM: isocitrate/isopropylmalate dehydrogenase;
FT                   KEGG: rrs:RoseRS_1057 3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33582"
FT                   /db_xref="GOA:A9WD13"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD13"
FT                   /protein_id="ABY33582.1"
FT                   /translation="MQICVIPGDGIGPEVIAVATAALRVLAPDLTIKEAEAGWAVFQRT
FT                   GTALPETTLALAREATAILFGAVASPSHPVPGYRSPIVELRRTLDLYANIRPTVGNEVD
FT                   LVVVRENTEDLYIGRERLEDDGATAIAERVITRAASARIVRTACELARTRQAYGHPGKV
FT                   TIVHKANVLRVSDGLFRTVALEVAADYPELTFEERLVDVAAMQLAAQPQRFDVIVTTNM
FT                   FGDILSDIACIHGGGLGVAASSNLGHGRALFEPVHGAAPDIAGRGIANPTAALNCVVML
FT                   LDWIGRPHAAERLRSAITAVAAAGIRTPDVGGQATTREVADEILNQLSAQM"
FT   gene            423214..423381
FT                   /locus_tag="Caur_0332"
FT   CDS_pept        423214..423381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0332"
FT                   /product="lysine biosynthesis protein LysW"
FT                   /note="TIGRFAM: lysine biosynthesis protein LysW; KEGG:
FT                   rca:Rcas_3470 lysine biosynthesis protein LysW"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33583"
FT                   /db_xref="InterPro:IPR005906"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD14"
FT                   /protein_id="ABY33583.1"
FT                   /translation="MHAECPECVAQITLPASTLESEIVACPDCGAELEVVSLNPPTLAL
FT                   APEVEEDWGE"
FT   gene            423425..423592
FT                   /locus_tag="Caur_0333"
FT   CDS_pept        423425..423592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0333"
FT                   /product="lysine biosynthesis protein LysW"
FT                   /note="TIGRFAM: lysine biosynthesis protein LysW; KEGG:
FT                   rca:Rcas_3470 lysine biosynthesis protein LysW"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33584"
FT                   /db_xref="InterPro:IPR005906"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD15"
FT                   /protein_id="ABY33584.1"
FT                   /translation="MQAECPECGATIALPAGTMANEIVACPDCGAELEVVNLDPPTLAL
FT                   APEVEEDWGE"
FT   gene            423655..424503
FT                   /locus_tag="Caur_0334"
FT   CDS_pept        423655..424503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0334"
FT                   /product="lysine biosynthesis enzyme LysX"
FT                   /note="TIGRFAM: alpha-L-glutamate ligase, RimK family;
FT                   lysine biosynthesis enzyme LysX; PFAM: ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp; protein
FT                   of unknown function DUF201; RimK domain protein ATP-grasp;
FT                   KEGG: rca:Rcas_3469 lysine biosynthesis enzyme LysX"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33585"
FT                   /db_xref="GOA:A9WD16"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011870"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD16"
FT                   /protein_id="ABY33585.1"
FT                   /translation="MRIAVLCSRIRAEEKLLFQELERRGLDYVKVDDREQIFDLHTTTY
FT                   PFDVVLERCIQHSRALYMLKIFNDAGVPTVNTYHVALTCGDKFLTTQALIHAGVPTPRC
FT                   LLAFTPESALEAMEQLGYPVVLKPVIGSWGRMVSKINDRDAAEAILEHRDVLGNYQHSI
FT                   FYIQQYIHKPGRDIRSFVIGDECIAAIYRTSPHWITNTARGGVATNCPVTPELADISVR
FT                   AAHAVGGGVVAIDLLETPEGELLVNEVNYTMEFRNSIDTTGVDIPARIIDYVLEVGRGR
FT                   G"
FT   gene            424633..425667
FT                   /locus_tag="Caur_0335"
FT   CDS_pept        424633..425667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0335"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: rrs:RoseRS_1060
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33586"
FT                   /db_xref="GOA:A9WD17"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037535"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD17"
FT                   /protein_id="ABY33586.1"
FT                   /translation="MSLRVSIVGASGYVGGELLRLLLDHPHVSIIQATSARNAGRYLYQ
FT                   VHPNLRGRTNLQFVHPDTLQPCDVLFLALPHGEAAQAIERYASLAERIIDCSADFRLRD
FT                   PAVYQQWYGSAHPAPAWLERFVYGLPEVNRAALTGARYASGVGCNATATNLALLPLVEA
FT                   NLIDRSRPIIADVKVGSSEGGATVNEASHHPERSGAVRSFAPVGHRHLAEVEQVTGLRN
FT                   VHLSITAIELVRGALATVHAFASRELSEKELWQAYRTFAREQPFIRIVKERQGIYRYPE
FT                   PKILAGTNYADIGFAYEPATGRIVSICAIDNLMKGAAGSAVQCMNLMCGFAETTALTFA
FT                   GLHP"
FT   gene            complement(425782..426054)
FT                   /locus_tag="Caur_0336"
FT   CDS_pept        complement(425782..426054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33587"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD18"
FT                   /protein_id="ABY33587.1"
FT                   /translation="MEGYVRQRIEVLTARLNSLRPGLERARQSVARLENEAVPAGATAL
FT                   ARAAQLSAARAMATTLAERERHLLIAIQALQAELADQTLTGHEQE"
FT   gene            complement(427180..428205)
FT                   /locus_tag="Caur_0337"
FT   CDS_pept        complement(427180..428205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0337"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: rrs:RoseRS_3855 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33588"
FT                   /db_xref="GOA:A9WD19"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD19"
FT                   /protein_id="ABY33588.1"
FT                   /translation="MSQRAPVRGSMTSRLSLVGGFILLLIIVGIGLSTMKYVQVDEGQA
FT                   AIELVQGRIVAVHGPGPIFRPFAPFTEIELVNIRRQSRQISQNVASSDKQLYDIDIQVD
FT                   FRRLPTEQALRAAYAEIGVSDAQLNDFLDGFINDALKSASTQFTLDEALSDRGAFAERI
FT                   RRFLTTPPGDGQRAPVDQLYITIEAVKVLDIKVGETYAQLLAEKANLEVQIETEQKRRQ
FT                   QIEAQQANNLFQAEQEALVALTRERGITAAALEAANREAQVRAIEGRYWRENPELFELR
FT                   KRELLVQMMANGNIWFVDPNTNLTLLLNNQAGEGQALVIPQPGAGQSVTPPAPTEPSVS
FT                   P"
FT   gene            complement(428220..429239)
FT                   /locus_tag="Caur_0338"
FT   CDS_pept        complement(428220..429239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0338"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rca:Rcas_1513 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33589"
FT                   /db_xref="GOA:A9WD20"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD20"
FT                   /protein_id="ABY33589.1"
FT                   /translation="MVKQQPTFSVVAPVYNEEQLIAEFCRRVIAALEPLGEPFELVLVN
FT                   DGCRDRSPEIMRELHQRDPRIKVINFSRNFGHQIAITAGTDYATGKAVIVIDSDLQDPP
FT                   EVIPELIARWREGYQVVYGVREEREGETWFKKTTAAIFYRLIVRITNVNIPVDTGDFRL
FT                   MDRKVVDALKRMREHHRFMRGLSAWIGFRQTGVPYRRHARAAGTTKYPLRKMLRFALDG
FT                   ITSFSYLPLQLATYLGFIVAAISMIFLLVVFVMRLADPSAPEPAFYGQASTLASVLFLG
FT                   AVQLISLGIIGEYVGRIYDEVKGRPLYIVAEALGVEEEPATSPASVRTTHMEQSTSVK"
FT   gene            429574..431100
FT                   /locus_tag="Caur_0339"
FT   CDS_pept        429574..431100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0339"
FT                   /product="DNA mismatch repair protein MutS domain protein"
FT                   /note="PFAM: DNA mismatch repair protein MutS domain
FT                   protein; KEGG: ace:Acel_0734 DNA mismatch repair protein
FT                   MutS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33590"
FT                   /db_xref="GOA:A9WD21"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD21"
FT                   /protein_id="ABY33590.1"
FT                   /translation="MVSLSILHYHDGLQTEATSQPDFFPDLNLDQVVEAITKPGQEYNL
FT                   QPFFWTPLRDAQAVRYRQEVFQDLEKAPILEAIKQFAEGMRVVRRYLAMMEQLNFADHR
FT                   KGWLLEAALVYCDTVTTLARHLVDLPLRSNGLSTFREHLTTCIQSPAFRSLATDSQHVK
FT                   NALAAIKYSVIIESGKFSVKRYEGEVDYSSEVEHVFSKFKQRDAQDYLVHLPERAGMSH
FT                   IEAKILEFVARLYPEPFEELDRFCTEHNQFLDETIRTFDREIQFYVAYLEYIADLKRQG
FT                   LPFCYPHVSATSKAVYVRDGFDLALAHAWRYEQKTITLNDFFLTGPERILVVTGPNQGG
FT                   KTTFARMFGQLHYLASLGCPVPGREAGLFLADRIFTHFERIEDSQNLRGKLEDDLVRMH
FT                   RALIQATPDSIFILNEIFSSTTVQDALFLSKEIMARLTDLDVLGVWVTFLDELASLSEK
FT                   MVSMVASVDPNDPVRRTFQIIRKPADGLAYALSLARKHGLSREQLQERIR"
FT   gene            431097..432614
FT                   /locus_tag="Caur_0340"
FT   CDS_pept        431097..432614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0340"
FT                   /product="DNA mismatch repair protein MutS domain protein"
FT                   /note="PFAM: DNA mismatch repair protein MutS domain
FT                   protein; KEGG: tpt:Tpet_1786 DNA mismatch repair protein
FT                   MutS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33591"
FT                   /db_xref="GOA:A9WD22"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD22"
FT                   /protein_id="ABY33591.1"
FT                   /translation="MMKVFLLHPDQDFDPSTPLLPNVDDLTQDLSLNILFKAMARGDTF
FT                   LFQVVRQVVLSPLDESASILYRQEILKDCLKYPDVVRQMYLIPLTFLERKHKRWLWISL
FT                   RHSTPTSILSSARELLAASLDLLRQLRLIADQHVNTFESQGFRRFFTMIQRELDDDYLN
FT                   LVEKHVQQLRFSRGTLLSAQPGKGNEGSNYVLCYPNDADQHWLQRMLTSHSPTYSYTLH
FT                   PRDEAGARILEELRDRGLARAANAVGQAAEHIESFFRVLQWELAFYIGCLNLYEQLTAL
FT                   GKPVTFPQPVPAHERRLSCAELYDVTLALTLGSSVVGNDISADGKSLIIVTGPNRGGKT
FT                   VFLRSVGVAQLMMQCGMFVPAESFLANLTTGLFTHFKREEDKTMERGKFEEELARMSVI
FT                   VDYLTPNALLLLNESFSATNEREGSEIARQIVSTLIEKGIKVYFVTHLYEFTRSFNGDN
FT                   ILFLRAERLPDGERTFRLKEADPLKTSYSVDLYYRIFGTEQQQEMTD"
FT   gene            complement(433144..435972)
FT                   /locus_tag="Caur_0341"
FT   CDS_pept        complement(433144..435972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0341"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rrs:RoseRS_3415 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33592"
FT                   /db_xref="GOA:O08307"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08307"
FT                   /protein_id="ABY33592.1"
FT                   /translation="MAYPLLVLVDGHALAYRAFFALRESGLRSSRGEPTYAVFGFAQIL
FT                   LTALAEYRPDYAAVAFDVGRTFRDDLYAEYKAGRAETPEEFYPQFERIKQLVQALNIPI
FT                   YTAEGYEADDVIGTLARQATERGVDTIILTGDSDVLQLVNDHVRVALANPYGGKTSVTL
FT                   YDLEQVRKRYDGLEPDQLADLRGLKGDTSDNIPGVRGIGEKGAIALLKQFRSLDALLEQ
FT                   IDAAPKRYQTLLREQAEAARFSRQLATIVTDVPVQLDLEAARIGVYDRSAVMALFQELE
FT                   FGVSSNLIKKLPSVVQAPTLAELPADLPAAPLTTAPTQLSLFAGESEPAQPTAEPPPVT
FT                   IVRDATALADLVSRLRNAPAFAFDTECTSLQPVASDLVGISIAIAPDTVCYIPVGHQSE
FT                   TQVPCGEVVTALAPFFANPQQPKFAHNAKFDMEVLAGAGIKVSGLAFDTMIAAAMLGKR
FT                   QGLKDLAFYELKLPEPPTTIEDLIGRGNKQISFAEVPVEQAAPYAAADALYTLRLTERL
FT                   QRQLEAEPALHDLYYRVELPLIEVLTDMELTGIRLDQEYLRELGRHFAQRIADLVERIY
FT                   QQAGGPFNINSGQQLNDVLFGRLGIDPRAHGLSKLKSGGYSITAEVLEELSQLYPIAAD
FT                   ILTYRQLTKLKSTYIDALPDLVNPRTGRIHTSYNQLGAATGRLSSNNPNLQNIPVRTEE
FT                   GREIRRAFVAEPGWRFVAADYSQIELRVLAHMSGDENLIAAFQQGLDIHAATASRLFGV
FT                   EPTAVDKNQRRVAKTVVFGVIYGISAFGLAQRLGIERDLARQLIDNLFAQFPGIRRYID
FT                   QTLEFGRQHGYVQTLFGRRRVMEDLRASGARRAAAEREAINAPIQGTAADLMKMAMVNV
FT                   HRALREQGLRTRLLLQVHDELIAEAPEDEVEPAARLLRDVMSSVYRDLVVPLSVNLEVG
FT                   PNWDEMSPLAMG"
FT   gene            436119..437177
FT                   /locus_tag="Caur_0342"
FT   CDS_pept        436119..437177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0342"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   rrs:RoseRS_3190 histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33593"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD24"
FT                   /protein_id="ABY33593.1"
FT                   /translation="MTTAIVTDQRFDLHTWHGHVEQAERLHAIRRAIEVDGLWPRLLQL
FT                   PIRPATEAELLAVHSSSMLHRVRQLASYGGGQIDSDTYVTAESWDVALLAAGATICMAE
FT                   ALVSGRCHNAFALVRPPGHHATDIRSMGFCLFNNIAVAARVLLDRHHLRRIAIVDFDVH
FT                   HGNGTQDIFYRDGRVLFCSIHAAPLYPGTGSLHEMGDPRTAGGTTLNVPLPYGTGDHGY
FT                   EQVFQRVIGPVLRRFQPEIILVSAGFDAHWSDPIGPMALSIQGFARIVQHLCDWADELC
FT                   DGRIGFVLEGGYSLPALAAGVVTTLRLLLGMPAGSDPMGKMNAPEPAIEHIITSLYTYH
FT                   PLLMQTTYQGEA"
FT   gene            437174..437812
FT                   /locus_tag="Caur_0343"
FT   CDS_pept        437174..437812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0343"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: rca:Rcas_2919 imidazole
FT                   glycerol phosphate synthase, glutamine amidotransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33594"
FT                   /db_xref="GOA:A9WD25"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WD25"
FT                   /protein_id="ABY33594.1"
FT                   /translation="MIAVINYGAGNLPNVVRALQRVGATLTVTDNPEVIRSAQAVVLPG
FT                   VGATADTMASLRHLGIAEVLPAVIAASTPFLGICVGMQVLLSESEEFGLHSCLDIIPGT
FT                   VRRLPEHAGKIPQIGWNQLQISPTFRNHPLFADIPDGADVYFVHSYYCAVADEAIIAAR
FT                   TDYGIPFPSVIIRDHLAAVQFHPEKSGDYGLRLLANFVRWSEAVQPKGV"
FT   gene            437815..438540
FT                   /locus_tag="Caur_0344"
FT   CDS_pept        437815..438540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0344"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein; KEGG: rca:Rcas_2920
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33595"
FT                   /db_xref="GOA:A9WD26"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WD26"
FT                   /protein_id="ABY33595.1"
FT                   /translation="MEIIPAIDIKDGRCVRLYQGDFAQMTVYADDPVAVARSWEAQGAT
FT                   RLHLVDLDGARAGHPQNVDAILAITQAVQIPVQLGGGLRREQDVESALALGVERVIIGT
FT                   AAIAETDLVARLLDRFGEQIVIGIDARNGLVATDGWTVTSSVKATVLAEQMANLGARRI
FT                   IYTDISRDGALSGPNFAALSELITPHGPAIIASGGIASIDHVRQLAQLGVEGAIIGKAL
FT                   YVGAVKLAEAMAVAHMTNV"
FT   gene            438609..439706
FT                   /locus_tag="Caur_0345"
FT   CDS_pept        438609..439706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33596"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD27"
FT                   /protein_id="ABY33596.1"
FT                   /translation="MSNSDLTARYEEERLRAQEQSQLVYLQGQIDELRRLLKDQTNKYQ
FT                   WAMEQIRKNEGTIAQIQSLFDRHTGEVAQANEIVRRDVVALRREVATALVKIEDGLRPI
FT                   RDMQAQIQQVAEARKQDRDFLAGWLSRIEQVERQIATLSSQVKELDERQRQLTLQLERL
FT                   READAAVMQEVRRFGDDLQVEKQSMRRMAVEAQQFVADLQPVVEEQRSRIDRLEEIRQH
FT                   IDLFTEMLPAQIKELSAKIPDLMAEMKRIERISTERFLMNQERLEELRQMADERMSTLQ
FT                   ETDEQYLRQMTAWLERIDSWLRELEQRLSRTTDRLELEQKAHLLRIMELERREADTLNA
FT                   QLNLLRQRLELVRAAQIESGGGNAG"
FT   gene            complement(440235..441263)
FT                   /locus_tag="Caur_0346"
FT   CDS_pept        complement(440235..441263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0346"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; Methyltransferase type
FT                   11; KEGG: rrs:RoseRS_2276 putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33597"
FT                   /db_xref="GOA:A9WD28"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD28"
FT                   /protein_id="ABY33597.1"
FT                   /translation="MSHQIEIVVPAGLEELARAEALRITGLRLEPLTERGVIRATMHGS
FT                   LQALFDLRSVISVFVVRRFAIPRPRALLGDEHFRAVVAMLEMVRRLHPAGTFQTLFLSA
FT                   AGADSSVLQRFKQMIGERLGLAIGTEDGDMLIRLRPSRDRSGWDVLVRLTPRPLATRSW
FT                   RVCNREGALNGPVAHAMAVLSKPHAGDRVLNVGCGSGTLLIERLLITTAAQAIGCDTDP
FT                   TALACAWRNLGAAGLSKRVELYDWDACQLPLPSASIDVVLADLPFGHLVGSHTTNLTLY
FT                   PALLAEAARVTRPGGRAVLISHEVRLMERSLATLPQWRVDQQLRVDLGGLYPRIFVLRR
FT                   TG"
FT   gene            441394..442665
FT                   /locus_tag="Caur_0347"
FT   CDS_pept        441394..442665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33598"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A9WD29"
FT                   /protein_id="ABY33598.1"
FT                   /translation="MDIGITIWPPMPAQPQALPASWSSYDHGALREFLQRAHDVGLRQV
FT                   RFDLRWAEVQPGTQRISVAALNGFQRGLDLAQANHIQVVVSLMSATLGPTLHLPDWALG
FT                   IPTQALSTQAVSALLSAPTLTILDNSFYRQEPVRDLYTDPDMRAAQRYLLREVIGNFAD
FT                   HPAISGWLLAAGFERVRPPTDHRDMAAWWADLAEQARSYGAERLFGHIDATALSSRVSL
FT                   RPYDIAMAGGAVVVSVGPWPPLGDGPPARGEAACFLHAIVAGLLAEEVNDTAAAQVVVA
FT                   DLGWPTAPRANLSGWQADQVFAQPAHTFLADEEAAASALQESLTTLARAGAAAVWLAGM
FT                   VDPPESQWNIPPFDRSWIARTWGLWTADGREKAGWEALREAIRQLPATARLPGFPIDPE
FT                   RFWRDPANELRRLWREYRTETLPS"
FT   gene            complement(442830..443591)
FT                   /locus_tag="Caur_0348"
FT   CDS_pept        complement(442830..443591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0348"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="KEGG: rca:Rcas_1332 tRNA
FT                   (guanine-N1)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33599"
FT                   /db_xref="GOA:A9WDJ3"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WDJ3"
FT                   /protein_id="ABY33599.1"
FT                   /translation="MRFDILTLFPAMFQGPLTESILKRAQQAGRIEIHLHDIRQWTTDR
FT                   HRTADDTPYGGGAGMVMKAEPLAAAIRAVRAADERPGVTILLTPDGELLTQQIVRELAT
FT                   LPRLLLVCGHYEGIDERVRETLIDRELSIGDYVLTGGELAAMVVVDAVARLVPGVIDSE
FT                   SIVEESHSDFLLEYPHYTRPAVWEGRAVPPVLLSGHHGEIARWRRAERLRRTLVRRPDL
FT                   LARAAAAGVLTKADLALLAELGWRPETSNGA"
FT   gene            complement(443597..444508)
FT                   /locus_tag="Caur_0349"
FT   CDS_pept        complement(443597..444508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0349"
FT                   /product="alpha/beta hydrolase fold-containing protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rxy:Rxyl_2331
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33600"
FT                   /db_xref="GOA:A9WDJ4"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDJ4"
FT                   /protein_id="ABY33600.1"
FT                   /translation="MAVKPGWSLLPMALAGAFSLLGGITAYYVSLRVSPSPRRTYLDSY
FT                   TFTPWELEVPYETVEFRSSDGLRLVGWWLPRPETNAVIVGSHGHAGRKDELLGIGSYCW
FT                   RAGYNVLLFDYRGRGESDPWPQTLVSREVDDLLAALQYVRQRMPEAAIGVIGYSMGAAV
FT                   GILATARDQSVRALVADSSFTTGDEVVADAVEKVLRVPLRPLVHLADIIVAWRHGYRFS
FT                   QARPIDAIGQIAPRPVFLIHGVDDSLVPVCHVRQLYAAAREPRLVWEIPGAEHCGGYFV
FT                   DRVGYCRRVVEFFDQYLRSVEA"
FT   sig_peptide     complement(444440..444508)
FT                   /locus_tag="Caur_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.865 at
FT                   residue 23"
FT   gene            complement(444518..445105)
FT                   /locus_tag="Caur_0350"
FT   CDS_pept        complement(444518..445105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0350"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rca:Rcas_2087 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33601"
FT                   /db_xref="GOA:A9WDJ5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDJ5"
FT                   /protein_id="ABY33601.1"
FT                   /translation="MNDQPVCQDIPTTITTRDGRTLRVRSLAASDAVLLERMFYRLSPE
FT                   TIYRRFFIAAEHASPELVHKSAKRLAAINPRREAALVALADEQGSEEAIAVARFARLPH
FT                   NPKVAEASILVRDDYQGTGVGRKLLALLLAEARAAGLERLIFLTHADNTPMIRLAMGLG
FT                   LPFQGRHADGLYEIHVLLEPQSTTKFEFVRNE"
FT   gene            445343..446233
FT                   /locus_tag="Caur_0351"
FT   CDS_pept        445343..446233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0351"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="KEGG: rca:Rcas_4310 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33602"
FT                   /db_xref="GOA:A9WDJ6"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WDJ6"
FT                   /protein_id="ABY33602.1"
FT                   /translation="MEELIAIVGPTAVGKTELAVAWARRINGEIVSADSRQIYRWMDIG
FT                   TAKPSPEEQAQAPHHLIDIRDPDQPFSLAEFCDLATAAIADIRGRGRIPLLVGGTGQYL
FT                   AAFLEGWQVPRVAPQPDLRAELELIAAREGPAVLHARLAAVDPVAASRIPPTNVRRVVR
FT                   ALEVYLVSGEPISRLQERKEPPFRPRTIWLHRPRAELYARADARIERMIAAGLVEEVAG
FT                   LLARGYDWSLPAMSSLGYIQFRPYFTGEADLPTCIERLRFDTHAFIRRQEMWFRRLPNL
FT                   EIWTPDHPSWREITA"
FT   gene            complement(446203..447006)
FT                   /locus_tag="Caur_0352"
FT   CDS_pept        complement(446203..447006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0352"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   rca:Rcas_3447 RDD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33603"
FT                   /db_xref="GOA:A9WDJ7"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDJ7"
FT                   /protein_id="ABY33603.1"
FT                   /translation="MNATPSWREPYLVVTPEGVQVVYTAAGLASRSLAAVVDYVIIITL
FT                   LATSLVMIAANEGTSSANQDVILALLAILAFVVNWGYFVFFEWIWNGQTPGKRLLRLRV
FT                   LREGGRPVDIGAIVVRNLMRAIDFLPLLYGIGLVTMFVDRYHRRLGDLTAGTVVVHEAM
FT                   PLTLERVMQPVVVQLPPRAPDAPPTPLVPNVERLTAADLALLLEFLQRRDELQTEARSD
FT                   LAAHLAAVLRQRLALPSGSGDPERFIEHVLREYHVAQAVISRQDG"
FT   gene            complement(447003..447680)
FT                   /locus_tag="Caur_0353"
FT   CDS_pept        complement(447003..447680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0353"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: rca:Rcas_3445
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33604"
FT                   /db_xref="GOA:A9WDJ8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDJ8"
FT                   /protein_id="ABY33604.1"
FT                   /translation="MTIVYLIRHGETDWNMQGRWQGHADVPLNEIGYQQARLLARRLAN
FT                   EGVTFSAIYSSDLARAYQTAWEIGAALRVPVQLLPALREIDVGAWSGLTTAEVRARFAD
FT                   DWEQMIRGHDIPRGGGETVAAVRQRVVTAVEAMVAQHRGQTLAFVTHGGCIRVLLAHAE
FT                   NFDGVGFGHYDHIGNTSITILEIGYKHWRVKTVNDMRHLEAEHKTELVSAPPDDAELPD
FT                   TAQ"
FT   gene            448020..449645
FT                   /locus_tag="Caur_0354"
FT   CDS_pept        448020..449645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0354"
FT                   /product="thymidylate synthase complementing protein ThyX"
FT                   /note="PFAM: thymidylate synthase complementing protein
FT                   ThyX; KEGG: rrs:RoseRS_0926 thymidylate synthase
FT                   complementing protein ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33605"
FT                   /db_xref="GOA:A9WDJ9"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDJ9"
FT                   /protein_id="ABY33605.1"
FT                   /translation="METQQPETFTEQEIELLQPFVTNVDRPIFCLRNLPEVVKGALFAR
FT                   YSRSSKSLRRLLLDEFINEPESGFSAMVSAQDHNPAAQLIATRQAEAFYDRVLIGYGDD
FT                   SVAELGGAHLACEGVSNIAAKLLEDSRLGISPLEKSTRYVRFDRKGPDGYPYLREPAIM
FT                   ASPLADRYVAVMDHLFTTYSELLEPVQAWLQQQYPRDEATTPRAYRNTIQAKALDLLRG
FT                   LLPMATQTNVGLFGNGRAFEYLIIKLAASPFAEAQALSKMIQAELDQVIPSFVKRARSD
FT                   RGQAYADYLATTREQVAALAHQIPVEADSTTPVTVTLVDYDPRAEWKLAAAILYPHLDL
FT                   PLPAIEELVAAMPEAERHALINAAVGDRANRFHRPGRAFEEPYYTFDILADIGAYRDLQ
FT                   RHRVLTQERQRFTVRHGYVTPPELEEIGVADRYRTALEQAADLVTALEATLPNEAQYAV
FT                   PLAFRVRWRIKLNLREAYHLIELRSARQGHPSYRQIAQLMFREISAVHPFLAAGMRFVD
FT                   HNEYDLERLAAEQRIDQKRQQVGR"
FT   gene            complement(449712..449786)
FT                   /locus_tag="Caur_R0004"
FT                   /note="tRNA-Lys2"
FT   tRNA            complement(449712..449786)
FT                   /locus_tag="Caur_R0004"
FT                   /product="tRNA-Lys"
FT   gene            complement(449835..450569)
FT                   /locus_tag="Caur_0355"
FT   CDS_pept        complement(449835..450569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0355"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: rca:Rcas_1525 LmbE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33606"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDK0"
FT                   /protein_id="ABY33606.1"
FT                   /translation="MQQTQSEPKTALVVVAHPDDAEFGCGGTLAAWAAEGWEITLVVCT
FT                   DGSGGGPDDATDVGPAARRRISEIRKAEQQAAAKILGLKEVIFLDYPDGMLQPTLELRR
FT                   DIVRQIRRIRAQRVVCQSPDRVWTPQYSIPRFHPDHLAAANATLAAVYPAAQNGWDFPE
FT                   LLAEGYPPSKVREVYITGAPVLNFAVDISATIEQKLAALRCHVSQLGTDQTELAGRVRQ
FT                   WAAERGQEFGLPLAEAFHRVEN"
FT   gene            complement(450699..451310)
FT                   /locus_tag="Caur_0356"
FT   CDS_pept        complement(450699..451310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0356"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: cte:CT0652 chlorosome
FT                   envelope protein X"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33607"
FT                   /db_xref="GOA:A9WDK1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDK1"
FT                   /protein_id="ABY33607.1"
FT                   /translation="MATVIVNDVEMTARPGERILDIARRNSAHIGFVCDGTGFCQTCKV
FT                   RVLAGAEFLSPPNDREKNWLPDARLQEGWRLGCQASVRGKGPIAVITNAEELRLQAFAA
FT                   INPPAGSSVATNVSSLITNLTQQSIDQLVGYPWNMLNAIATIGLGRIINPWQSMERFSQ
FT                   WLTDIGKVVEQTLNSPAPAPPSDPLARVRAAAAEVRRASE"
FT   gene            451481..452401
FT                   /locus_tag="Caur_0357"
FT   CDS_pept        451481..452401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0357"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   rxy:Rxyl_2580 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33608"
FT                   /db_xref="GOA:A9WDK2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDK2"
FT                   /protein_id="ABY33608.1"
FT                   /translation="MVSSTTQRTDVVRVEQYTASGESLSSALADLTWLNTADMLRGFGI
FT                   SKPPWLYGLSTVLARPPALRFARQLLTFDALVGQAGLPAGCAWICSLFAPGLDIVGPQP
FT                   PAQGPLLIVANHPGLLDAAALITALNRNDLKIIAIARPLLRTLPNTAAAIIPIGTTPQH
FT                   RMNALRTALRHLQQGGAVLTFPAGRIEPDPAHDDTASASLEDWSSSLDLFGRIAGGVPV
FT                   VTAIVSNVLAEAALHHPLTLLHRNPEDRRWLAAILQVLWPHLATTPVRIQFSAPCRADH
FT                   QMRATVLHTARQSIYQARAAQRRTP"
FT   gene            452398..453608
FT                   /pseudo
FT                   /locus_tag="Caur_0358"
FT   gene            453611..454219
FT                   /locus_tag="Caur_0359"
FT   CDS_pept        453611..454219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0359"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="PFAM: GTP cyclohydrolase II; KEGG: bce:BC4111 GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33609"
FT                   /db_xref="GOA:A9WDK3"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDK3"
FT                   /protein_id="ABY33609.1"
FT                   /translation="MTTFFPITRAAMADLPTRFGHFQIVVYLDAEQKEQIALTCGQLHT
FT                   PEPVLTRLHSECLTGDIFGSHRCDCGEQLAAALTAIQQAGRGVLLYLRQEGRGIGLVNK
FT                   IRAYALQQQGLDTVDANRALGLPDDMRDYRVAAAILTDLGIKSVRLLTNNPAKITGIEQ
FT                   HGIAVTERVPLQMPANNYSAAYLLAKQVRMGHLLDSRLL"
FT   gene            complement(454251..455486)
FT                   /locus_tag="Caur_0360"
FT   CDS_pept        complement(454251..455486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0360"
FT                   /product="glycoside hydrolase family 1"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   sus:Acid_2768 glycoside hydrolase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33610"
FT                   /db_xref="GOA:A9WDK4"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDK4"
FT                   /protein_id="ABY33610.1"
FT                   /translation="MQQFAFPTGFLWGAATSAHQVEGNNINSDSWVLEHLPDTIYAEPS
FT                   GDACDYYHRYPEDIALLAQLGFNAYRFSIEWARIEPEEGEFSFASLEHYRRMLATCHEH
FT                   GLKPVVTLHHFTSPRWLIRAGGWLDPKTPDRFVRYCERVVHYLGDLIAGACTFNEPNLP
FT                   VLLSKIMPASPLASPFWRAAAAEFAVTPDRLGIFQFVSQPRMREIIFAAHRRAFEVLHD
FT                   GPGSFPVGMTLALVDIHAGPDGERMAAEFRRELAEVYLEQLREDDFVGVQTYSRLVVGP
FT                   AGIIPPGDDVEKTQTGEEYYPEAIGGTIRHAAAVAGIPVVVTENGLATTDDTRRVEYFR
FT                   RALRSVAECLIDGIDVRGYFAWSALDNFEWISGYKPKLGIIAVDRTTQARTPKPSAYWL
FT                   GNVARFNYCVFD"
FT   sig_peptide     complement(455424..455486)
FT                   /locus_tag="Caur_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.707) with cleavage site probability 0.625 at
FT                   residue 21"
FT   gene            complement(455634..458492)
FT                   /locus_tag="Caur_0361"
FT   CDS_pept        complement(455634..458492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0361"
FT                   /product="alpha-L-rhamnosidase"
FT                   /note="PFAM: alpha-L-rhamnosidase; alpha-L-rhamnosidase
FT                   domain protein; KEGG: kra:Krad_0118 alpha-L-rhamnosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33611"
FT                   /db_xref="GOA:A9WDK5"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDK5"
FT                   /protein_id="ABY33611.1"
FT                   /translation="MSYEQLSTSQSQVSRLIVRVEHYQSTLGIGNPCPRLSWIIETNAT
FT                   NWLQTAYEIECYTKDGRVRGRTGWIHSPESVLVPWPFEPLTSREQVLVRVRVRDNKGDI
FT                   SPWSEMLPIEAGLLKVGDWSARFITPDWDDDILKPQPCPMLRHEFRVDNDVIQARLYIT
FT                   SLGVYEAQINGVVVGDQVLAPGWTVYDRRLRYQTFDVTMHLREGINAIGVILGDGWFRG
FT                   RLGFGGGRRNIYGNRLAVLAQLEITYRDGSTQQVCTDQTWRSTTGPILASDIYDGEIYD
FT                   ARLELPNWSKPGFADHQWSGVRLLEWDFSTLVAPISPPIRRIEMVLPVAIFSSPSGRTI
FT                   VDFGQNLVGRVRLTVSGPPGQMITVRHAEVLEGGELSTRPLRFAAATDRYILRGDGTEV
FT                   WEPRFTFHGFRYAEIDGWPGELRTTDIVAVVIHSDMERIGWFTCSDQLLNRFHENVVWS
FT                   MRGNFLDVPTDCPQRDERLGWTGDIQVFAPTAVFLYDVAGLLQSWLIDLAIEQEKLGGA
FT                   VPHVVPNVLGPSAAGAAAWGDAATVVPWVLFQRYGDKRVLETQYKSMRSWVDYIATKAG
FT                   HTYLWDRGFQFGDWLDPTAPPDKPGQARTDKAIVASAYFIFSATLVAKAAHVLGYDADA
FT                   DFYADLAHKARFAFAKEYITPAGRLMCDTETAYALALVFDLFPTDTQRRYAGERLAALV
FT                   RDSGYHIRTGFVGTPLICDALCSVGHCRVAYRLLMQRECPSWLYPVTMGATTIWERWDS
FT                   MLPDGSINPGEMTSFNHYALGAVADWMHRTIGGLIPVEPGYRRIEFRPQPGGEIVYARV
FT                   SHRTPYGLAECFWRIEEGVFYLRVVVPPNTTAQVFLPGRDDQPLDVGSGIWQWSIPCQD
FT                   TATRGSYTVDDLVDEIIDDEVAREAVNQVLSQVDAWRLFGNLLLNERSASLREAIQALP
FT                   NSEIVIERLNALLTRIPKKDGI"
FT   gene            complement(458521..459387)
FT                   /locus_tag="Caur_0362"
FT   CDS_pept        complement(458521..459387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0362"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_0944 putative
FT                   ABC-type sugar transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33612"
FT                   /db_xref="GOA:A9WDK6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDK6"
FT                   /protein_id="ABY33612.1"
FT                   /translation="MRMLMTSTMLTLRKQSVWKLLIWTLVVILVLIELYPLTWLLLSSF
FT                   KAPAEFSLNPIYALPEGFYWQNYIRAWTEGRMGVYFRNSLMVTIPSLFLILCLGSMAAF
FT                   GIEILKWRFNNVVLVIFLLGIMIPVQMILLPLFAIYNQLQLLNTFTGLILVYTAFGLPL
FT                   TIFLLVSFAKSLPHEVLEAALIDGANIYQIFLYIALPMMANAIITVGLVQFFFIWNDLL
FT                   ISLTFISDSELRTVQTGLLSFVGRFGQREWGPTFASITTSVIPILFLYLILNNAIMKGL
FT                   TSGAVKG"
FT   gene            complement(459399..460283)
FT                   /locus_tag="Caur_0363"
FT   CDS_pept        complement(459399..460283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0363"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_0127
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33613"
FT                   /db_xref="GOA:A9WDK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDK7"
FT                   /protein_id="ABY33613.1"
FT                   /translation="MNQTLRDRKALLVFVGPALTLYVMIVIVPIIWTVGYSLFEGSPIT
FT                   GFQFVGLGNYGKLWQDQDFINAFLFSARYALVVTAGQVGFGLLLALLYLFFLKRSSAFI
FT                   RTLVFFPVVLPTVAVAQIFVKLFEITPQYGLVNAIFAAIGQESWVQPWLGRSDSAFWVA
FT                   ALMNIWTAMGFYAVILYAGLLDIPNEIIESARLDGANGFNLVVFVIQPLLTPVLVTSII
FT                   FSLNGTLKVFDQLLALTNGGPGKTTTPLTLYMYRVAFNYNDYGYGSTIAIILMIECLIV
FT                   SLLAFRFARRDVS"
FT   gene            complement(460430..461776)
FT                   /locus_tag="Caur_0364"
FT   CDS_pept        complement(460430..461776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0364"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: aau:AAur_0946 putative extracellular sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33614"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDK8"
FT                   /protein_id="ABY33614.1"
FT                   /translation="MMPGKLVVPSLLVLICCVIISCSAPAAQPQPVVTPAQSTTTESQL
FT                   PVVIHYLTVQQETEGWPLIIGTLTREYQANHPNVEWKYENYPQTDLVQRIQLLAGSDSL
FT                   PFMFNYESGAPLRDLAASGKVLELEQTFKELGIYDRLNPGAVSLLKNLVGGSGLYALPL
FT                   ELNIEGFWYNKQIFAEHNLAVPTTWDELLAVADKLHQAGIQPFAVSGLQKWPLTRLING
FT                   YVMRVYGYDVMSRVVNGELKVTDAGFIAAAQIVQDMAMKGYFGQGVNTLDYAPAQDLFL
FT                   QGRAAMYYMGSWALRDFNNPELNKIGIDNIGFFNIPLVEGGVGTLNDYSINAGLTTSFS
FT                   QKEFSRNPQGYGEWMKAVFSAYGDRAMSELGMITGFTVSQIPDNVSPLTRLTVAEIDNV
FT                   KNGAPWFEAYFNARTQAVATDNVQLLVTGDMSPEEYMAELQKAIDEQLP"
FT   sig_peptide     complement(461693..461776)
FT                   /locus_tag="Caur_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.996 at
FT                   residue 28"
FT   gene            complement(462031..463071)
FT                   /locus_tag="Caur_0365"
FT   CDS_pept        complement(462031..463071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0365"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: rso:RSc1014
FT                   probable transcriptional regulatory DNA-binding repressor
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33615"
FT                   /db_xref="GOA:A9WDK9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDK9"
FT                   /protein_id="ABY33615.1"
FT                   /translation="MKRPTQMDVARRAGVSRATVSHVINGLSGGRVPISPETRERVWQA
FT                   IKELGYEPDAGARALRLGKSRTIGLIMPDLYNPHFWENAEGVEQEARANGYRLLLCSMN
FT                   LNIQYGEDAFKDLVGRRIDALILMGSFVYESEEARNTLIRSLERGLPIVEISDRVTKDY
FT                   LADCVLSDYRAVAAAAMQHLIMLGHRRIGLIYGVANSSLAEDRLIPYKKSLQAVGIPID
FT                   EQLIVHCGPTIEEGYRAAIHLLQKPNRPTAIVAINDLLAIAVLRAAGDMGLRVPADVSL
FT                   IGFDDIAIANYLIPRLTTAAKDAVQLGREAVKLALARLRDPKRPRQVIEVPARLILRES
FT                   TAPPSC"
FT   gene            463509..463772
FT                   /locus_tag="Caur_0366"
FT   CDS_pept        463509..463772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33616"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDL0"
FT                   /protein_id="ABY33616.1"
FT                   /translation="MWSAAAWLPRQPCSRSSAWYSVDPAGHGDAGCGVPSLVGLGTLSA
FT                   CYARGAACGVRQRGCRASRAHDPARGIPLTRLVTGMPGVMFF"
FT   gene            complement(463963..464589)
FT                   /locus_tag="Caur_0367"
FT   CDS_pept        complement(463963..464589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0367"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   mca:MCA1614 cold-shock DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33617"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDL1"
FT                   /protein_id="ABY33617.1"
FT                   /translation="MNNVCRIGVFYDGSYFTYAQFYFYSEKKVGWLSFVPFHRLIEQFV
FT                   SSKEQRYAAHRVVYASWHQGLFHSAQTSEKQFQIERNRHIDLVHAGIEPKYVPMPPNGQ
FT                   EKGVDVSLAIDAMERAMEGKIDVAVLVTGDGDLTPLVRALMKHGVRVGLLYFEYESSQR
FT                   TSHVNRRLLDACNYALNVNQLEHTPQAAAIFKGLFRQPQGVVARN"
FT   gene            complement(464693..465463)
FT                   /locus_tag="Caur_0368"
FT   CDS_pept        complement(464693..465463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0368"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: rba:RB8188 probable glyoxylate-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33618"
FT                   /db_xref="GOA:A9WDL2"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDL2"
FT                   /protein_id="ABY33618.1"
FT                   /translation="MSALAPLRFSVCLDMIFTDRPFEQRLEHIADLGFRAYEFWTRKGK
FT                   DMNITIALQTALRLHCVAIFGSEAAPNDPDQRARFRDEVTRSAALAVDLACDNLIVHGG
FT                   ITRTDLDYATQRAHLVDALHEAAETAADAGLNLLLEPRNPVDHPGSFLWSSDEGFAIVR
FT                   ELGQPHVKLLFDCYHQQISEGNLTRRILANLDLIGHIHVADVPGRHEPGTGEINYEHIF
FT                   GVLREHGYSGYVGLEYTPRIDAAASLRVVRMMSQ"
FT   gene            complement(465894..469082)
FT                   /locus_tag="Caur_0369"
FT   CDS_pept        complement(465894..469082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0369"
FT                   /product="peptidase S41"
FT                   /note="PFAM: peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; peptidase S41; WD40 domain protein beta Propeller;
FT                   KEGG: rrs:RoseRS_2312 peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33619"
FT                   /db_xref="GOA:A9WDL3"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR012393"
FT                   /db_xref="InterPro:IPR028204"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDL3"
FT                   /protein_id="ABY33619.1"
FT                   /translation="MSKSQALLRQPALDPDGRLLAFIAAGDVWLVSIEGGVAERLTAHP
FT                   ASHYGPRFSPDGQRILFSAGRDGSGDLYVLDLAGGPPRQITFQDEQCTPEDWANDGDAV
FT                   FFTTAIEQMGSAIYRVKTSGGTPAPIYLEPYEQLGQVAVSPDGTRLAFVNIRERWWRRG
FT                   PHPFSSNEIWLGPTDPDYRALCQIAGPFGQRLVYAGKLGWPLWAPDGQGLYIVCDSDGN
FT                   ENLWYLPLGEGEARQITHFRDGRLLFPAIARRNNVIVCERGDGQLWRIDPISGESVPVP
FT                   IRVRIDSKRTPVRVERWTSGFSEVRLSPDGKKLAIVARGDVFADFADKETDRDLRQGPA
FT                   FRVTNTPAREWSIAWAPDSQRLIYLSDRYGEVELFAYDFSSGQEQQLTRDGRPKMLPRI
FT                   APDGKSIAYIRDQRIIEVIEVTDPSPREVCQARFAVAADLCWSPDSRYLAFIAQDDRLF
FT                   SNVYIVPAAGGEPRQITFLSNLDGGNLCWSPDGSFIIFTTEQYRLEAQIARVDLRPSQP
FT                   VFRETAFERLFEKKEEKPTEPGDQSAKEPRVSQPLTEPIIYEGIERRLRLLTPPQMNAM
FT                   AGPISPDGKDLLFLASVAGKVDVWTMPLDEPRANQPPRQLTASDTRKGFLQFAPDGRSF
FT                   YYLEDGQVVVRRFPGGNEPNRLSLRAEVEVDFHREKEQIFIEAWRELRDSFYDPTFRGQ
FT                   DWQAVRDRYASLVGAVQTTGELHTLINLMVGELRASHLGSSFYNSESEDGFIGIIFAAE
FT                   PLLREGRLIVERNLPDGPAALTADPPRPGEELVAIDGTRLNGTLSLHKLLLRSVGRRVR
FT                   LVLRANDGTEREIVVRPINASAYEQLRYRDWVFNNEQYVHTHSQGRLGYVHIAEMSYAA
FT                   YQQFLVDLDAETHSKAGVIIDVRYNRGGHTATFILDVLMRRSALRSGFRDLGTTDASHL
FT                   AGNRVLDRPTVLVTNERSASNTEMLSESYRRLRLGKVVGRPTAGAVIWTYQIPLLDGSW
FT                   LRLPRLYVVTPEGEDLEGRGRPVDVEAVRPLGEWAYGRDSQLDAAIATLLKTVRRRRKN
FT                   DVPNPVASPDTTYE"
FT   gene            complement(469242..470030)
FT                   /locus_tag="Caur_0370"
FT   CDS_pept        complement(469242..470030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0370"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; Male sterility
FT                   domain; KR domain protein; KEGG: rrs:RoseRS_1352
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33620"
FT                   /db_xref="GOA:A9WDL4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDL4"
FT                   /protein_id="ABY33620.1"
FT                   /translation="MDPRDRVVIITGASSGIGAATARCFAAAGARLVLAARSQEALTQV
FT                   AADLPQALAVPTDVSDPEACMRLVERAVATYGQVDILINNAGIGLTGPVTRLARADLER
FT                   VLAVDLLGPIWLTQAVVPIMRAGGRGQIINVSSVLAVQPLPFLGGYAAAKAALEQISNA
FT                   LRIELHGSGIAVTVVRPGTTRTDFNQRRLGRGRERRRIAPPGVPPEVVARTILRAARTE
FT                   PRLAYVSWSDRLALWIGRLFPGLIDAILARAFVWEEQAYH"
FT   sig_peptide     complement(469950..470030)
FT                   /locus_tag="Caur_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.755 at
FT                   residue 27"
FT   gene            complement(470049..470990)
FT                   /locus_tag="Caur_0371"
FT   CDS_pept        complement(470049..470990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0371"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   rrs:RoseRS_4162 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33621"
FT                   /db_xref="GOA:A9WDL5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDL5"
FT                   /protein_id="ABY33621.1"
FT                   /translation="MTTMTIGTLPTFVHIREVGPRDGLQNEPTILTTAQKITLIELLAA
FT                   TGLRAIEVGAFVRPQQVPQMADTEAVFAGIKRQPGVVYSAIAPNVIGARRAIAAGADVV
FT                   QVFLSASESHNRSNVNMSIEQSLVQVAEMATLVHAAGKPFDAVLSVAFGCPFEGDVPIE
FT                   RVLDLCQRLLDLGAEQLTLGDTTGMAHPLLVQEVVRAFRARFPRQPLRLHLHSARGAGL
FT                   ANLLAALQLGVDLFDSSIGGIGGCPFAPGAPGNLCTEDVTHLLHEMGIATGLNLPALMA
FT                   TARELERMLGHEVPGQTIKAGICKHLRDRGEG"
FT   gene            471261..471809
FT                   /locus_tag="Caur_0372"
FT   CDS_pept        471261..471809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33622"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDL6"
FT                   /protein_id="ABY33622.1"
FT                   /translation="MDWSKQANDMIKMWTGTQQKVWDSWMASMQYMAAPQNPEAWQKTV
FT                   DSWRGTVKQTLEAQVELTRMWAEAVAANSVNMPNLPPIPGVPTIPGLNPASPTSVVEWS
FT                   RQVLELTRNFTESQTRFIEGWFEMLKKSDPTTIARGWDTTQMQKVMQSWQEAMQRVIEA
FT                   QAELGKVLMGVVNNTVEKK"
FT   gene            complement(471908..472708)
FT                   /locus_tag="Caur_0373"
FT   CDS_pept        complement(471908..472708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0373"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: sfu:Sfum_1692
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33623"
FT                   /db_xref="GOA:A9WDL7"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDL7"
FT                   /protein_id="ABY33623.1"
FT                   /translation="MTLPRCLTIAGSDSGGGAGIQADLKAFAALGAYGMSVLTAVTAQN
FT                   TVGVQGVVELPAAFVGQQIDSVVTDIGVDAVKTGMLANADIIAVVAEKARAYQWPYLVV
FT                   DPVMVAKSGHPLLHPEAQQALITLLLPLATIVTPNLPEARALTGLNITTIAEMEQAAQM
FT                   IHAMGPRWVLVKGGHLEGDSVDVLFDGAQYQYFTAPRIETRHTHGTGCTFASAIAAGLA
FT                   KGLSVPDAVAQAKEYITTALRHAPGLGQGHGPVHHFAAWYGVAE"
FT   gene            complement(472705..473355)
FT                   /locus_tag="Caur_0374"
FT   CDS_pept        complement(472705..473355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0374"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: mta:Moth_2162 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33624"
FT                   /db_xref="GOA:A9WDL8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WDL8"
FT                   /protein_id="ABY33624.1"
FT                   /translation="MSIAHIVDWRLYVVTDAGLSRGRSHRAVIEAAIVGGATVVQYREK
FT                   HASTRQMIEEALELRDLTRRAGVPLIVNDRVDVALAVDADGVHVGQDDMPVALARRLIG
FT                   NKLLGVSAHNLSEALQAVRDGADYLGVGPIFATTTKPDAAAPIGLDGLRAIRQHVSIPI
FT                   VAIGGINQANAADVMRAGADGIAVVSAVVAADDVTAAARQLRALVSVTQEKAL"
FT   gene            complement(473383..474192)
FT                   /locus_tag="Caur_0375"
FT   CDS_pept        complement(473383..474192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0375"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="PFAM: hydroxyethylthiazole kinase; KEGG:
FT                   rca:Rcas_4122 hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33625"
FT                   /db_xref="GOA:A9WDL9"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WDL9"
FT                   /protein_id="ABY33625.1"
FT                   /translation="MTLNERIAELRERVRQQRPLIHHITNFVVMNDTANVTLHIGGLPV
FT                   MAHDRAEVAEMVTAAGALVLNVGTLSPDWIEAMLIAGRRANELGIPIVLDPVGAGATSL
FT                   RTASNRRLLEELQIAVVRGNSGEIGALAGMGGVVKGVETVVEVDDPTAAAKALAQQYRT
FT                   VVAVTGRQDVVTDGKRVFLVDNGHEWLKTLTGTGCSATTVIAAFAAVEREYPFAAAAAL
FT                   ACFGLAAELAAPAARGPASFKVAFYDAIYHLSADQIRAGARVTAVAG"
FT   misc_binding    complement(474297..474419)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 62.60"
FT   gene            complement(475047..476720)
FT                   /locus_tag="Caur_0376"
FT   CDS_pept        complement(475047..476720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0376"
FT                   /product="3-oxosteroid 1-dehydrogenase"
FT                   /EC_number="1.3.99.4"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: afm:AFUA_4G14850 extracellular 3-ketosteroid
FT                   1-dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33626"
FT                   /db_xref="GOA:A9WDM0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDM0"
FT                   /protein_id="ABY33626.1"
FT                   /translation="MDRSDYQTDVLIVGSGAGALVAALVAKEAGLETLVIEKTDLVGGS
FT                   SAMSGGGLWIPNNPVSREAGVEDSFEMAWRYLEEVVPAAGPAASPDRRRAFLEYGPQMV
FT                   EFLRRLGFRWHAAIGYPDYYPERPGGSKRGRAIEGSIFDGRQLGPWLKRLRPFPGAPPI
FT                   PIHTNEVASFLVSLRTVRGFLMAMRVFGRFFQRALGKVPMGLGASLVGQLLWLCLQRNI
FT                   PIWLESSLEELVVDHGRVAGAVVRREGRTLRVAARRGVLLAAGGFEHHGEMRERYLPKP
FT                   TSTDWAVGASGNTGDAIRAAQALGAAVALMDKAWGGPVVILPQGQVSFLVGERSLPFSI
FT                   IVDSKGERFMNESASYVDCWRWQYERHRQTPAIPAWLIMESRHRRYYPFGLLPPGITPQ
FT                   SATSSQFLVRAQTLRELAMRIGIDPDGLERTVVRFNRMAQQGKDEDFHRGESAYDRFYS
FT                   DPRVKPNPNLGPLERPPFYATAIYPGELGTLGGLLTDEWGQVLHENGEPIPGLYATGNT
FT                   SASVFGGTYPGPGSTLGPACTFAYIAMQHIVQNMQLVERV"
FT   gene            complement(476743..477564)
FT                   /locus_tag="Caur_0377"
FT   CDS_pept        complement(476743..477564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0377"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ttj:TTHA0660 oxidoreductase,
FT                   short-chain dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33627"
FT                   /db_xref="GOA:A9WDM1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDM1"
FT                   /protein_id="ABY33627.1"
FT                   /translation="MKVKNKVFVVTGGASGLGRELVLRLLDMGANVAAVDINGAALDEL
FT                   VGQAGQARSKLSTHVVNIADLAAVQALPEKVLSVHGAVDGLINNAGIIQPFVKVNDLED
FT                   AAIDRVLKVNFYGTLYMTKSFLPYLIKRPVAHIVNISSMGALVPVPGQTMYGASKAAVK
FT                   LFTEGLRSELLNTNVRVTIVFPGAMATDIVKNSNVAQSSLPMQAAQAQRSSRMKALSPK
FT                   EAARIIIDGIEGDRYRILVGSDARMMDWLSRLNPRWAAELIYRQMQHLLSR"
FT   gene            complement(477870..478859)
FT                   /locus_tag="Caur_0378"
FT   CDS_pept        complement(477870..478859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0378"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   afm:AFUA_3G11050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33628"
FT                   /db_xref="GOA:A9WDM2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDM2"
FT                   /protein_id="ABY33628.1"
FT                   /translation="MKSKTKNTKTRAQIEAMVARAFGGMALADDEGAVYELKDGWFNAV
FT                   YSIRLANGQEVILKIAPPPDAEVMSYEKNIMATEVATMRLVRQNPAIPVPNIYFCDDTH
FT                   EVCDADYFFMEKLAGDTLAHMRARLPAATLATLEYQIGTIIREINSFRGTYFGYEGNPD
FT                   LRASTWKEAFIRIMDAVLEDAARKRVTFDYSYDEIRDVVWKHAAALEEVTIPCLVHWDA
FT                   WDANFFVQQGRIVGIIDFERVLWADPLMEAQFRPFFGDGITNSMRGYGKTSFTFAEKQR
FT                   CYLYSLHLALVMHTECYYRNYDTDEIFNFSKGFIARSMAWLRANYVYG"
FT   sig_peptide     complement(478773..478859)
FT                   /locus_tag="Caur_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.978 at
FT                   residue 29"
FT   gene            complement(478967..481228)
FT                   /locus_tag="Caur_0379"
FT   CDS_pept        complement(478967..481228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0379"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: rpc:RPC_1611 glycoside hydrolase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33629"
FT                   /db_xref="GOA:A9WDM3"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDM3"
FT                   /protein_id="ABY33629.1"
FT                   /translation="MTTNDALVQRANDLLAAMTLEEKAGQISQYFYFRGLTAQNELVEA
FT                   QVRAGQVGSLLFVADPRETNRLQRIAVEESRLGIPLLFGFDVIHGLRTIFPVPLGMAAS
FT                   WDPQLYERVQAIAAREARAVGIHWTFAPMVDIARDPRWGRIVEGAGEDPYLGAQMAAAQ
FT                   VRGFQGEAIGAPEHVVAGPKHYVGYGAALGGRDYDEVNISESELRNVYLPPFAAAVAAG
FT                   AGNVMTSYVGIDGVPGAADRYLLTDVLRGELGFKGFVVSDAAAVMDLVTHGFARDAQDA
FT                   AVRALRAGLDMEMWLGMRFVPGTNPIPTVGAFSTLAEAVRSGVIEESLLDEAVRRVLLV
FT                   KLRLGLFEQPYVNEGAAGAILNDPAHREMARIAAERAAVLLRNEGNILPLDRSAVRQVA
FT                   VIGPLADDRAATLGPWVFAPDLNATVTVLEGLRRTAGEGVRVEYAPGVPMPTRAIPSPF
FT                   ASLSQALGMPASSETSFDEEAEFARAVALARASDVAVLVLGEAADMNGEAASRSTLDLP
FT                   GRQLELLEAVAATGTPVVVVLLSGRPLDLRRVLPCSAAILVAWHPGSEGGNAVARLLWG
FT                   DATPGGKLPFSWPRSVGQVPIIYSRLNSHQPATSHQRYWEEESTPLYPFGFGLTYGQVE
FT                   YRNLTLSATQIGLEDTIEATVEVHNTSAREVEEVAQLYLHQRYGRAARPVRELKGFERV
FT                   TLKPGERRTLRFAIPPSARRYWSKADSAYVLDESDFDVWVGGDSTAALHAEFSVRSSTV
FT                   "
FT   gene            complement(481331..482578)
FT                   /locus_tag="Caur_0380"
FT   CDS_pept        complement(481331..482578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0380"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   chu:CHU_1068 transport protein, MFS family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33630"
FT                   /db_xref="GOA:A9WDM4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDM4"
FT                   /protein_id="ABY33630.1"
FT                   /translation="MPTNKTRVSGIGLIVLAFVAFIALGLPDGLLGVGWPSIRDSFAVP
FT                   LDAIGMLLTTVIAGYMISSFFSGFLLSRLGVGRMLAASCLLTGMALIGYTVVPHWWMMV
FT                   ALGVFAGLGAGAIDAGLNTYVAAHFGETLMQWLHASWGVGVTIGPILMTLGLTTLNTWH
FT                   FGYQIVGIFQIALAICFVLTLAMWASHARNVPSGDEPAKRLTDYQTPMIETLRQPQVWL
FT                   SVMLFFLYVGAESSLGIWTYTLLTESRGVDQALAGFFAGSYWFTFTIGRIAAGMITIRT
FT                   GATRLVFTGLSGALLGAVLLIWNPSQLMNVVAVALIGLAIAPIFPALMSDTSMRVGDHH
FT                   AANTIGMQMTATGFGTAVIPGLMGVLAQRVSLEIIPLCLLVVYASLFGLYLLVVRLRRV
FT                   SVTVVAAKTGPTQAIK"
FT   sig_peptide     complement(482501..482578)
FT                   /locus_tag="Caur_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.985 at
FT                   residue 26"
FT   gene            complement(482668..483681)
FT                   /locus_tag="Caur_0381"
FT   CDS_pept        complement(482668..483681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0381"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sde:Sde_3960
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33631"
FT                   /db_xref="GOA:A9WDM5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDM5"
FT                   /protein_id="ABY33631.1"
FT                   /translation="MSKKSVQTLEDIARLANVSRSTVSRALNNSPLISKQTRERIQAIA
FT                   REHNFCLNVSGRNLRLRSSRTIAFVAPMCFPPVASAEHLFGLEMLGAIWSGLHELNYDC
FT                   LIVHSASQDTDWVHRYLHSGRVDGFILMESSFKQTQIEALVQMKVPFIVWGMPVSPFNY
FT                   CSVTGDNVAGGRLATEYLIRTGRQRIAFLGGLKGTLTVENRFKGYEQALQLAGRALDPA
FT                   LIVYGDYTYASGAAGMQRLLERAPDLDAVFVNSDLMAIAAINVIQESGRSVPADIAVVG
FT                   YDDLSIAGYATLPLTTIRQNIPLAGKLLAQNLIQHIETGLVTNVTVPVELVIRKSA"
FT   gene            484035..484862
FT                   /locus_tag="Caur_0382"
FT   CDS_pept        484035..484862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0382"
FT                   /product="translation initiation factor IF-3"
FT                   /note="TIGRFAM: translation initiation factor IF-3; PFAM:
FT                   initiation factor 3; KEGG: rrs:RoseRS_1032 translation
FT                   initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33632"
FT                   /db_xref="GOA:A9WDM6"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDM6"
FT                   /protein_id="ABY33632.1"
FT                   /translation="MPRLSPVARRRSRAIRDRFRINNRIRAREVRLIDENGTQVGIVPL
FT                   REALAMAEERGFDLVEVAPNAVPPVCRLLDYGKFRYEQSKKEREARRNQKQSELKQIRL
FT                   MPKTDDHDVAVKANQARRFLLAGDKVKFNLRFRGREMAHPEIGRQMLDQIAEQLSDIAV
FT                   IEQKPLMEGRVLSMLLAPTAKVLKAAQQAQKAAAQRTTTAESAKPATSAASTPATAEPA
FT                   DEEEEELIDDGDVVEEDEDDDDTFVADYDDEDDDFEDDDDDDEDDERNRRRRR"
FT   gene            484918..485124
FT                   /locus_tag="Caur_0383"
FT   CDS_pept        484918..485124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33633"
FT                   /db_xref="GOA:A9WDM7"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDM7"
FT                   /protein_id="ABY33633.1"
FT                   /translation="MPKMKMKTHKGAKKRFKVTASGKFLQQRGVRGNKRNRPSRSQRAW
FT                   GKDQPISPTNRRMLQTALPYGLE"
FT   gene            485273..485632
FT                   /locus_tag="Caur_0384"
FT   CDS_pept        485273..485632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0384"
FT                   /product="ribosomal protein L20"
FT                   /note="TIGRFAM: ribosomal protein L20; KEGG: rca:Rcas_1436
FT                   ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33634"
FT                   /db_xref="GOA:A9WDM8"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WDM8"
FT                   /protein_id="ABY33634.1"
FT                   /translation="MARVKRGIMVRKRHKKLLEQAKGYRGARSRHYKVAHEAVMHALAD
FT                   AYRDRRRRKRDFRRLWIMRINAAARLHGTTYSRLINSLKQANIEIDRKMLADLAVRDPQ
FT                   AFARIVEQAQAAVTA"
FT   gene            485650..486432
FT                   /locus_tag="Caur_0385"
FT   CDS_pept        485650..486432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0385"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
FT                   ribose methyltransferase substrate binding; KEGG:
FT                   rrs:RoseRS_1035 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33635"
FT                   /db_xref="GOA:A9WDM9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDM9"
FT                   /protein_id="ABY33635.1"
FT                   /translation="MALISSPANHHVKWLRSLAESARHRRRERSFVIEGVRLVTDALTA
FT                   GAEVRLVLYAPDQLATTTAGTALLNRLRHLPHCFPATPAVIVAAADTEQPQGVVAAVTW
FT                   PELPPRPGLRLVLDAIQDPGNVGTLLRSAAAAGVGLVMCAPGTVDPFNPKVARAAMGAH
FT                   FLVPLRVSPWETIRAELQSYTVYAADSAGQQPYYAVDWRQPAALIVGNEAHGLSEPARA
FT                   LAHQTITIPMSGSIESLNAGVAGSIILFEALRQQTVAH"
FT   gene            486557..487606
FT                   /locus_tag="Caur_0386"
FT   CDS_pept        486557..487606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0386"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase class IIc;
FT                   aminoacyl tRNA synthetase class II domain protein; KEGG:
FT                   rca:Rcas_1438 phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33636"
FT                   /db_xref="GOA:A9WDN0"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDN0"
FT                   /protein_id="ABY33636.1"
FT                   /translation="MTTLLDELTTLEQEALTALETVADLSALTEWKSRFIGKQGRLSRL
FT                   SRGLGALPASERPLVGQRVNALREQLEAAFSAAKERLEAQAVAAELAAERIDVTMPGRR
FT                   PAVGYVHLTNQILRQVQHIFAEMGFQVWESPEVEYDAFNFSLLNFPDDHPARDMQDTFY
FT                   VEMPAGAPSVLLRTHTSPGQIHAMRRNAPNPLRVLIPGKVYRNEQVTVRSEMMFHQFEF
FT                   LAVGRNVTMADLKGTLSFFAERMFGPGTRVRLRPSFFPFTEPSAEMDVTCFLCGGKGCR
FT                   ICKYAGWLEIGGCGMVHPNVLRNGGYDPAEFSGFAGGFGPERVAMLKYGIDDIRWFYSG
FT                   DQRFVEQFG"
FT   gene            487610..488482
FT                   /locus_tag="Caur_0387"
FT   CDS_pept        487610..488482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33637"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDN1"
FT                   /protein_id="ABY33637.1"
FT                   /translation="MRRDELNRAIHDLYRAEHEALGERGGYELLERARQWNLAPTLAAG
FT                   GVIVFPHAGVADCGHQIAAAVHACLDSGADRVLVISVLHAWNDEMEQARRRVAAGGSPS
FT                   AERYWGIQGPGLQRGNEWQLDHALYSFRFFWELETRRRGIRGPQVIERYPYLAGGHPEL
FT                   LPGIEELIELAQDAVIVSTADPFHHGIGYGDPPEQSFAPAEGGLELARQTIEEGMQLLA
FT                   NGDYWGYNQHCVRAKSDARDAGQVFRFLRGPLQGEILDLVASDATQLYQSPPPTWVAAP
FT                   LVRWTKVTV"
FT   gene            488479..489411
FT                   /locus_tag="Caur_0388"
FT   CDS_pept        488479..489411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0388"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rca:Rcas_2761 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33638"
FT                   /db_xref="GOA:A9WDN2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDN2"
FT                   /protein_id="ABY33638.1"
FT                   /translation="MNRHRLWLYTVLFAGVLIASTASILIRYAQGTGMSSLSIAAGRLG
FT                   LAALILTPLALHRSSQEIRHLSRRDVIFGAAAGVFLAIHFASWISSLEYTSVASSAALV
FT                   STNPLWVGLASLFLFRERLPWTILVGIALTLIGTIVIGISDSSSSTQSNPLLGNTLALI
FT                   GAMTASGYLLIGRDLRRRLSTMAYIWLVYTSAAVVLVIWTLISGQQFLGFPPQAYLFVL
FT                   GLALGPQLLGHTAFNYALSGLSATYVAVAILGEPIGSSLLAFLLFGETVAFLQFVGIAL
FT                   LLVGIVIASIAEQQAPESTARQTAENQTA"
FT   sig_peptide     488479..488568
FT                   /locus_tag="Caur_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.846 at
FT                   residue 30"
FT   gene            489472..490467
FT                   /locus_tag="Caur_0389"
FT   CDS_pept        489472..490467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0389"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sme:SMc00267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33639"
FT                   /db_xref="GOA:A9WDN3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDN3"
FT                   /protein_id="ABY33639.1"
FT                   /translation="MLIGLSALSFSYRCGLIGRGTPRAVSHPLDIEGVMALASRAGLQS
FT                   VEFPLSLLPDLSPGRLSALRERLTLCGLTPVADSDIVDVDTLRAHIPAAAMIGAHVLRV
FT                   LISPVLEGYRRPFTTDWPAHLADVTDRLRAVIDLAAEHNIILAVENHQDATSADLAAIC
FT                   AAVDSPHIGVCFDAVNCLVVGETPYAALERLGPLIRNVHLADYETYPTTQGWRLVRCAL
FT                   GEGDLDIRRLFHLIEHYAPDVACQIELVSHSARHVRILDDDWWQGYPPCDVREVLPVLR
FT                   LFAQTMRLRDDDWRTPWERGAGEEQISLYEDQQYATSIAYLRTIGILPRL"
FT   gene            490615..491100
FT                   /locus_tag="Caur_0390"
FT   CDS_pept        490615..491100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33640"
FT                   /db_xref="GOA:A9WDN4"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDN4"
FT                   /protein_id="ABY33640.1"
FT                   /translation="MSARRIWWFVVGLLFVAGTLIWPQRSFSQAGIDQFFVDTLADNPV
FT                   ADLNTHCTDALPNANCSLRQAIAKANAVAGSNRITINFDLVTEGSVASAPYIITITTGQ
FT                   RLPPITRANVTISADLLNGAPQVAINANNNDAGLVLSGGGAIIEGLVIYGASNDAGT"
FT   sig_peptide     490615..490701
FT                   /locus_tag="Caur_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.705 at
FT                   residue 29"
FT   gene            491087..494368
FT                   /locus_tag="Caur_0391"
FT   CDS_pept        491087..494368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3733 conserved repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33641"
FT                   /db_xref="GOA:A9WDN5"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDN5"
FT                   /protein_id="ABY33641.1"
FT                   /translation="MPARNRGSGIYISSSGNTVRNCSIGLTLDGSVPPDTLRNRNGIVI
FT                   SGSAAGNNQIGAANQPNTIAGNTVNGIVISNASDNRIQGNRIGVLFTTATVVRPNGGFG
FT                   VQILSDTTIDPNGRAERNLIGGTENSERNIIGGNGLSGVLISGSRTLTTTIASNLIGVN
FT                   LEAETGLGNNGDGVRIEDGAQATRIGSTNQTQPLVIGGNSGAGIRIHANGGAAPSNTTI
FT                   DGYVVVGLSRSGINARPNTQGGIYLTESAGTTTIGSSATTLRIGWNGGPGIWIGPGISD
FT                   VTITNAFVGALPGGILAANNGGVAINGATNVTMTASTVAANTAYDLQIANASNVSLDGN
FT                   LIGLHADGRSVAGSVTAGISVTNSTNVTIGNTTGNVIAAANGPGIDISGSSSVSITVRA
FT                   NILGLRRDTTGDAYSVAAAHAGPAIRITDAAQISVAGNVIGGNGSAAGIELTNVQSATL
FT                   TQNQIGWINDPGGGTTPLARPAGVGIALTNVTTATLSGNLLRLNTDDGVRLTDSSAVII
FT                   DNANAIEENGGDGVQVGGNSRNVRITGNRIRANTGYAVLVTDTAQRVGITQNQMAANSA
FT                   GGIHLANTTLYSGTGADPDQSLNRPNHSIDPPFDIQVSQDGIITGRVFTSTAEREEDLV
FT                   PVSACAGCTIQVYSPNPDLPSADGQGWQQLQVVVNGNTRADINQVSASGVFNAQMLDAP
FT                   ATYRQLIFAATDQFGNTSPFHIFTPTVDLRLIPLDPVQQSAAPGSSISYRLQLENHGTL
FT                   QINRIRLSTSGTLSGWTVATDPAERFSLPPGGTRQITITLTLPTGTHPSIQVPITDTTT
FT                   LSLTAPAMSAITQTLRTEVQALPVLAASPLTGAATVLPSDSYIYRHQITNNGNVTVPID
FT                   ISATTADLVGLDTYNTTVLTPSVTLAPGASTEIAVRITVPTGAQTTTPSGNPVRATTVI
FT                   TATPRGFGSQAITMTDTTTVGLRYAAELRSSYEQDVRAGREVVFLHTLRNTSNGRATFQ
FT                   LNFAASRGSTLIAFESATSGVTISGNRVTLDNIADSGKINQIVLRVRVQISELILPGSR
FT                   ETLRIWVSIPDTTEPLSGAEVQDVAVVRDSSGVLVPAIWVPLVMN"
FT   gene            494379..499541
FT                   /locus_tag="Caur_0392"
FT   CDS_pept        494379..499541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0392"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; SMART:
FT                   Parallel beta-helix repeat; KEGG: rca:Rcas_3732 parallel
FT                   beta-helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33642"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="InterPro:IPR026457"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDN6"
FT                   /protein_id="ABY33642.1"
FT                   /translation="MHRRFRLALLFLILVSLLPFAQPASAASLVVNSLADTNDGACTTA
FT                   PDGCTLREAILTANSNGVPDTITFSVSGTIYVQNSGLPPLSEGGTTIDAGDNHTIIVSG
FT                   EQLRDASNNVIPAHGIVIASNDNVIRGLVIIRFSRGIGFTGGGSGIYLRNNAQNNLIVN
FT                   TWIGHLNGSPEPNTGYGILIDGGASNNRIGTGNPTDRNVISGNTVADIGVSNNLNTTPL
FT                   NGNQIVGNYIGTTVSGDADQDTTSDPGNLGGISIENYAYNTLISGNLIGGYTGANAAGI
FT                   VLFSDSTSSGSPSIPRGTRITGNWIGVNPTGTVIANRIGILVSGGGTYGAINTEIGDPL
FT                   NPIAGRNYIGGNTNGGIVIADTTFASGPTTIAGNYIGVALNASGNPFPVGNGTINQTSG
FT                   GEGIFVGRNAVSTIIGPGNVIAGARTNGIRIRSGNTVVRGNYIGVDPTGTQTTTTTINS
FT                   PTVGYGTGDAGVWIENGSSSVIGGANLSDRNVIAAGNFAVTGSGAAVLIEPCASGCSAN
FT                   GNTVQGNYLGVRADGNGILVGSTIVADSEGLRITNANNNTVRNNLIGGVDRGINVRMNA
FT                   SNNLISGNRIGVRASSSDTPGSGTTTRRDGIQLNSGTNNRIEFNLIAFTGQNNTSAFNA
FT                   AHGIVVRSSNNQLFGNRLVRNGRLGFGHGIFVADNVTGVLISQNTTQDNAQDGIGLGSG
FT                   ANGDLAAPSFNAVTPGSPTVTGTTGCGAGCVVEIFTTSASVSDRNREGPVFLTSTTTGV
FT                   GGAFSVNVTGCLGYITATVHNPTTGNSSPFSNALDVNATDACSTPTATLTVTGGSSRAV
FT                   SIGSTSTYTLTLSHTSFVTRTYTLTLDSTRGWTSGPTLVELPPNGNTQLIISVAVPFTA
FT                   TAGDTDTTTVTARSDQTVSNPITLTTTAQAITIIPARPEVSPGQIVERTGNTVTFVHTI
FT                   TNTGQLVGTFSVIRPDGSSGLPVFSGTPPTGWNIQSATLSSSTLSPGATATLTIVANTP
FT                   ASTTLLAGDYPFSFRVRAISQQGSQTFTEQSDPATTDTVRVPVARSFSFTAQPPTSQQL
FT                   TPAATVNFSYILTNTGNITDTFIITPPTGTTPASSLSFSATPATAFTLAAGQSRPITVT
FT                   VTASASEPVGTYNFTVQAGVTGGSNPPANQTASGTVQVIGGGTPVFVGTPLVTPDPVLP
FT                   GGTATITVTVRNGGNAAAPFDFTQTLPSGWNLISNSSTCPSPVPADTTTCTYVVEVAVP
FT                   ATADGGAATVTIQAIARNGGQIPPAPDSTASVNATVTVATIRNLRFDPTPLNASADPGA
FT                   VITFSHTLTNTGNAPDAFTLNLSGLPTGWTATVVPTTTTTLARNASLTVTVQITVPTGI
FT                   SAGTTVTATIRATSQGNPAVSAEVLDSITVNAVNGAELSPGTTINSLPGATAIFTHTLR
FT                   NSGSTTITYDLSVRSGDAGWSALSVNPATSPILSPGSSTIVTVTVTIPTGAAAGTSNTI
FT                   TVEARATGDSTLLASAENVVQVGALRDVEITPARTVIALPNTTTVITHTVRNLGFTADS
FT                   YTITALQGDGHSAIATPNQVDLGPGESREIAVLLTLPAGLAADTVLSSIRVTATSRSDS
FT                   SITDSIFDSVRVGLVTGVALSSDRLQGIPDGSNRVIFSGIVLENLGNATDTFDLTVSGL
FT                   DSKFRASVVPTSVTLNGGAIDVGIVVTVDLPPIQPFALRHDVTLTATSRRDPDQRSSIR
FT                   LSMIYLTRQAIFGEPVFIPIISR"
FT   sig_peptide     494379..494459
FT                   /locus_tag="Caur_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 27"
FT   gene            499571..500005
FT                   /locus_tag="Caur_0393"
FT   CDS_pept        499571..500005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0393"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: rrs:RoseRS_3243 3-dehydroquinate dehydratase,
FT                   type II; TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33643"
FT                   /db_xref="GOA:A9WDN7"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDN7"
FT                   /protein_id="ABY33643.1"
FT                   /translation="MTKTILVLHGPNLNMLGRREPHIYGATTLAEINEALEQRGKAAGV
FT                   EVICIQSNHEGVLVDAVQTHGWTASGIIINPGALTHYGLSLRDALAMVSAPIIEVHLSN
FT                   VYQREAFRHTSVVAPIARGQITGLGWRGYLLALEWLLAEL"
FT   gene            complement(500264..501268)
FT                   /locus_tag="Caur_0394"
FT   CDS_pept        complement(500264..501268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0394"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: rrs:RoseRS_2838
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33644"
FT                   /db_xref="GOA:A9WDN8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDN8"
FT                   /protein_id="ABY33644.1"
FT                   /translation="MIDDAFVFDGVCHVFNFDKSNAFGKPGEMFIEHLYAFHQVLNAPG
FT                   EKTLSREEYMREWHVDEIARMIFDESPTDMIIAQPLPLTDLFKDGLSSWERCAEMARRY
FT                   PDRAVFWGSVNPLEGKKALDLMEIQVKEYGARGFKLYNVRYDYGQPFPWRMDDPRVAFP
FT                   IFEKALELGVNIIGVHKGVPLGPQPVEHTQAWDMDGAAANFPEINFIIFHVGLPFIDEI
FT                   CWQLVRYPNLYASIAATVNFVVRSPRVFAETMAKLLFWCGEDKIIYGGETPIWHPRGAL
FT                   KAFWEFELPEDIVQGYGCGQLTKEAKKKILGLNLARLHGFDVEEKKRSLGIAA"
FT   gene            complement(501265..501702)
FT                   /locus_tag="Caur_0395"
FT   CDS_pept        complement(501265..501702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0395"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   rca:Rcas_0663 protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33645"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDN9"
FT                   /protein_id="ABY33645.1"
FT                   /translation="MLRELSSVSCKQEVPMNETTTVGVGHDDVMAVLQRCYDPCCKERQ
FT                   VSVVDMGLVERVNVDGQRVAIDIILTTGWCPFALHLLQMMEEEVKTLPGIEQVQVNITW
FT                   DTPWSPERMSAQARERLRLPLEQLLPLREARLRRTQKEEAP"
FT   gene            502015..502524
FT                   /locus_tag="Caur_0396"
FT   CDS_pept        502015..502524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0396"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   rca:Rcas_3229 molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33646"
FT                   /db_xref="GOA:A9WDP0"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDP0"
FT                   /protein_id="ABY33646.1"
FT                   /translation="MSHQEHRRLAETQTTAIPCAVLTISDSRSEATDDSGRYICTALTQ
FT                   AGHNVVQYAVVRDEPAQIVEMVRRFAAEGCKVIITNGGTGISRRDSTFEAIDALLEKRL
FT                   PGFGELFRMLSFAEIGPAAMLSRATAGVFGGTLIFCLPGSPNAVQLGIDRLILPELAHL
FT                   VWETVR"
FT   gene            502604..503242
FT                   /locus_tag="Caur_0397"
FT   CDS_pept        502604..503242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0397"
FT                   /product="4-vinyl reductase 4VR"
FT                   /note="KEGG: rca:Rcas_0802 4-vinyl reductase 4VR"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33647"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDP1"
FT                   /protein_id="ABY33647.1"
FT                   /translation="MTSVEAFRGLYYPNKIGRLCFLSLEEVMGQNGVKALLRLADLQQY
FT                   IDAYPPNDLKREFPFEAISKYSVALGTMYGPRGARGLELRAGRVAFSLGLKEFGPLLGM
FT                   ADLALKLMPITMKLKIVLNATAQTFDRFSDQSSHVEEERGRFVYHITRCSNCITRPEPG
FT                   PVFYIARGILEEATAWVSGGRRFAVEQLSCMGQGNCSSCAFAIGKDPLE"
FT   gene            503247..503459
FT                   /locus_tag="Caur_0398"
FT   CDS_pept        503247..503459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0398"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   rrs:RoseRS_3917 protein of unknown function DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33648"
FT                   /db_xref="GOA:A9WDP2"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WDP2"
FT                   /protein_id="ABY33648.1"
FT                   /translation="MLRWLLLKLIRFYQVAISPWTPPSCIYTPTCSHYGYEAIKKYGAL
FT                   RGGWMTVKRIARCHPFARGGYDPVP"
FT   gene            503950..504624
FT                   /locus_tag="Caur_0399"
FT   CDS_pept        503950..504624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0399"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   rca:Rcas_0024 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33649"
FT                   /db_xref="GOA:A9WDP3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDP3"
FT                   /protein_id="ABY33649.1"
FT                   /translation="MAEPSRETIVRAQQGDQQALTELIIGQQHYVYSIAMSVLKNADDA
FT                   ADLTQEAFIRLFRALPQYSGESRFTTWLYRLVINLCRDELRRRGRQAPIVPPATDDEEL
FT                   DALHTVADNDRWVDPAQSLDLNQLRLEVRRALEQLEPHYRLVLTLYYFEDLKYTDIAEI
FT                   LDLPLNTVKSHIRRGKERLAQLLQTNEPPATRAVNQPKRSATDDHVVQITPLRLLPGWG
FT                   RR"
FT   gene            504628..505095
FT                   /locus_tag="Caur_0400"
FT   CDS_pept        504628..505095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0400"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: rca:Rcas_0025 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33650"
FT                   /db_xref="GOA:A9WDP4"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDP4"
FT                   /protein_id="ABY33650.1"
FT                   /translation="MSTQLPTPPPDDLLDAALRHELRWEAPPELTNRLLHLVPGAVPMA
FT                   TAEISPLPRWRLYVAIALMSLLILVSIPSASYLYQLVWFQWGFAQFIAQLEALPARLLQ
FT                   TFYETMPFARELVSIIALIRDQLHWLLVALVLWIILDNWQPERRLVHQESK"
FT   gene            complement(505523..506128)
FT                   /locus_tag="Caur_0401"
FT   CDS_pept        complement(505523..506128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33651"
FT                   /db_xref="GOA:A9WDP5"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDP5"
FT                   /protein_id="ABY33651.1"
FT                   /translation="MLARIALSLLLGFICGTTGLVFMPDLARVIGPLVCTGNLEPDRSE
FT                   GVLHFRCRTINGDEQRIKLGQMLPYAIISTSLLLIPPVHSAIRRFERRRAVIQQAIERD
FT                   LATALPARAEVLRVAIVGSYKRAILVRAVEVELTLWVYPPANRPYEARVIWLVEETGLS
FT                   HLRRGTMLNTRINPLRPQRVYPAESWASYIWSEPVPTV"
FT   sig_peptide     complement(506045..506128)
FT                   /locus_tag="Caur_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.695) with cleavage site probability 0.562 at
FT                   residue 28"
FT   gene            complement(506281..510324)
FT                   /locus_tag="Caur_0402"
FT   CDS_pept        complement(506281..510324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0402"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; CHASE domain protein;
FT                   PAS fold-4 domain protein; KEGG: ana:alr3120 two-component
FT                   hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33652"
FT                   /db_xref="GOA:A9WDP6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDP6"
FT                   /protein_id="ABY33652.1"
FT                   /translation="MAQWSRRALISFGVVYAVLIWVGAQPLLANRGIPLLWVAGGFAAG
FT                   GVLLAGKRLLPIIFIGAFIAYTVVFRQLGLSSERLLAAALVFGLSAIIQAWLVNWLVRR
FT                   FGRTLPPSSIRYTLVVCGLLALAVLPAPFLAVMVLVVVQQPLVSSPPIVALQWWLNLVA
FT                   GVWLVTPWMVLGEYYRQRRPMREPWLWPVSSLLLALMLFSLQLIWRDANRQFTTQLQAD
FT                   VNEVVSLINDRLTIYEQALLSQSALFLASQRVDQHEFSVFSRTQLARLPALRAVSWIPR
FT                   IPLQQRTAFEHAMQETGLPDFRIREPDATARPADTRDEYYPITYLEPFARRRAVLGLDL
FT                   AADPVRRAAIEQARDSGQVVITAPLQSYLASDPAPAVLLFAPVYSGSLPPQSVEERRQR
FT                   IRGMVAFLIVPGEVIEQALRPVTTPDLEFVLVDATEESLRPLAVFTGGRAVPSPYISDL
FT                   DIVIRDAVAISDIPRYGRVWSIAFCLGTNYLPFWWSADAISRTVLAIASVAIFFLFVAI
FT                   RQRHEARQRRLTRTYALLSAINQMIIRERDPQRIFQEVCQVGIGEGGFRLVWIGRHNLV
FT                   TSRFETIAIHSAKELDQSLVHLLTGEQLAMTLSPVCQGDRVVINDLATDPRCAAWRSQA
FT                   VAYGLRAMAGFPLVVPDEPPAVLCFYAGQPAAFDHDEIQLLDELVRDIIFGLLVSQQEA
FT                   QLRTSEQRNHLIVSALPDLVLRLRPDGQVVDVVAAESMVLPMAPTAMINSTLEQLFPAA
FT                   IATQYRQALSAAFASGELQTLAYQLIVEAKEYFFEARIKAALPAEEAIAIVRDVTAWRN
FT                   AELALQVERDLLAQRVAERTAELHRANAELLRAARTKDEFLANMSHELRTPLNSILALS
FT                   ESLLEELYGPLRDQQQKAIRAIEASGRHLLALINDVLDLAKIEANRIELVKEVVAASDV
FT                   CEASMALVKEQATKKQIHLSIQLDDPHARFVADPRRLKQILVNLLSNAVKFTPAGGAVS
FT                   LQVTTDTTQGTIAFTVSDTGIGIAEEDLSRLFQPFVQLDSGLSRQHEGTGLGLVLVRRL
FT                   VELHGGKVEVESMPGVGSRFTVTLPYQPVTHIAASSSADELPPVQLALIIEDSATTADQ
FT                   LARYLEELQIQPVICSYGKGAVEQVQALRPDLILLDVQMPDRSGWEILADLRRDPDLRQ
FT                   VPVIIVSVVDEPERGLAAGAAAYLVKPINRLMLRRALSQITVTKTTSSTAPRRPLSRRI
FT                   LLAEDNEVNRVTLSDYLVAQGYEVRVACQGKEALQIAAEWRPDLIIMDIQMPGLDGLEV
FT                   IQRLRADAAFAATPIIAVTALAMPGDRERCLSAGANDYFAKPIRLRQLVERIEQFLASS
FT                   QHAI"
FT   gene            complement(510394..510882)
FT                   /locus_tag="Caur_0403"
FT   CDS_pept        complement(510394..510882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0403"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: ttj:TTHB244 phenol hydroxylase component B"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33653"
FT                   /db_xref="GOA:A9WDP7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDP7"
FT                   /protein_id="ABY33653.1"
FT                   /translation="MSIDPREYRSTIGLFATGVTVITASDGDHIRGMTANSLTSVSLDP
FT                   LLLLVCVDRKARMAPVISAASHFAVNILRADQEAIARHFAGRPQPDIEVALEELAGAPV
FT                   LSASLATLVCSRERILDGGDHLIVLGRVIALRRAAEGDPLLYFAGAYRQLAEMSTTLA"
FT   gene            511410..511865
FT                   /locus_tag="Caur_0404"
FT   CDS_pept        511410..511865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33654"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDP8"
FT                   /protein_id="ABY33654.1"
FT                   /translation="MTITDRMLTGAIANNPGNYHGDGEWRYSITQRTIYFSKAAAPDPR
FT                   DQEPFFPLPSLNPDGSGRMERAFRQFIRRRWPPSRCTELEKFAERRGWHLAMELKYGGG
FT                   ALEDHEAAEWQYVVNRELQRLAAEVRARIAELEQQATQSEPTPASGG"
FT   gene            complement(511828..512208)
FT                   /locus_tag="Caur_0405"
FT   CDS_pept        complement(511828..512208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33655"
FT                   /db_xref="GOA:A9WDP9"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDP9"
FT                   /protein_id="ABY33655.1"
FT                   /translation="MNVKALQRGFWLSFWSVVIYMIVRGALIPARLRHPRITSLSGIEP
FT                   MYAMLSWGYGPGSRPVNVIFDVQFAGGAQGSVTVDGEALEAEVPLIGKAQPGESYTITA
FT                   TLVYRQLGRAFTRQMQVSAQIE"
FT   gene            complement(512205..512492)
FT                   /locus_tag="Caur_0406"
FT   CDS_pept        complement(512205..512492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0406"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   mgm:Mmc1_3700 protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33656"
FT                   /db_xref="GOA:A9WDQ0"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDQ0"
FT                   /protein_id="ABY33656.1"
FT                   /translation="MKPAQRAYLRRLAHPLPVTVMIGKNGLTEGILAKIEQELNAHELI
FT                   KVRFLDHKDMKQSLTETIVSETGADLVAIIGHTAILFRQHADPTQRKIQV"
FT   gene            complement(512489..513274)
FT                   /locus_tag="Caur_0407"
FT   CDS_pept        complement(512489..513274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0407"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rca:Rcas_1701 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33657"
FT                   /db_xref="GOA:A9WDQ1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDQ1"
FT                   /protein_id="ABY33657.1"
FT                   /translation="MTTNNEPFLSIVIPAYNEERRLPATLAAIKAFLVNEPYTAEVIVV
FT                   DDGSEDRTAEVAEAAGATVLRCEHRGKGFAVRTGALAARGDIILLCDADLATPIEEWPR
FT                   LRAAIERGYPIAIGSREGIGASREGEPWYRHVMGRVFNWIIRLVALRGINDTQCGFKAL
FT                   RRAVARDLFQRVRIYGDDAPIVRGAAVTAYDVELLFLAQRRGYAICEIPVKWRYGTETK
FT                   VNPLRDSWRNLRDVLRVRINDLCGKYDVTSTPIEEVAPR"
FT   gene            complement(513271..514233)
FT                   /locus_tag="Caur_0408"
FT   CDS_pept        complement(513271..514233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0408"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rrs:RoseRS_1415 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33658"
FT                   /db_xref="GOA:A9WDQ2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDQ2"
FT                   /protein_id="ABY33658.1"
FT                   /translation="MIDVVVPNYNGSALLPTCLDSLRAQTRRDFTVTVVDDASTDDSVA
FT                   LITTRYPEVRVLRLPQNRGFAAAVNAAFAATREPFFVLLNNDTEADPNWLAALIGALER
FT                   WPQFAFAAAKLRLFDRRNIIHSAGDFYRPNGEPGNRGVWEEDRGQYDAFHEVFGPCAGA
FT                   AAYRRCALEQLAEDGRVFDEALVMYCEDVDLNLRARRKGLRTIFVPTAVVYHRLSASGG
FT                   GVLASYYCGRNFPLVWVKNMPPVVQRRYWPALLVSQLRFALHSLRHFREPAARARLRGQ
FT                   LAGLRALPHFWSRRAFTPEEEAALVAAFELSQPPAQRFV"
FT   gene            complement(514230..515084)
FT                   /locus_tag="Caur_0409"
FT   CDS_pept        complement(514230..515084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0409"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: rca:Rcas_1699 dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33659"
FT                   /db_xref="GOA:A9WDQ3"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDQ3"
FT                   /protein_id="ABY33659.1"
FT                   /translation="MRIAITGANGQLGRALIATLADQHTLVPLGHDQLELTDPVTVEQI
FT                   AATDADVVIHAAAYTNVDGCARDPGLAYRVNGLGTRYVALGCRRIDAALVYISTNEVFA
FT                   GDARRPYFEDDPPRAINPYGQSKLAGEQAVRSLVARHFIVRVAWLFGGERNFVRTVLRL
FT                   AANPPAHGLRMVADEIGSPTYTFDVAAGLARLITTDYYGTYHFVNDGICSRYEFAAEIL
FT                   RRVGLNIPLQPIRLCDFQRDSTPPPYTPLANLAGASLGITFRPWQDALADYLGRLPNEV
FT                   LPT"
FT   gene            complement(515326..516807)
FT                   /locus_tag="Caur_0410"
FT   CDS_pept        complement(515326..516807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0410"
FT                   /product="PAS sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold domain
FT                   protein; KEGG: rca:Rcas_3604 putative PAS/PAC sensor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33660"
FT                   /db_xref="GOA:A9WDQ4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDQ4"
FT                   /protein_id="ABY33660.1"
FT                   /translation="MEQNTILIVDDDELMRSLLIEIITPFNLRLITAQRGDQALQLAQQ
FT                   HLPDLILLDVMLPDMNGFEVCQRLRDDPATAQIPIVMITALNDREAKIHGFEAGADEFI
FT                   TKPFDPGELQARINTVLRLNRYRRLLQEQAKVNVERARFEWVIETSDNAYVIIDHDDQI
FT                   RYANRRARTYLGLTANEQPVRPFRELVTQRYRLVPPEAWEQWPIGAPELLYLVHPETSR
FT                   SPEQWLQVEAARIHPSDDQIVVTLCDVTQQITLQRDMWTFHTAISHKLRTPLVSYLGGL
FT                   NLLYDNIEHMDRTMARNIAAIALSAAKRLQQVIDDIFLYVRSPGDIHYDNCTVFDLPAM
FT                   VSTLNQELEIPAISLSIDPVLDARRLRISRRSLEMVLRELCENARKFHPQQRPMVTIRV
FT                   DADLAQNQVRLVVCDDGVHLPPAHLQKIRQPYYQAERNFTGQVEGMGLGLAQVARIILA
FT                   VGGSYQMRNRSDRPGICVELRIPFVEEDSSDRVIG"
FT   gene            complement(517036..517461)
FT                   /locus_tag="Caur_0411"
FT   CDS_pept        complement(517036..517461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33661"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDQ5"
FT                   /protein_id="ABY33661.1"
FT                   /translation="MYIRWVVRKHKNAEIANTNFYDAYLVESYRDERGQPRQRTVAYLG
FT                   NIRQINNEFPTIERELFLLRADRILDTLPELTESDRQEIREALRRKIPPLNRDEVIRAF
FT                   TANLTWYRQWWEQNGCPLTDDELLSIIRATRGGMEAV"
FT   gene            complement(518662..535179)
FT                   /locus_tag="Caur_0412"
FT   CDS_pept        complement(518662..535179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0412"
FT                   /product="conserved repeat domain protein"
FT                   /note="KEGG: ddi:DDBDRAFT_0184530 colossin A; TIGRFAM:
FT                   conserved repeat domain protein; PFAM: protein of unknown
FT                   function DUF11; Thrombospondin type 3 repeat; Cna B domain
FT                   protein; SMART: Fibronectin type III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33662"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDQ6"
FT                   /protein_id="ABY33662.1"
FT                   /translation="MLRQNIVAARRTLLSLLLILTVVLAGLRPDVALANATTDVTLSTN
FT                   FPVVNSGDWSVINVDYSCSSVLNTPCENATVTVVLPPTLAGGVGDVQALGAGTSPSYNP
FT                   ATRTVTWTFNAPLAAGDSGRLELRVRFPAGSTPDGTTATLRAEMRSTTAPPDLSNPLTI
FT                   TARAEPNAVATKTFVSGGAPDVPTTYQLQVCIPNNGSGALNLTNVQITDTLPTGVTFVS
FT                   ASDGGTFNGATNTVTWPPTSLTVPGSLCATRTVTVIFPSATFTVGTEVRNVMDVTAQAG
FT                   SVTITLTDDDVRRIQPPTPGYGFTKNGPTTALVGDTVTYTFNTINTGTTPLNDVVVTDP
FT                   VPPELQVTRITAAGGNIAGVRVELEYTTNLNPTFTAVPGSPFTTTSCVNIAPNTGGGCT
FT                   TLTLGAGEQITAIRWRYLDPLPFGFSATGHNFSAVVTASPINGVVVNQATSTFTYNGFT
FT                   ATRTDEARTRIIEPGARAEVAKSVSPAVAYAGDTVIYTITLANTAVGSPAAALINPMLA
FT                   DLLVPALIYVPGSATVVSRPAGAPDPVLEVIEDFNGTGRTLLRWRWDSYSLPPNASFTL
FT                   RFEARIDPATQAGTINNTASLASFANPAGEIFIDRCSQQNPDSNDFDGDGNITELLCSS
FT                   SITSLSLAAAANASSAKWVLGQLDTEWTRDPDTGLTTPGGMADYRLIITNTNSVPLTNL
FT                   VLIDILPWVGDVGVVRFNDPRDSQWQPYLAGPIVVPDGATVYYSTTNNPCRNPDLGLTD
FT                   ANGDPIDAPGCVDPQWSTVLPSDITTVRSVRIDFGSRVLYPQDSIVITWPMRAPLGGTP
FT                   GEIAWNTFGYRAFDINGNPLLAAEPPRVGIERGPVIPPSYGNYVWLDANLNGVQDTGEV
FT                   GVNGARIDFYQDSDGVAGPSTGDRWVGFTISGPDNDGNPGYYLFSDPTDIPPGDYYIRV
FT                   TPPAGYSLTTPDQGGDDSRDSDINLTTRYSAVTTLISGENDDTWDVGLINDTAVGNYVW
FT                   IDRNGNGVQDEPSGDGVNGITVRLYTASGTLVDTTVTADDLLGNPGYYLFSGLSAGNYY
FT                   VEFVLPAGLNFTTADSGSNDQLDSDANPTTGRTDVFTLVTNQFDRSRDAGLLVPAGTLA
FT                   LGNRVWHDRDNDGRYEPLNGEAGINGVRLSLFRDVNSNGQPDAGEYVGSSTTATVSGEA
FT                   GYYQFTNLVAGDYIVVIDDDNFAPGGALFGMRSSSGNDPAPDPDTNVDHDDNGALFGAT
FT                   VRSQPITLTINGEPTDDGDGTNGNQTLDFGFVNGAALGDRVWFDTNSNGIQDAGEPGVA
FT                   GVTVELLDGSGNPIDSDPTTSGVQPTITVTDGVGRYGFSGLAAGTYQVRFSNLPAGYSF
FT                   TTADQGANNDLDSDVNNAGLTPVITLAANQTDLSWDAGLVATPASLGDRVWNDLDYDGI
FT                   QDAGEPGVSGVQVQLYRPGYDNVAGTTDDELVATTTTDSNGNYGFTNLPPGRYFVAFGS
FT                   PPAGFAVSPTDQGSDDTVDSDADLTTRRTAIIELTPGENDPNWDMGLFVFASIGDRVWS
FT                   DTNNNGIQDTGEPGVGGVQVRLYRPGSSVPVATTTTNSSGFYSFTNLIPADYYVEFSLP
FT                   GGYRASPQNQGSDDTLDSDADPITRQTATTTLDPGENDPTWDFGIVPTASIGDRVWLDL
FT                   NANGIQDASETTGVPGVQVVLYDSAGNPLNTTVTDVDGFYRFENLLAGDYYLRFVVPAS
FT                   FIISPQDQGGNDNADSDADPTTFLTVATTLSAGENDLRWDLGLYQLASIGDRVWHDING
FT                   NGRQDGGEPGVANVPVELYQPGNDGQAGTADDVLVASATTDGIGEYLFSNLQPGRYFVA
FT                   FGAASGYSLLSPRDAVVATDETDSDVDANRRTPIVELLSSTSNRTLDMGVLNPASLGNR
FT                   VWFDADVDGVQDPGESGVSGVTVRLFALDGTLVATQTTDANGEYLFTNLSPGEYYVVFS
FT                   NLPANRSFTRVDQGGDDTADSDANPLDGRTGIVRLNSGDANLTVDAGIFETITVGDRVW
FT                   LDRDADGVQDIDETTGIPGVRVELLRDSDGTVLDYTFTDSNGLYQFTNLFPGTYRIRFS
FT                   EIPTGYLRSPQDQGSDDQLDSDANSSFETAPFTPVSGNNPQYDLGLYQPAEIGNFVWED
FT                   RNGNGRQDAGEPVLANVTVTLNGTTGAGDPVSLTTQTDSNGIYLFANLVPGTYTVSVSA
FT                   PAGYVFTAANQGDDTGDSDTNASGVMATTTLESGESDLSWDAGLYRPASIGNFVWRDTN
FT                   GNGVQDSGESGIDGVTVTLTGTTGSGSPVSLTITTGGGGIYSFTNLAPGSYQITVTAPT
FT                   GERFTYRDITATEVAGATDNNDSDADNAGAMIATTLDSGESDLSWDAGLVIPASLGDFV
FT                   WEDLDGDGVQETGEPGFANVTVELIGAGRDRTFGTADDTLATTTTNGSSGYGFTDLQPG
FT                   LYRVRFTRPNGYGFTVGDATAATDATDSDVPTGTAATATTTTIDLESGENDPTWDAGLY
FT                   QLLSLGNRVWEDTDNNGQINGSETGINGVTVRLYRDLNGDGDVSDSGETTPVATTTTAN
FT                   GGYYLFSGLVQGNYLVEVVLPAGYVSSTGTNGSATGAYEPAPDADTNTTDSDDNGTRSG
FT                   GVVRSTIVRLAPNSEPTAESDPLPGSITDPARNENSNLTVDFGLFRPASIGNLVWFDRD
FT                   ADGVQDGGDETGIGGVTVRLYDASNTLIATTTTAADGSYGFDYLIPGNYYLVFDLPTDY
FT                   VRSPQDQGGNDTADSDPDRTSGQTIVTNLVAGESDLSWDAGLYQRVNLGNQVWNDVNNN
FT                   GLLDSGESGIDGVVVDLYYDADRNGIIDGSEETPIATTTSAGGGFYNFTDLDPGNYLVE
FT                   IPASNFAGGTALGPSGNQPAFRSSTGTNGSATGPYEAAPDPDNNVDNDDNGTTDGSGAV
FT                   RSALITLRSQDEPTGDGDGNNGNLTVDFGFFRPLTLGNLVWHDVNNNGQRDSGEAGIDG
FT                   VTVQLYRDTNANGSYDAGTDTLVATTTTGGGGDYRFTDLVPGDYLVVIPASNFGTGGAL
FT                   RFYRSSDNGNATDTANDPDGDIDNDDNGIGPNVGVVTGAATDLVRSTAVTLGLDGEPTG
FT                   EDGDSNTNLTVDFGFYSLTIGNRVWIDLNNNGVFDAGDINGGYANGRTVNLLYDANNDG
FT                   VISGSETTAVATITTSNGGRYLFGGLRDGGNYAVEVVSDASNVSSTGVNGSASGPYEPG
FT                   LDPDSSTVDNDDNGTATGNNERSPVFTVRVGLMPTGEPDAVMPAGVTNPAADANSNLTI
FT                   DFGLFDDARIGDQVWLDVNGNGIRETGETTYIAGVTITIYNATTGQPLDGDPNTPGIQP
FT                   ITRTSVAAATSYLFDRLIAGTYYLAFSDIPAQYAISPLGQGGDNTVDSDVDPSSLRTAN
FT                   IVLTNNNDLSWDLGLYPRLTLGSLVWYDSNDNGLVDGGESGISGVQVDLYRDSNNNGQP
FT                   DAGEFVASTTTDATGNYSFTGLEQGNYIVVIPDSNFAIGQPLYRHRSSTGSNGAATGPY
FT                   EPAGDPDNNSDNDDNGTDTSNGVVSGVISLNPSVEPTTDGDGANGNLTLDFGFFEPLTL
FT                   GNLVWHDVNNNGQRDSGEAGIDGVRIELYLDSNGNNQVDAGEFVAFTTTASGGLYTFSD
FT                   LIEGNYIVRIPASQFGAGQPLAGFVSSTGTNGSATGSYEPAPDPDSNIDNDDNGTTSGS
FT                   GNVDSAPVTLARSTEPTTDGDGDNGNLTVDFGFFRHARLGDRVWHDQDADGIQDTGESG
FT                   IGGVSVQLFSAGPDNAIGGGDDALVATTSTDGSGVYGFSHLLPGNYYLIFAQPTGYSDV
FT                   SPQDQGSDNAADSDVDPVTRQTPLITLAAGDNDPSWDMGVFNRVSIGNFVWEDTDGDGV
FT                   QDSGEPGVANVTVLLNGTTGAGTVVNLTTTTDSNGFYRFNNLAPGTYTVTVQLPTGYAF
FT                   TAANQGSDDGLDSDADPTTGAMSATVLTSGEVDLTWDAGLYRPASVGDRVWLDSNGNGL
FT                   QDTGESGIQSVAVAIYSVGPDGVIGGGDDVFVAATSTDSSGNYSFSGLRPGSYYLLFNL
FT                   PAGYNISPQDQGSDNTIDSDVNPISRQTTVITLASGDNDPTWDMGLYQPASVGNVVWHD
FT                   VNGNGVQDTGESGIGNVTVTLYRADGSMVGSTTTAADGSYSFTNLPPGEYYLVFSNLPS
FT                   GYVFTAADQGGDDAADSDASQSTGQTATFTLVSGQVDERWDAGAYQPASIGNFVWEDTD
FT                   GDGVQDGTESGVANVTVRLNGTTGAGAAVTLTAITDSDGFYRFDNLAPGTYTVMVQASA
FT                   GYAVTATDQGGDDARDSDADPNTGVMSATELESGEVDLTWDAGLYRPASIGDRVWRDTN
FT                   GNGIQDSGEPGVANVTVQLSGTTGAGAVVAQTTTTDGDGLYRFTNLAPGTYTITVTAPA
FT                   GDGFTAADQGGDDSRDSDANSSGVMSATTLVSGEEDVSWDAGLFGAASIGNFVWEDING
FT                   NGVQDAGEPGIEGVEVQLTGTTGIGTVVNLTTTTDSDGFYRFDNLAPGTYTVAVQSPGG
FT                   YVFTTDNQGSDDARDSDANPATGEMSATVLESGEVDLIWDAGLYRPASIGNFVWEDTDG
FT                   DGVQDTGESGIGNVTVTLYRADGSPVGSTTTAADGSYSFTNLPPGEYYLVFSNLPSGYV
FT                   FTAADQGGDDAADSDASQSTGQTTTFTLVSGQVDERWDAGVYQLTSVGDLVWLDRNGNG
FT                   VQDVGESGIENVTVTLYRADGSTVGSTTTAADGSYSFTNLPPGEYRLRFTDIPSGLTFS
FT                   PADSSGDDTTDSDVTATNGETDVFALLSGQSDTNRDAGVYPLLSLGNLVWEDTNNNGVV
FT                   DSGESGVGGVQVRLYRDSNSNGTWDASDQEVASTVTDGNGVYRFTNLPQGDYIVVLPGR
FT                   QFEADSPWFNYRSSTGARSLSGGPYEPGVAANGDLDNDDNGTRQSDVDSSFNIVSSLIT
FT                   LRPDGEPDTAVDGDDRNSNLTVDFGIFRPATVGDLVWNDLNGNGIYESTEPGVANVLVT
FT                   LYDVGDDGIAGTSDDVMVATQRTDDDGFYLFENVPPGDYYLVFSDLSGGARFTYPDRGG
FT                   DDASDSDADPGNGATTTFTLQSGSENLDWDTGLILPASIGNLVWEDRNGNGVQDGGESG
FT                   IAGVTVRLTGTDSDGNSVDVSVVTDIDGVYRFENLLPGNYTITVAPPAGYVFTAADQGS
FT                   NDALDSDADPNTGAMNATVLESGEVDLSWDAGLYRPASIGNFVWEDTDGDGVQDGTESG
FT                   VANVTVLLNGTTGAGTVVNLTATTDSNGFYRFDDLAPGTYTVTVQVPAGYVVTVANQGS
FT                   NNALDSDADPDTGAMNATVLESGEVDLTWDAGIFLPATLGNRVWHDINANGIADSGETG
FT                   VSGITVSLYRADGTLVQTVVTDSNGAYLFTNLPPGDYYLTFSLPNGWVFSPSGQGGDSG
FT                   RDSDVDPDTQRTQVFTLGYGQTDLSWWAGIHQPAPPTAITLLSFTAERQANGVLLRWVT
FT                   GSERDTLGFLLLRSSTGNRADATPILSTPIPAQGSAGSGASYQWFDRTAQPNVSYHYWL
FT                   VEVEVDGDRHEFMLSSPAVQFTYRVLVPIIQR"
FT   sig_peptide     complement(535102..535179)
FT                   /locus_tag="Caur_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.468 at
FT                   residue 26"
FT   gene            536993..538351
FT                   /locus_tag="Caur_0413"
FT   CDS_pept        536993..538351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0413"
FT                   /product="PUCC protein"
FT                   /note="PFAM: PUCC protein; major facilitator superfamily
FT                   MFS_1; KEGG: rrs:RoseRS_1912 PucC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33663"
FT                   /db_xref="GOA:A9WDQ7"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR026036"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDQ7"
FT                   /protein_id="ABY33663.1"
FT                   /translation="MGLLRFAVKTFRLSLMRVGAGWMFALLTFNFNRVSISDLGAMAVI
FT                   VTTLIGLHHFISFFQVYWGRFTDRYPIFGLRRTPYVILSNVGAALIFLALPSIAVGLGE
FT                   RSIIATIEAFALIFLFGVLMAMNGSSSNALIAEVTTPKERGAVVAFIWATVIISGIVSA
FT                   GISRVIMPVYSPEAMQQLYNLTPIIVTVTVLLGVIGLEKPISKEEHRKLLEQAPEKGEA
FT                   GPLETWRVATGLMKRNPQVRGFFAFVLLAILGIFLQDAILEPFGAEVFGMPQKDTAAFQ
FT                   QAWGAGALLGMLGIGILSSIFPIQKKTIATLGGLGVAGGLAMLMISALTLHREIISPAL
FT                   LIMGLGIGLFNVGALAMMMEMTVEGQTGLYMGMWGMAQGLGNGFANVISGLGHTVMIEG
FT                   GLVTPSVGYGLVFGLEALLMVLAIGILRGISVQEFKGLTRQEITTALAMDAAS"
FT   gene            538382..539203
FT                   /locus_tag="Caur_0414"
FT   CDS_pept        538382..539203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0414"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rca:Rcas_1535 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33664"
FT                   /db_xref="GOA:A9WDQ8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDQ8"
FT                   /protein_id="ABY33664.1"
FT                   /translation="MPLPITFDQIADVYDAQRAHPAEVSTAIGQAIVDQAGSGARVLEI
FT                   GIGSGRIALPVAAAGATVIGIDISAGMLHVAHRRAEETGTPLHLVQADAQYLPFATATF
FT                   DAVLAVHVLHLLPNWRAGLAEMVRVTRPGGVIIQGVDWRDPASCVGLLRGQLRQTVMDL
FT                   LPGARPPGAGAAVSQHLAKLGAPVVEEGIVAARWHRTLSPAEVIAGMAARSDAETWALS
FT                   DEVLQTAIERVQGWAAQQWPDLNERQEVEHRFLLTVSRVSTAPANDQRGGR"
FT   gene            539203..539691
FT                   /locus_tag="Caur_0415"
FT   CDS_pept        539203..539691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0415"
FT                   /product="2-vinyl bacteriochlorophyllide hydratase"
FT                   /note="PFAM: 2-vinyl bacteriochlorophyllide hydratase;
FT                   KEGG: rca:Rcas_3748 2-vinyl bacteriochlorophyllide
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33665"
FT                   /db_xref="GOA:A9WDQ9"
FT                   /db_xref="InterPro:IPR009905"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDQ9"
FT                   /protein_id="ABY33665.1"
FT                   /translation="MYTPEQLERRNRSPWTKAQFILAPIQFIVFIISFALVIRYLATGE
FT                   GYWVATVSVWIKIALIWALTITGMLWEHDIYGKYFMAREFFWEDLGNLIAILTHNAYFV
FT                   AVWLHLDSRTIMWVMVFAYVTYLFNAGQFLWRGIRSAKERRLLQAQLQAQSAGMAKPS"
FT   gene            539752..540741
FT                   /locus_tag="Caur_0416"
FT   CDS_pept        539752..540741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0416"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rrs:RoseRS_3261 alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33666"
FT                   /db_xref="GOA:A9WDR0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDR0"
FT                   /protein_id="ABY33666.1"
FT                   /translation="MPIKSRAVVIPKRNTIEIRTVQVNEPKAGDVLIKTAFTSISAGTE
FT                   RMLLDGRLPQPQLLFPVVPGYETVGQVVQVGSKAPKELLGQWVYIGGARCFRGVNAAWG
FT                   GQSEYITAEHERVVPLGSLDPATGVLLALAATALHGIKIGQIRRSDRVLVLGQGIVGQL
FT                   AARLAKYAGAQHVAVADRVAVRLQASQADQVIDVTRESLDEAIGEAKVDVLIEATGSMG
FT                   ALSGALPLLANHGRVVLLGYYDHINIPYAPVFMREAQILVAREWEFGPDGDLPRVRDLL
FT                   ANGDLKVDGLLTHHVPLDRIQAAYRLALEDPACLKVVVTWPQNGTDAA"
FT   gene            540839..542029
FT                   /locus_tag="Caur_0417"
FT   CDS_pept        540839..542029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0417"
FT                   /product="chlorophyllide reductase iron protein subunit X"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: rca:Rcas_3746 chlorophyllide reductase iron
FT                   protein subunit X; TIGRFAM: chlorophyllide reductase iron
FT                   protein subunit X; PFAM: NifH/frxC-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33667"
FT                   /db_xref="GOA:A9WDR1"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR010246"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDR1"
FT                   /protein_id="ABY33667.1"
FT                   /translation="MLAVYGKGGMGKSFFTTNLVSKLALLGNRVLQLGCDPKHDSCNAL
FT                   FGGISLPTLGDVWREFKEAGREEELAAHHVIFKTTIMNGAATVYGCEIGGPEVGRGCGG
FT                   RGITFGFDMLEKFGLSQWALDYVVMDFLGDVVCGGFATPLSRSLAEEVIILCGNDRQSL
FT                   YAANNIASAAKYFASMGGRTKLLGLVVNRDDGSGVAARFAEKINLPVLASIPLDRKVRE
FT                   LADACQLALQEPRFDALFDRLARQIIDRTLPTVKMEEVQPLPYKEFLSVFGAEEPDITP
FT                   TGATAEELFGDHQVRQPAPVITLGLMERAVGEKPEMDAPTRLVVTRLLKELGMYVTEAN
FT                   HDPKKGMTLTIDGHTTVCIGNTDDLDSKIAILAALQRSGEPFRYVDLRRPASPFYR"
FT   gene            542161..542988
FT                   /locus_tag="Caur_0418"
FT   CDS_pept        542161..542988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0418"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   rrs:RoseRS_3259 protein of unknown function DUF169"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33668"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDR2"
FT                   /protein_id="ABY33668.1"
FT                   /translation="MALGPNCGGTERGKPRFTKPVVEALMSENDEIPDLKLLNRLLVER
FT                   MRVKRRPVAITYCYDGPPPGYEPVNVVACAIVREAEQGRRVYVDANHHDCWVGQYHLGF
FT                   NPDPGPYITQGIYLTDAQGFYTPEAAACNKQQSYSLPAGMIKALAAAPLDDVPDGVPVD
FT                   LMVCVVDPQRAMQIAGAASVRIGTFPVGELGASACASIFAAPWHTKNSVFAIGDGGGRM
FT                   HNRLDPSEMFVSIPRSHLRYVVELIENFRIDPQKMREVIMPSYAAKAQQSREE"
FT   gene            543327..544439
FT                   /locus_tag="Caur_0419"
FT   CDS_pept        543327..544439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0419"
FT                   /product="magnesium chelatase ATPase subunit I"
FT                   /EC_number="6.6.1.1"
FT                   /note="KEGG: rca:Rcas_1544 magnesium chelatase ATPase
FT                   subunit I; TIGRFAM: magnesium chelatase ATPase subunit I;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33669"
FT                   /db_xref="GOA:A9WDR3"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011775"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDR3"
FT                   /protein_id="ABY33669.1"
FT                   /translation="MSKEHVQTIATDDVSKNGHTPPTNASTPPYPFVAIVGQAELKLAL
FT                   LLCVVNPTIGGVMVMGHRGTAKSTAVRALAAMLPPIKAVAGCPYSCAPDRTAGLCDQCR
FT                   ALEQQSGKTKKPAVINIPVPVVDLPLGATEDRVCGTLDIERALTQGVQAFAPGLLARAN
FT                   RGFLYIDEVNLLEDHLVDVLLDVAASGVNVVEREGVSVRHPARFVLVGSGNPEEGDLRP
FT                   QLLDRFGLHARITTITDVSERVEIVKRRREYDADPFAFVEKWAKETQKLQRKIKQAQRR
FT                   LPEVILPDPVLYKIAELCVKLEVDGHRGELTLARAATALAALEGRNEVTVQDVRRIAVL
FT                   ALRHRLRKDPLETQDDAVRIERAVEEVLVP"
FT   gene            544494..546398
FT                   /locus_tag="Caur_0420"
FT   CDS_pept        544494..546398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0420"
FT                   /product="magnesium chelatase ATPase subunit D"
FT                   /EC_number="6.6.1.1"
FT                   /note="KEGG: rca:Rcas_2540 magnesium chelatase ATPase
FT                   subunit D; TIGRFAM: magnesium chelatase ATPase subunit D;
FT                   PFAM: von Willebrand factor type A; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33670"
FT                   /db_xref="GOA:A9WDR4"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR011776"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDR4"
FT                   /protein_id="ABY33670.1"
FT                   /translation="MVQKAIALPAAPLPFTAIVGLDTARQALLLLAVDPSLAGVAIGAG
FT                   AGTGKSALVRAFARMLAGGREFDPTIPWQLVEMPVGVSEDRLLGGIDIEATLATGERVH
FT                   RSGLLARANGGMLYVDSVNLLDDSTINHILSALDSGVVRVEREGISVVEPARFVLLVTY
FT                   DPAEGPPRRHLLDRLGLIVAPIGKAPVTTRAEVVRRNLQPGTDYEDDEALVLAGILAAR
FT                   ELLPSVTISDEQVQQLSLTAMALGIEGHRADLFAVRAARAAAALAGREEVNNDDLELAV
FT                   RLVMLPRATRLPEMTPEEAGPPPPPEPAPPPPSPENSDDEQRDDEEEKPPQPPEDELTI
FT                   EELILAAMETDVPPDILETPFTVRRRGRSGSRGTISGQRGRHIRSVPGKPAQGRLDVIA
FT                   TLRAAAPWQRIRAAEYHPHRRGRIHLRADDLHIKKYRSKAGTLFCFLVDASGSMALHRM
FT                   RQAKGAVNALLQQAYVHRDQVALLAFRGERADLLLPPSQSVELAKRALDVLPTGGGTPL
FT                   AAALLAAYQISEQARSRGIFRTTIVLITDGRPNVPLKADPTMDKARRLEQARQEVQQLA
FT                   GRLRAAGVGAVVIDTQRSFVSRGEAQQLAAWLGGRYVYLPNGRGDQIANAVIAASEEG"
FT   gene            547601..549094
FT                   /locus_tag="Caur_0421"
FT   CDS_pept        547601..549094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0421"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: rrs:RoseRS_3807 AAA ATPase, central domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33671"
FT                   /db_xref="GOA:A9WDR5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDR5"
FT                   /protein_id="ABY33671.1"
FT                   /translation="MPPKPRGTTLFDAQRQQALQQQAPLAARMRPRTLEEFVGQHHLVG
FT                   EGKLLRRAIANDQLFSLILWGPPGSGKTTLAQIIAHSTKAHFEPISAVSAGVNDLRRVV
FT                   QEAQDRLGMFQQRTVVFIDEIHRFNKSQQDAILPYVEDGTIILIGATTENPSFEVNSAL
FT                   LSRARVFKLEALTDEEIGVLIDRALTDRERGLGDLKIMLARDARDYLVNMANGDARTAL
FT                   NALEAAARSKPPAIGETRLITVDDIRDALQSRAVRYDKHGELHYDAISALHKSVRDSDP
FT                   DGALYWLGRMLDGGEDPLYIARRLVRIAVEDIGLADPQALPQTIAAQQAVHFLGQPEGE
FT                   LALAQAVVYLCLAPKSNALYRAYGAVQRDVAETRNEPVPLHLRNAPTQLMKRLGYGKGY
FT                   EYAHDLPEGRSDQEHLPPNLAGRIYYEPTGRGFEAEARERLAWREKRRLQTPPTPPPVS
FT                   EPAPGEESQLPPDELAPGEEPQLPPAASASRRREKRGKV"
FT   gene            549171..550328
FT                   /locus_tag="Caur_0422"
FT   CDS_pept        549171..550328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0422"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: rca:Rcas_1073 FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33672"
FT                   /db_xref="GOA:A9WDR6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDR6"
FT                   /protein_id="ABY33672.1"
FT                   /translation="MIERAQVVIIGAGVIGASIAFHLAERGLRDVIILEREETEISGST
FT                   ARSAAGVRHQFSSRTNVLLSRYSIERLRHFEEEVGGHAELRQVGYLFLINDEQTWAQYM
FT                   RNVAMQRELGVRVEVLTPAEAARFIPQMRTDDLIGATFGPDDGYCDPYGIALGYLRAAQ
FT                   RHGVRLYRGRPVTGFHIQGGRVTAVETPAGTVGCEFVINCAGPWAGEVAALAGLDLPVR
FT                   PYRRNVYMTTPFPAISAPIPLTIDVGSGFYMRREGQSILMGRSNPNEPSSTNTNVDWDW
FT                   LEAVIEAGIHRFPILETAGLAEQQCWAGLYEITPDHNPILGRHPDLAGYIDASGFSGHG
FT                   IMHAPATGLLIAEEVIDGRAHTINIDELRIDRFRSGHLASEFNVI"
FT   gene            550343..550588
FT                   /locus_tag="Caur_0423"
FT   CDS_pept        550343..550588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33673"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDR7"
FT                   /protein_id="ABY33673.1"
FT                   /translation="MTLDEAIAEIKRRIAEVSPSAVTRVTRVSAEEASIRAYAPAADEQ
FT                   AIKNATNEFTLSLLTNEGLEVQVLVYDITTSLPPEE"
FT   gene            complement(551032..551799)
FT                   /locus_tag="Caur_0424"
FT   CDS_pept        complement(551032..551799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0424"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rca:Rcas_0668 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33674"
FT                   /db_xref="GOA:A9WDR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDR8"
FT                   /protein_id="ABY33674.1"
FT                   /translation="MATLEIRAIRKTFTTPTGPVVVLDGLNMQVAAGEFVAVIGPSGSG
FT                   KTTLFNIIAGLETPDAGAVVIDGNDVTGCRGQVAYMPQRDALLPWLSVVENAVLATVVQ
FT                   GGDVAAARREARALLADFGLQGWGDARPAMLSGGMRQRAAFLRTVLWHRPVMLLDEPFG
FT                   ALDALTRAQLQQWLLSLWDRLDRTVLLVTHDIDEAIILADRIYVLTPRPARIALEVRVE
FT                   LPRPRSYALVTDQAFARLKRQLQAVLMEGERYA"
FT   gene            complement(552172..553161)
FT                   /locus_tag="Caur_0425"
FT   CDS_pept        complement(552172..553161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0425"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   rca:Rcas_0667 NMT1/THI5 like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33675"
FT                   /db_xref="GOA:A9WDR9"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDR9"
FT                   /protein_id="ABY33675.1"
FT                   /translation="MRRWLLLGLIVILTACGAATTPAVSEPPLTTVRVGLDWTPNTNHT
FT                   GLYVAQAQGYYRDQGLQVEILGAQEGGTVEQLVAAGRLDFGISYQEGVTQARVEGVPIV
FT                   SIAAIIQHNTSGFASRVEEGITSPRDFIGKKYGAFGSPIEEAVIRGLLECAGVGDQFDQ
FT                   VQFVDIGSSDFFVATERDEVDFVWIFKGWTGIEAEVRGVPLNIVMMNDVQCIPDYYTPV
FT                   IITSEKMIAEQPDLVRRFLAATSAGYRFAIDRPAEAAEILLQAAPELDAELVRRSQQYL
FT                   ATQYQADAPRWGEQKLEVWRAYAQWMAERNLIARMIEPEKAFTNEFLP"
FT   sig_peptide     complement(553084..553161)
FT                   /locus_tag="Caur_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 26"
FT   gene            complement(553161..553979)
FT                   /locus_tag="Caur_0426"
FT   CDS_pept        complement(553161..553979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0426"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rrs:RoseRS_0669
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33676"
FT                   /db_xref="GOA:A9WDS0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDS0"
FT                   /protein_id="ABY33676.1"
FT                   /translation="MSDDVSQSMPATPVTVAVRPSWRAGLFEYGPPTLLVISLLLLWEG
FT                   LVWFFAIPDWLLPPPSRIVRTLFASLPVLAGHTLATLTVTIPGFALALVAGFSLGIALD
FT                   ASPVLRRAIYPLLVTSQTVPIVAIAPLLVVGFGFGLLPKVLVVALITFFPIVVNTIDGL
FT                   QSADRDQRRLLEAMGASYWQLLRLLRLRAALPAIFTGIKVSITYSVIGAVLAEWIGASA
FT                   GLGVYIARSLRAFRTDQVFVAALVTSLLTIALFTLVSLLERWIVFWKGER"
FT   gene            complement(553972..554265)
FT                   /locus_tag="Caur_0427"
FT   CDS_pept        complement(553972..554265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0427"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: protein of unknown function DUF77; KEGG:
FT                   rrs:RoseRS_0668 protein of unknown function DUF77"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33677"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDS1"
FT                   /protein_id="ABY33677.1"
FT                   /translation="MASVTVSFEVLPGGLPDKATTYAAVDAAIAVVAASGLTYRVCPME
FT                   TTIEGDYDAIMAVIKQAQEAVLAAGASRVFTLIKVDYDPNGSSIAEKLAKYE"
FT   misc_binding    complement(554346..554461)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 66.84"
FT   gene            complement(554746..554820)
FT                   /locus_tag="Caur_R0005"
FT                   /note="tRNA-Met4"
FT   tRNA            complement(554746..554820)
FT                   /locus_tag="Caur_R0005"
FT                   /product="tRNA-Met"
FT   gene            complement(554856..555662)
FT                   /locus_tag="Caur_0428"
FT   CDS_pept        complement(554856..555662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0428"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methionine biosynthesis MetW protein;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   rrs:RoseRS_1837 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33678"
FT                   /db_xref="GOA:A9WDS2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDS2"
FT                   /protein_id="ABY33678.1"
FT                   /translation="MIDEQTMTKVDQSALFARVEQSARADGKEAYFRLHRYRFAAMLQA
FT                   MGPANGARVLEVGVTPGHFTELLVGAGFQVSGADLDPFTRKALWDRLGVEVRQVNLERE
FT                   PLPYPDTSFDWVVFSEVIEHMVYSPLPILREFYRVLRPGGRVLITTPNELYLKSRARAI
FT                   LRMLLWQSLSTREEFRHQMLLEGEARYTTHSRTYTMEELTWLVEQAGFRIESRRFEAPW
FT                   ERVGLEAGRLLRAPHRVLAKALFFALTAAIPPTRSMLLVVGRRPLN"
FT   gene            555764..556201
FT                   /locus_tag="Caur_0429"
FT   CDS_pept        555764..556201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0429"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   rrs:RoseRS_3547 membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33679"
FT                   /db_xref="GOA:A9WDS3"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDS3"
FT                   /protein_id="ABY33679.1"
FT                   /translation="MNSSPPSSQPSRIDYSRLFLRWLIYSLAIFAAVWIVPGIEFSGPG
FT                   WQIGIVALLFGLLNALLRPLLYLLTCPLVILTLGLFGLVINALLLGLTSALADQLGIAF
FT                   TVDGFWPAFFGGLVIAIVSTTLQYLAGDVQVRIMVERRPPE"
FT   gene            complement(556330..558213)
FT                   /locus_tag="Caur_0430"
FT   CDS_pept        complement(556330..558213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0430"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; KEGG:
FT                   rca:Rcas_1728 conserved repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33680"
FT                   /db_xref="GOA:A9WDS4"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDS4"
FT                   /protein_id="ABY33680.1"
FT                   /translation="MPPKPSPATRLPPGRGRAPAPWTIWEIMAITVSVLMIVVPLTLEG
FT                   LNWIRPPVAPAQELMAATETPVSLEQRPPTFTPLATATPGSPVPTNTLTPTNIPTGVTV
FT                   TPTGETVTPTGVTVTPTNTSLPTLTPSPTPGTTRVNKFASLSTVNIGQSFSYSLAVTTQ
FT                   SDSPITLTLRDVLDANLELIEASAFGGTCFPGQTVLCTLTVSRFNPASVTLQVRVRASA
FT                   TEGSIIPNQAVLEQGSLQVGVSNVVNVTVAGGTVPTSSPTETPTVTATSTATNTPTATS
FT                   VTPTPVSTTSTPTATNTPVVQPTSPPRPTSPPPPPRPTEPLPAPTSPPTPTAPPPPVVL
FT                   PTEPPPPAPVATVAPRPTATPRPRPPAPPTNTPTPAASPTPTEPPAPAAFAESDLLLRL
FT                   ASDWGSAYAGQDIVFTIVLGNTHPAQTVSAVSLRSVMPSNLQVLGANASRGADPTINGQ
FT                   TVTYLAPDLAPGERVEVTIATRIRSDVAAGTLLVVQAQANQRDLSRPVFSNISTVLVVG
FT                   GQQVATATATATRAPATLTATVVSPTAGTTATSAPATATATATPDIVLGGGAPPAVTTT
FT                   PTTTPPAAGGASGGQAPLPNTSAGIPFLGVLLLGATLLTRTIRLHRARERL"
FT   gene            complement(558229..559167)
FT                   /locus_tag="Caur_0431"
FT   CDS_pept        complement(558229..559167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0431"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: rca:Rcas_1727 sortase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33681"
FT                   /db_xref="GOA:A9WDS5"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDS5"
FT                   /protein_id="ABY33681.1"
FT                   /translation="MTTFSQRRSASQRSSTSSSPVQRTGDNDLLQHLLLNDLPARRDPF
FT                   RPLRLRSRDAYREEALRGFLLRNWVDRALLIAEILLFATMVIVFAYWFIDGYGRDWWRA
FT                   WQGKSQPAEVIMPPPAPVAPPAEEITSPPPAPVAPPAAAPHLPALPFTDPGLAVEPADY
FT                   LAPQTSVKPLPKTDPRPQRLRIPSIQLDTPVYEVFVVDGAWQVAEYAAGYHHGTALPGT
FT                   TGNTVLAGHAGLRGAVFRDLPALRPGDEILLEAGGWVYRYRVREMRNVWPTQVEVMDPT
FT                   PTPVLTLITCTNWDTQRLVVIADLVDSRPLS"
FT   gene            complement(559306..560448)
FT                   /locus_tag="Caur_0432"
FT   CDS_pept        complement(559306..560448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0432"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   rrs:RoseRS_1560 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33682"
FT                   /db_xref="GOA:A9WDS6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDS6"
FT                   /protein_id="ABY33682.1"
FT                   /translation="MAGVFSQLDLTPTRLELARRARMARGDLIDLTSSNPTTQGLIFPA
FT                   DILANAATPYWSTRRYHPDPRGDLAARTAIVTYYARRSPPLILTPDDVFLTASTSEAYS
FT                   LLFALLADPGDNLLVPNVTYPLFEYLAAMRNLELRSYQLDEERNWRINARSLRRLADER
FT                   TRAILIVSPHNPTGAIIDASIATLDLLGIPVICDEVFAPFTYAAPTTPPLAALHPELPV
FT                   FTLNGISKLFALPDLKLGWIALNQPARQFAARLELLNDTLLGANALSQYLLPTLFAQGE
FT                   PFVQAMVERVRANLTLALQRFADHPRLRARPPAGGYYLFPAIDGWEDEEALVLFLLDHG
FT                   VFVHPGYFYGDVPGCHVMLSALCEPERFALGVERLCAALA"
FT   gene            complement(560452..561492)
FT                   /locus_tag="Caur_0433"
FT   CDS_pept        complement(560452..561492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0433"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG:
FT                   rrs:RoseRS_1121 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33683"
FT                   /db_xref="GOA:A9WDS7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019919"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDS7"
FT                   /protein_id="ABY33683.1"
FT                   /translation="MEKAMLLLDAAFQVDANPLPGAAEVAKAAEALGFAALWAPETAHN
FT                   PFLALTIAAEHTQQLTIGTAVAIAFPRSPMVTAQIAWDLAGFSGGRFVLGLGTQVKAHI
FT                   ERRFSSVWDSPVGRLRDYIGALRAIWHCWQTGGKLDYRGQYYQHTLMTPFFSPGPIAHP
FT                   DIPIYIAGVNTGLAHLAGEVCDGFHAHPLTSARYLREVLRPQIAAGATAAGRDPSACAI
FT                   AGSALVITGNDKTERERMRAMVRQQIAFYASTPTYRAVLSCHGWDAVGEELSRLAAQQR
FT                   WAEMTGLIDDTMVATFAVEADPADLPAALKERYEGLLDRVALYIPFIPGERDDFWRHLT
FT                   TSLNGR"
FT   gene            complement(561544..562161)
FT                   /locus_tag="Caur_0434"
FT   CDS_pept        complement(561544..562161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_0591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33684"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDS8"
FT                   /protein_id="ABY33684.1"
FT                   /translation="MQSEAQNGRIGEVIESSTIHFVAATYELLASPPFGSLVRATTTDQ
FT                   GLHVYGLIYDIHTGSREPGGRAIVRGRTYTGRYLYDDEIYRAHPDLSVVLQTEFTALIV
FT                   GYTLHGRLIQRLPPQPPPVHYSVYPCPNEELAAFGDHLDFLRTVLLAPGLPADELLTAA
FT                   VRTIALARRDGPTYLVRVGRELARLLKDDYDRLTALLHRLRP"
FT   gene            complement(562165..563376)
FT                   /locus_tag="Caur_0435"
FT   CDS_pept        complement(562165..563376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33685"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDS9"
FT                   /protein_id="ABY33685.1"
FT                   /translation="MTLNLAALSEQLRAMGQNAARSVAQRETRMAQIATRYLNEVGYEQ
FT                   RWADAVRLSATSAHWLLAEPVEPLDTIGRIETLPTDYAVVATDGSHIDVDRHGEVSCYL
FT                   INIGQVYLRYGAHPEAYLESSPRLYFSEDDLYLHEDTRRIPVEGAVLSVRRDVEEGVAL
FT                   GRFAAMYLNDTTIPRLALQDGTLIRWALANADEFIRDHFLGQYLNYLEQMRKIGIPVAS
FT                   YISRTRSPEVMGLMRLMFCPDVNVPAQRGANCAQCSDAKQGKTPSCMICQDVIDADLFA
FT                   TRLQEGERSPIFRSWSRISIEGYGDHQIHFFFLRIGRELARIEIPAWVAGQPDMVAQVH
FT                   ALVYDQAMRGQGYPVVLQRAHEQAVIRSAERRVFEQMVAGVLRQAEVPTGVSAKRERKQ
FT                   FIQG"
FT   gene            563682..564998
FT                   /locus_tag="Caur_0436"
FT   CDS_pept        563682..564998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0436"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: rca:Rcas_0087 FolC
FT                   bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33686"
FT                   /db_xref="GOA:A9WDT0"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDT0"
FT                   /protein_id="ABY33686.1"
FT                   /translation="MQITTYQEALDYIYSFIDPTRQGSPDPAIAARSLARLRALLDIAG
FT                   NPHQQLAAVVVAGTKGKGSTCALIEAMARAAGLRVGLWTSPHLSSYRERIQIDREPISQ
FT                   ATLIQLVRDVQPIVDAFDTATYGRPSTFDIGFVMAMRHFVAAHVDLAVVEVGLGGRFDA
FT                   AATITPLIAVISSISYDHMAILGPTLHDIAYNKAGIMRPGRPAITVPQHPEAAAVFAAE
FT                   AQTVGAPLWLAAEHTVEPWLASGQPLTYPAPPQPGRLRGGFQRENARLAMGTALLLRDQ
FT                   GVPIDDQAIRRGLAEAWWPGRFELIAGPPRILIDGAHNGDSAQKLWQAISDELPHRQFI
FT                   LVLGTSRDKDIAAIAAALAPQAAHVIITRSNHPKAMDLDRIAAEVAPFTNAPMQIVPVV
FT                   AEALATAQALAEQDDLICVTGSLFVVGAAREALGLAVAD"
FT   gene            complement(565047..565835)
FT                   /locus_tag="Caur_0437"
FT   CDS_pept        complement(565047..565835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0437"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   ttj:TTHA1204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33687"
FT                   /db_xref="GOA:A9WDT1"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDT1"
FT                   /protein_id="ABY33687.1"
FT                   /translation="MLRYLRLFVLFVHNSLQIALEYRVNFLTSLFQSVLWLLWGVLGTL
FT                   VFFQFTGTLGGWTLPQALLVVGMFRIFEGLIDGIMRPNITRIVEHIQKGTLDFVLVKPV
FT                   DSQFMASLRQINLMVLPDFLVGFGLIIYGLWLGQIWPTPFQLLAFLFLLACGMVIAYAI
FT                   WMLLVTTAFWLVQVENVTELLTAIYETGRFPVTAYSQWLRLVLTFVIPIAFLTTFPAAA
FT                   LIGLLDPFYLLLAPIIAGILLLASRAFWRVGLRSYTSASS"
FT   gene            complement(565964..567301)
FT                   /locus_tag="Caur_0438"
FT   CDS_pept        complement(565964..567301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0438"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   proten HflX; PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   rca:Rcas_3144 small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33688"
FT                   /db_xref="GOA:A9WDT2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDT2"
FT                   /protein_id="ABY33688.1"
FT                   /translation="MRTHDGKRLYPTAVPRRRALLVGAEIASMRSPWPVEDSLDELALL
FT                   AQTAELEVVGRIFQRLPEPQPKFFIGPGKVKEVAALREQTQADLIVFDDELSPAQTRNL
FT                   EEELQTQVIDRTGLILDIFARHARTHEGRLQVELAQYQYLLPRLRRQWTHLERQAGTGG
FT                   TAAGGVVGLRGPGETQLEIDRRLIERRIAWLKDQLADVHRHRELYRQRRRQTGIPVIAL
FT                   VGYTNAGKSTLLNAMTGADVLAEDKLFATLDPTTRQVLLPGNIVALMTDTVGFIQKLPP
FT                   QLVAAFRATLEEIEEADLLLHVVDVTHRNAQEHAQTVEQTLRELGVDHKPVLTVLNKID
FT                   LLEGATAEDVGQIAAEMGLPTDIVAVSAQRGWGLQTLGERIVAMLAQRMVRVDAYIPYQ
FT                   RNDLVALWRQRGVIEVEEFEGDGAHIVGRLPPALAPQFARFARSSL"
FT   gene            complement(568059..568361)
FT                   /locus_tag="Caur_0439"
FT   CDS_pept        complement(568059..568361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_0898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33689"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDT3"
FT                   /protein_id="ABY33689.1"
FT                   /translation="MTTNTQQTQADLIKAITDIATTLPMAQVMQLYQFALFLKMHPLPE
FT                   EMFSEILADEALWESQFASTDDSKLAELIDVIETEINEGRTRPMFDEHGEFLEYQ"
FT   gene            complement(568864..570357)
FT                   /locus_tag="Caur_0440"
FT   CDS_pept        complement(568864..570357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0440"
FT                   /product="deoxyribodipyrimidine photolyase-related protein"
FT                   /note="PFAM: deoxyribodipyrimidine photolyase-related
FT                   protein; KEGG: rrs:RoseRS_0009 deoxyribodipyrimidine
FT                   photolyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33690"
FT                   /db_xref="GOA:A9WDT4"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDT4"
FT                   /protein_id="ABY33690.1"
FT                   /translation="MTLAHESVWILGDQLSPHHPGLVAGRRVVMIESLARLNQRPYHRR
FT                   KLVLIISAMRHYAGELRAAGYEVDLRSAPDFLSGLRDHVATFGVRHLICMAAAEYDTRQ
FT                   FQQRLEHDLGIPVTMLPNTLFLVERHPPTRSPALMEPFYRAMRRQTGLLIEPDGEPTGG
FT                   VWNLDHENRRRYDGRPVPAPVRFPADTITQQVIADLARSCPNAIGSADDFDLPVTRAQA
FT                   LVALDDFIAHRLADFGPFEDAMSADHDLLFHSQLSPLLNIGLLDPLETATAAVAAYHAG
FT                   KAPLASVEGFVRQIIGWREYIYYRYWELMPDLLSANAWQAERPLPGWYWHGETRMHCLS
FT                   CVIKKVLRSGYCHHIERLMVLCNFALLAGIRPQEVNAWFLECYIDAYEWVVTPNVIGMG
FT                   LNADGGRTATKPYLASAAYIDKMSDYCRGCFYDRKARIGPRACPFNTLYWHFLIVHEAT
FT                   LRANPRLGPAVLGLRRITEAERQAIMAQAATILAQIEAL"
FT   gene            complement(571258..571704)
FT                   /locus_tag="Caur_0441"
FT   CDS_pept        complement(571258..571704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33691"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A9WDT5"
FT                   /protein_id="ABY33691.1"
FT                   /translation="MLTSDELTPTSDSYAQREMEILRRELSEAQALIRTLRRQLEKAIA
FT                   AAQEAQRAHAKMVETLTETMRENTVLCHERDMWRARAQRLESSLHEEIRPGAAIDISSL
FT                   VGQISEDEANAIRKAMARLHHPDVGGDPERMKAWNAALDRLFRQ"
FT   gene            complement(571983..572798)
FT                   /locus_tag="Caur_0442"
FT   CDS_pept        complement(571983..572798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33692"
FT                   /db_xref="GOA:A9WE32"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE32"
FT                   /protein_id="ABY33692.1"
FT                   /translation="MIMLTVSDYLAQPVVSPDVSIRYGDHPDQFGDLYLPAQVHPAPVV
FT                   MMIHGGCWQAAYPLTPLGECCAALRARGYAVWNLEYRRLGNGGGWPSTFLDVAAGADHL
FT                   RVLAEHYPLDLNRVVVVGHSAGGHLALWLATRPKLPPTSPLYIPHPLPVHGVVALAAVA
FT                   DLRRGVTATACGTACLELIDNEESRCAEASPHARLPLDIPHYHLVGGDDPIVPASYVAA
FT                   FVDAARQAGDLAHLTIVPKCGHFELTTPHSQAWQTVVQTIDKACSLNRS"
FT   gene            complement(572795..573157)
FT                   /locus_tag="Caur_0443"
FT   CDS_pept        complement(572795..573157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33693"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE33"
FT                   /protein_id="ABY33693.1"
FT                   /translation="MPVVIQLTSAMHGGTSPSCGTGDHSSCGPDCGCGCPYTGMVERGR
FT                   VEPVALIEQRYPGQWLALVIPPGEDEEHPEQAMLVAYSTDPDEVWDAVSRITFNQVVHV
FT                   YFNGSLADYLAWAEAE"
FT   gene            complement(573191..574462)
FT                   /locus_tag="Caur_0444"
FT   CDS_pept        complement(573191..574462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0444"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: rrs:RoseRS_3466 seryl-tRNA synthetase;
FT                   TIGRFAM: seryl-tRNA synthetase; PFAM: tRNA synthetase class
FT                   II (G H P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33694"
FT                   /db_xref="GOA:A9WE34"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WE34"
FT                   /protein_id="ABY33694.1"
FT                   /translation="MLDIKLIREQPDEVKRRLARCGVDGAVVDQVLAFDEQRRRLIYEV
FT                   ETRKAERNTVSKQIGAMKDPAERQAKIDAMRQLGDEIAALDRQLAEVEEQQRAVMLEIR
FT                   NLPHPDVPDGVDDRDNVVIYQEGEERQLPFPARPHWELGEALGIIDFERGVKLAGSRFY
FT                   VMRGAGARLQRAVIQWLIDLHLEQGYQEVYTPFVVKESVLWASGQLPKFRDNLYRDEES
FT                   GLWLVPTAEVPLTSLYADEILDASQLPIYHVAYTPCFRKEQLSAGRDVRGIKRGHQFDK
FT                   VEMYMFVTPDQSYQALEKLRRDAEECARRLGLPFRTKLLCTGDLGFGSTKTYDIEVWAP
FT                   GVGEWLEVSSCSNVEAFQARRANLRYRPEPGAKPEFLHTLNGSGLGLPRTIIAIMENYQ
FT                   QEDGSILIPEVLRPYMGGMERIGP"
FT   gene            complement(574540..575037)
FT                   /locus_tag="Caur_0445"
FT   CDS_pept        complement(574540..575037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0445"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: xft:PD0527
FT                   7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33695"
FT                   /db_xref="GOA:A9WE35"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003562"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE35"
FT                   /protein_id="ABY33695.1"
FT                   /translation="MPYTPILATLGYVLSPDRQSVLMVHRNARPGDQHLGKYNGLGGKL
FT                   ERDEEIVAGIQRELFEEAGITALELTLRGTVSWPGFGKHGEDWFAFIFLITRFAGEPPP
FT                   SNEEGTLEWVPLQRVMHLPLWPGDRFFLPLVFDDDPRPFHGVMPYANGQPVAWNFSRIG
FT                   TG"
FT   gene            complement(575055..575558)
FT                   /locus_tag="Caur_0446"
FT   CDS_pept        complement(575055..575558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0446"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rrs:RoseRS_3464 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33696"
FT                   /db_xref="GOA:A9WE36"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE36"
FT                   /protein_id="ABY33696.1"
FT                   /translation="MYHERAYLMREWLLSTTYQFLINMRFVAWRVLRPRAIGVRVIVQQ
FT                   GDSFLLVRHRGGAAPWGLPGGAIDRGETPADAARREALEESGCPVTITALHGVFHYLAD
FT                   GLSDYIIVFTAAAEGPPVPPTGDLEICDARFFHPDQLPAGVEAGSARRIAEARRGERGI
FT                   FASW"
FT   gene            576440..577864
FT                   /locus_tag="Caur_0447"
FT   CDS_pept        576440..577864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0447"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: rca:Rcas_2017 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33697"
FT                   /db_xref="GOA:A9WE37"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE37"
FT                   /protein_id="ABY33697.1"
FT                   /translation="MRWYNAAMAKTRTVFVCQQCGAQQSRWMGKCPECGAWDSLVEQIV
FT                   TPARGTGGQRAATVGQNQPIRLRDVPLTDFQRLPVYAEEFARVLGGGLVPGSVVLIGGD
FT                   PGVGKSTLLGQVAAHFAASVGPALYVSAEESAQQIRLRAERLGLTADDLFLLAETSLDL
FT                   IIEHIRHLRPRLVIVDSIQTVYLPELTSAAGSVSQVREGALRLMQLAKETAIPIVLVGH
FT                   VTKEGAIAGPRVLEHIVDVVLYLEGDRFHQFRLLRGGKNRFGSTNEVGVFEMTGDGLRE
FT                   VRNPSQVFLAERNTQSPGSTVTVTLEGTRPLLVEVQALTSHTGNAQPRRTTNGFDLNRL
FT                   LMLTAVLSKRVGLPLFNQDLYVNIVGGLRIGEPAADLAVALAIASSYRNQRIDPDLVCL
FT                   GEIGLSGELRSVSQLERRLSEAAKLGFRRAIVPAHSTPDRADGLTITPVRSLSEAVELL
FT                   TRKGIASSSSPAIEQG"
FT   gene            577868..578962
FT                   /locus_tag="Caur_0448"
FT   CDS_pept        577868..578962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0448"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Nucleotide
FT                   binding protein PINc; KEGG: rrs:RoseRS_1733 PilT protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33698"
FT                   /db_xref="GOA:A9WE38"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE38"
FT                   /protein_id="ABY33698.1"
FT                   /translation="MRLSLDLIVRLFGFSWMAYLGFWVGHSLSGPTPNSDQVLATLLLT
FT                   LAGGGLGLILAPRIIADPLRSLFRQARTIPLHEVVLITIGISIGGVLGALFTVPLAMLP
FT                   APYGNLLPGIVTAIMVYFGAAILYLRKREFVDLVNRWRQPRSQPPSPPQSLHSESPSAL
FT                   PSTRRYLLDTSAIIDGRIAAVVRTGFMEGSLLIPSFVLTELQMLADSNDDLRRQKGRRG
FT                   LELLNQMQQSSPLPIEIVSHDVPDSLRVDDKLIELARQYHCPIITNDYNLNRVAGLQGV
FT                   TVLSINQLSDALRPPVMQDQRLQVLIRNEGNTRQQGVGYLDDGTPVIVENARHLIGHTI
FT                   EVVVTRIHQTQTGRLVFAIPVEET"
FT   gene            578962..579444
FT                   /locus_tag="Caur_0449"
FT   CDS_pept        578962..579444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0449"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   rca:Rcas_2223 D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33699"
FT                   /db_xref="GOA:A9WE39"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WE39"
FT                   /protein_id="ABY33699.1"
FT                   /translation="MRAVIQRVREASVTVAGEVVGAIGNGLLILLGVCHTDTAEDVELL
FT                   AEKIAQLRIFSDHEGKFNLSLLDVGGAALVVSQFTLYADTRKGRRPSFTAAARPEIAAP
FT                   LVDAFAAALRARNIPVATGVFGAMMQVALINDGPVTLVIDSAELRLPRRAGSRVDS"
FT   gene            complement(579763..580620)
FT                   /locus_tag="Caur_0450"
FT   CDS_pept        complement(579763..580620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0450"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: rrs:RoseRS_4564
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33700"
FT                   /db_xref="GOA:A9WE40"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE40"
FT                   /protein_id="ABY33700.1"
FT                   /translation="MIQDMGLELIRIMGPFDANLLGRLLLTLVLSGLVGLERSGHERAS
FT                   GFRPHILVGIGACLVTMAGAYGFAELSSERDALRVASYVVSGIGFMGAGAILRHGTTVR
FT                   GLTTAATLWGCAGIGITVAVGLGWLAIAGTLLFLFTLTVLEWFERRLNFGGPISRLRIH
FT                   LRDDSRSVGKALDALVRLGVPVKRATVLPGAGTSALLDVELARTLSAEQAPLLARQLLT
FT                   LKKYVVQVETAITPLDEPTTMDESDEVQKDDTIVPLNLKDATLLRDLNDPDEAVPGSQT
FT                   ERSR"
FT   gene            complement(580951..581103)
FT                   /pseudo
FT                   /locus_tag="Caur_0451"
FT   gene            complement(581902..582237)
FT                   /locus_tag="Caur_0452"
FT   CDS_pept        complement(581902..582237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33701"
FT                   /db_xref="GOA:A9WE41"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE41"
FT                   /protein_id="ABY33701.1"
FT                   /translation="MKKFSNETKTADETFNSTTGFGLVGNADLTLQDDVAGAAQRRREA
FT                   IAQARTNRSRTAQLEREIIQAVIVLYLLILGSFAGLHLYGRYVIAELPQQVETTINESP
FT                   QDEPAAR"
FT   gene            complement(582321..583265)
FT                   /locus_tag="Caur_0453"
FT   CDS_pept        complement(582321..583265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0453"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: rrs:RoseRS_4560 Mg2+ transporter protein, CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33702"
FT                   /db_xref="GOA:A9WE42"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE42"
FT                   /protein_id="ABY33702.1"
FT                   /translation="MSQNELLSLPVSANQTPSVDRWLRVSITQTDALAAIKQRLGIDVV
FT                   QALKSGLCQEGEFLIYPLTFLSVEGSKKMISKVVFVLGREILVSLEPDPSPKPLRVAVS
FT                   RMQRDGRDNDPFDAFAVVLQSINDATDELIDLLNEELGEALVQTNAVLHSLESNERDFG
FT                   VSDVVATQVELGTVEDLLSQCIQTQLQLALVARQTLARLPQESFHLKQLYLTLIDDIEE
FT                   IEEHVHFVHDRVRLLQTSNNLALSVKQNQIVKVFSVLTAVFMPALLISTYYSMNFAYMP
FT                   ILEWQYGEPMVIALTALLALLPLIYVKQRGLLR"
FT   gene            complement(583262..583606)
FT                   /locus_tag="Caur_0454"
FT   CDS_pept        complement(583262..583606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33703"
FT                   /db_xref="GOA:A9WE43"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE43"
FT                   /protein_id="ABY33703.1"
FT                   /translation="MKGGPTVQQFTYNRWSGSVDTPAEPLVWTRDARRAQSRALRDKPS
FT                   TRWTRYERLSFLMMGLAWGLMIAIVAALHFGNYHLETRTSSTSGTHKSFYVEEIATPQS
FT                   NPSDGEGESQ"
FT   gene            complement(583619..584518)
FT                   /locus_tag="Caur_0455"
FT   CDS_pept        complement(583619..584518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0455"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: rrs:RoseRS_4558 Mg2+ and Co2+ transporter-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33704"
FT                   /db_xref="GOA:A9WE44"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE44"
FT                   /protein_id="ABY33704.1"
FT                   /translation="MTTVNELPAWVRLRASNQQELEEVARTHELSLIPEAIVRSEDILR
FT                   IRCARLEGSRLLVTDIFWLLRDDQTPLYTVEPIHSELWAGQARKWIWSQGLSFESSHAT
FT                   ALALLHQLVFQTANVLDVIDDELSVAGCISAGFLMKVGTDEASGVEDVENLDARLSRLN
FT                   APLSFVLQSLDDLERSGRQLRRAVLRQSSLTVDHVDELITEIENVQRRARFMQERQRFH
FT                   QTAARETVAMSDLNVVKVFTVLWAIFVPATALINWYGQNFQFMPELSWFASSLVQMLGV
FT                   LLVTAVPVIIIRQTGALR"
FT   gene            complement(584515..585450)
FT                   /locus_tag="Caur_0456"
FT   CDS_pept        complement(584515..585450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0456"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: rrs:RoseRS_4557 Mg2+ transporter protein, CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33705"
FT                   /db_xref="GOA:A9WE45"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE45"
FT                   /protein_id="ABY33705.1"
FT                   /translation="MTTNAIAATSAHDHLLQAGWMRLFRHQDDRLAEVKRVYGIDLLVS
FT                   SRRATVEEYGFLIIPVNLIVHREHEYRETNVVFALGKSVLISLETHPGTLDVASRILLE
FT                   EVQAGNSHDPASVLFLVLQSLNDTAHATIREISERLDETGASVASAGGGYQMAGRQVGV
FT                   ADIADMVAKLAEAEELVAKTVESQMMIARAVRWLRRIESSRRFGQALPTLVSDIHSLRR
FT                   YAQFQHGKIRNLQQSLMTMLDLKQNNVIKVFTIVTAVFTPPTLVAAFYGQNFAEMPELF
FT                   LPWGEWAVIVLTGLSAILPLFYIKKKGWMR"
FT   gene            complement(585547..585975)
FT                   /locus_tag="Caur_0457"
FT   CDS_pept        complement(585547..585975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33706"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE46"
FT                   /protein_id="ABY33706.1"
FT                   /translation="MRLILPYITSRLELRAELVFAVQRAWRHHETLKLLYQQLAARAPD
FT                   EQRRIMLLTLANAKRAHQQRYRRTLARLHAPLPPSGSAIDRFWLWLLPRCGIVVALRWA
FT                   EWIERRDVRAILDAVLLLRKWADFDNRANGYAIGRTRR"
FT   gene            587412..587822
FT                   /locus_tag="Caur_0458"
FT   CDS_pept        587412..587822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0458"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: rrs:RoseRS_2297 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33707"
FT                   /db_xref="GOA:A9WE47"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE47"
FT                   /protein_id="ABY33707.1"
FT                   /translation="MESTTFRIQREADVYVALSSGRRLATELQFSETDRTRIEICILEL
FT                   AHNLIRHAGGGEMTITVLRRDDQTAGIAIEARDNGPGIPDIELALQDGYSTTHSLGAGL
FT                   PGVRRLMDDFHIQSTPGLGTTVRAVKWRTTRR"
FT   gene            587832..588410
FT                   /locus_tag="Caur_0459"
FT   CDS_pept        587832..588410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0459"
FT                   /product="Stage II sporulation E family protein"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG:
FT                   rrs:RoseRS_2296 stage II sporulation E family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33708"
FT                   /db_xref="GOA:A9WE48"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE48"
FT                   /protein_id="ABY33708.1"
FT                   /translation="MKLSWGAALRPKAGQHISGDAYLVLPYADNQLLAAVIDGLGGGEA
FT                   AAEAAQRAVAVLERYPTLELTELMRQADRALVGSRGAVMALLRLNADQHTAEFVGVGNV
FT                   GAQVYSDLLIKPISKNGIVGYRLPQLLRLSYTYNSGDTFVLYSDGISSRFTTEMPPDLH
FT                   QSPQHIADEILHRFGKDSDDATVVVVRSE"
FT   gene            588432..591068
FT                   /locus_tag="Caur_0460"
FT   CDS_pept        588432..591068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0460"
FT                   /product="PAS sensor protein"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: rca:Rcas_3170 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM: GAF
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold domain protein;
FT                   SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33709"
FT                   /db_xref="GOA:A9WE49"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE49"
FT                   /protein_id="ABY33709.1"
FT                   /translation="MNPTLSQWLHTRQTAILDNWPDRNEAMTGHVVIQPRLETQRLVSA
FT                   LIAAAEGNELPLRDLFSEWIAAETDVGLPVMVRNFQNLHRTIRASLIQDTSSLTLIDDL
FT                   ADLFDQAIAILVELWTEHTSQLIHEREFIAASLDAASAAADQRALQLKALNDISQRLSA
FT                   TLDRDTLIEIVIDSLHRLTEAHHAALWLVDDKQRIRVVASRGSDDGPPVGYILPDANPT
FT                   VQAAFHKGVFWPALPADNMQEWMIAGCSVLIIPMTGGERLIGAVTLQELHNPLDLRFMQ
FT                   DLAQSIASQAAIALQNAELYHTIRTLNADLEQRVIERTRELEEEKDRLATLHAIAAQVN
FT                   QTLDLDQILNNSLTMLARIVQAEHASILLTEEDNPSLLVTRAILGTKVSPDNTVRFAIG
FT                   QGIAGWAAQHGQTVLVPDVAEDERWVTIPGSSRKREGSMIAVPLFVQGEVIGVMTLSHS
FT                   QTHFFHEGHVRLLNACAGAIAIGINNANLFRMISTEAERRYELLDRQQKETSQIAAILQ
FT                   SLLDGVIVCDLYGGVISINPAASRILHRPLEELLLWNLRDVIQRYLGSHAAELPLDDLL
FT                   RRPLSVNGEARTFTTTAIVGGKTVNFSLSPVLKENDELLGALLVLRDITREVEADRMKN
FT                   EFIGTMSHELRTPMTAIKGFTQLLAMGGLGQLNDTQREFVNTIYSNTERMINLINDVLE
FT                   ITKIESGSIDLEWRSLHLAEALSGVIAELQPQITQHRHQLTISIPPGLPLIRADAMRLH
FT                   QILYHVLLNAVKYTPAGGSITIAAREVMNIDIPEPIRSTLSDNRRYLLLSISDTGVGIR
FT                   PEDLPRIFDRFFRGENLLKVEAGGTGLGLSIVKPLVELLGGRIWVESTVGVGSTFSIIM
FT                   PIAGEHA"
FT   gene            591157..591909
FT                   /locus_tag="Caur_0461"
FT   CDS_pept        591157..591909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0461"
FT                   /product="peptidase C26"
FT                   /note="PFAM: glutamine amidotransferase class-I; peptidase
FT                   C26; KEGG: rrs:RoseRS_2428 peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33710"
FT                   /db_xref="GOA:A9WE50"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE50"
FT                   /protein_id="ABY33710.1"
FT                   /translation="MTPLIGISCGTFRDRDWCPPSYGHRQTYVDAVLQAGGAPILIPPL
FT                   LDSATLRTIYDRLDGLLLAGGGDISPNHYGDQPHERLGAIDPPRDLMELRLARWAAADG
FT                   KPLLGICRGVQLINVALGGSLYQDIPSQLDTAIDHNLSYAREDWTYMAHSITIAADSRL
FT                   AQALGTTNLMINSLHHQAVRRVAPGLRAVAWAPDGVIEALEGDSQHFIVGVQCHPEALQ
FT                   ATVDPRWQGLFAAFVQSCSDTHRQSRAA"
FT   gene            591925..592692
FT                   /locus_tag="Caur_0462"
FT   CDS_pept        591925..592692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0462"
FT                   /product="peptidase C26"
FT                   /note="PFAM: glutamine amidotransferase class-I; peptidase
FT                   C26; KEGG: rca:Rcas_3050 peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33711"
FT                   /db_xref="GOA:A9WE51"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE51"
FT                   /protein_id="ABY33711.1"
FT                   /translation="MNNQYRPLIGITTMHSGTSADGRELQAVRPTYLRAIEAAGGIPLI
FT                   IYLTDDMSAVRRLYDLCDGILLPGGDDVDPAYYDEPPHPKLGAVDRQRDAVEIALARWA
FT                   HAERKPLLGICRGLQVINVALGGSLYQDIPSQLATTIDHRANTRTRAWTELTHSLHILA
FT                   DSRLATVLHTTDIGCNTMHHQAIKQLAPGLRAVASAPDGIIEAFEALDDHYLLAVQCHP
FT                   EHLWDSSEPRWQALFADFVNTCRERATNAHQAS"
FT   gene            592726..593514
FT                   /locus_tag="Caur_0463"
FT   CDS_pept        592726..593514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0463"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: pth:PTH_0922 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33712"
FT                   /db_xref="GOA:A9WE52"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE52"
FT                   /protein_id="ABY33712.1"
FT                   /translation="MIGIFDSGLGGLSVMRAIHERLPDTDLLYLADSAYCPYGPRPLSE
FT                   IRDRALACGRWLVDQGARIVVVACNTATAAAIELLRRELPVPVVGMEPGVKPAVAATRN
FT                   GKVAVLATSGTLASDRFRSLVQAYAAGVEVYPLACPDLVAQVEAGELQSDQTRNLIEQH
FT                   LATVPEVDVIVLGCTHFPPLKPLIATCAGSHVTVIDTGPAVAAQTERIARQINVPAGSG
FT                   TIRCATTGDPQLVAPALYNVWGAPLPLVGVQIDSAVVVHE"
FT   gene            complement(593583..595622)
FT                   /locus_tag="Caur_0464"
FT   CDS_pept        complement(593583..595622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0464"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; KEGG: rca:Rcas_2379 VanW
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33713"
FT                   /db_xref="GOA:A9WE53"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE53"
FT                   /protein_id="ABY33713.1"
FT                   /translation="MSVQHSQPFNPTHERTDGEVFSPSLPGAVDWPDQVVHPPAVQRGT
FT                   GRRTRRKVSRGWWWLLLVVLSGLAIVGTGMVFLDRSYAGRILPNVTVRGVAVGNMTREE
FT                   ARAAIEASFAPFLAQPVVLTYSGRSWTPTLAELGVALEIDEALDAALAVGRSANLFTDL
FT                   QQMSAVWQYGIDIPLRLSIDQDAMQRYLLARVAEVEQPARDAHLMLHGTTVEVAPSAVG
FT                   RQVLVAETLQEILSAIQDLNPDTVALRTRALEPSLRDDAAFLAQDQIAALLAGPVTLLV
FT                   DNRPFVWSLDELARMIRVERISDPMGDRLEVSVDHDMVMEKLIALGDSTEVKGTYPRLN
FT                   WNEGKLEIFQPGKPGKRIDEAQALNAVLEALNKPADQRTVTVNFREIPPPVTADNLDQL
FT                   GITTLLGVGRSDFTGSAPYRVTNIQAGMRLLHGILIPPGEEFSFNQTIGRIDSSNGFVE
FT                   GYAIIQNRTQLEWGGGICQDSTTVFRAAFWAGLPITERWGHSFYISWYDRYGFGPYGDG
FT                   PGMDATIFTGGPDLKFLNDTGGWILMQTMVDTRRNLAEVRLYGPETGRKVLLEGPVITN
FT                   RTPPPTEPVYVAVPERPVGQPRQSDKARGGMDILFTRIVLGPDGKEIERREFVTRFKPW
FT                   PDIFEYNPADLGPDGKPLPTPTPPPAEPIPVEQPPVEPPTDATG"
FT   gene            complement(595836..596624)
FT                   /locus_tag="Caur_0465"
FT   CDS_pept        complement(595836..596624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0465"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; KEGG: rca:Rcas_3883
FT                   multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33714"
FT                   /db_xref="GOA:A9WE54"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE54"
FT                   /protein_id="ABY33714.1"
FT                   /translation="MNLVINAAEALPDQRGEICVQTGLCVVTARMQSRLIRQHHLLPGQ
FT                   YAILEVRDNGEGIDPVIRQRIFEPFFTTKPYGHGLGLASVLHIVQRYGGGLEVDSQPGQ
FT                   GSTFTVWIPVMSSVTTEMLPVPSPTSAESYILVIDDNPEVRALIERILVRAGYRVLAFH
FT                   NGNDAIRAISDHPVACALIDITLADMHGYEVCRQIAAMHPHIPLALVSGYAVQAENLVD
FT                   VPVMATLQKPFRASELLALVRRLLENTVHKETPPSHSMDT"
FT   gene            complement(596631..598424)
FT                   /locus_tag="Caur_0466"
FT   CDS_pept        complement(596631..598424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0466"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: rca:Rcas_2148 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: GAF domain
FT                   protein; histidine kinase A domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33715"
FT                   /db_xref="GOA:A9WE55"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE55"
FT                   /protein_id="ABY33715.1"
FT                   /translation="MARRWTVTQTRLLADVGALLVSLDGIEALQQVARHIVPLLGDLCA
FT                   IVIRDERQQVRRVALACADTRYQHLVEHLIQHSLLIDPHSIPARVLDSSQPLLLADLSD
FT                   EYYDDPAFSPLYRDILRQIRPRHILGVPMRGHGMTCGALVLTITDASSRRFTPNDIDLI
FT                   CELARRIAMAVENILLYRSTQRRLEQLLMVQRVAALINSTLQTDLICRLVVQQLHDVFG
FT                   YQLVSMYLLQNEALHLQAVVGYDRLLPVIQLHEGVAGRVVRNGRAEFVRDAQHDPDFLE
FT                   VMPDTKQCIAVPLRYETAEPVGVIIVESQGNPALDDEDFFLLSLLADQIGVAFFNSLLF
FT                   ERLRDTNERFRLLIELAGNLVICLDPDLRITEFNRMAAQVLARAREDVIGRPFATTLLS
FT                   EAERPLFAALVREVITGQEDRSFETSFWVDGRKCYVLWTVTCRRQTNGTIGELLLVGQD
FT                   LTDQREKTWALVRDEQRLQALERFESMAIMAGGIAHDFNNLLSMVVAHANALQTIYPTG
FT                   NPADQHIHHLIEAAHQAGDLVRELLSFATGRQTALQPVDLNHLIQETISLLQSSLGPHV
FT                   HIRIGLEPSLPAVLADPVHIR"
FT   gene            598567..599130
FT                   /locus_tag="Caur_0467"
FT   CDS_pept        598567..599130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0467"
FT                   /product="Disulphide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB; KEGG:
FT                   rca:Rcas_2051 disulphide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33716"
FT                   /db_xref="GOA:A9WE56"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR012187"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE56"
FT                   /protein_id="ABY33716.1"
FT                   /translation="MDRAQSMELTATTSPTSLLDWLTLTCRHIALLAAMLATVGSLFFS
FT                   EVLGWIPCELCWYQRILMYPLTVLLFIGIWRDDRKVYLYVLPLSLTGIAVALYHYLMVM
FT                   LIIPPAPCAGAVPCAFDYINIPGVLSFVKIPFLALVAFIIISVMMANLALAETAPAHGR
FT                   MARMIATAIVLATSLAFIGLGVMI"
FT   gene            599608..601470
FT                   /locus_tag="Caur_0468"
FT   CDS_pept        599608..601470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0468"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   rrs:RoseRS_4064 glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33717"
FT                   /db_xref="GOA:A9WE57"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE57"
FT                   /protein_id="ABY33717.1"
FT                   /translation="MCGIVGYIGGREATEVVLNGLQRLEYRGYDSAGIAIYHPDAGLQL
FT                   RRSVGKLINLQQRVQADPPRGRVGIGHTRWATHGGVTEQNAHPHRDASGTIVVIQNGIV
FT                   ENYLSLKGRLIELGYQFESQTDTEVIAKLIGHYYQEQRDLVAATRQALQELRGGNAVVA
FT                   FCIHEPDTLVAARLGNAGGIAIGLGDNEQFIASDIPAILDYTRNLIFLEDHDIAVVRRD
FT                   EVTITRLDGTPVTRAVHSIAWDPVAAAKGDYRHFMHKEIDEQPRALMDVLRGRIDQERG
FT                   LITLEDLRLDDQDLRRVRRIYAIACGTAWHAALVAKFMIENLARVRVEVDYASEFRYRQ
FT                   PILQSNGERDALILTFTQSGETVDTLAGMEEARRQGVPSVAIVNAIGSQAARLADGGPI
FT                   YLHAGPEIGVASTKAFTSMLVAGYLFALRLAQAHGTLTPAQIREHIQALVELPGKAAQV
FT                   IEQVTPVCVELAERYYRVGNALFLGRQINYPIALEGALKLKEISYIHAEGYPAGEMKHG
FT                   PIALIDEGMPVVCIATRDHIYEKMISNVEQVRARHGQVIAIGHEGDELLAAKANHFIGV
FT                   PATLPLLQPVLNVIPLQIFAYHVAVLRGCDVDQPRNLAKSVTVE"
FT   gene            complement(601775..603148)
FT                   /locus_tag="Caur_0469"
FT   CDS_pept        complement(601775..603148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_0867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33718"
FT                   /db_xref="GOA:A9WE58"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE58"
FT                   /protein_id="ABY33718.1"
FT                   /translation="MTRLFRTIFLAAFEATVVGLPFLALTTIALSWPGLFSAVVLGRVA
FT                   DEVGSRLRWPFNRSLLVLAPIVAAAWLSWLTFGLDPLTLLAALRPGQPQSGPIYLAVLV
FT                   AFFLVWRGVRLADHDSATILTLAGRGVIGAVLALILGPLLRAGEAVSNDLLLVYIIVFV
FT                   GSGLAALALTHVVEMTSDQAQSLDARWSLLLLGVIGAVLALGLSLAALLSGDLALEGMI
FT                   ALLQLLLLPFALIGAALVYLITVVFGDVIRALLGVLGRALAQMNLRPEPPPTPDTAVVD
FT                   DTAAETVVAIAQQATFLLALIPLVALVIIIVLWRRRHRRSVTDEERQSLDIGQSLIADL
FT                   RDLFGSFRRPFRRHLHGLQAALAALRGADAVSRVRRAYIQALLALEAQGWRRPPDQTPS
FT                   EWCTHVSSVLPDQQPFIDLTATYERARYRPDGVDADEADAAERSLQGLRTSLSSQRAQ"
FT   sig_peptide     complement(603053..603148)
FT                   /locus_tag="Caur_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.617) with cleavage site probability 0.314 at
FT                   residue 32"
FT   gene            complement(603264..603428)
FT                   /locus_tag="Caur_0470"
FT   CDS_pept        complement(603264..603428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0470"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: rca:Rcas_3334
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33719"
FT                   /db_xref="GOA:A9WE59"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WE59"
FT                   /protein_id="ABY33719.1"
FT                   /translation="MASKKGNRIVIKLKSTESGHTYTTEKNRRNDPSRLELRKYDPIVR
FT                   RHVLYRETK"
FT   gene            complement(603565..604737)
FT                   /locus_tag="Caur_0471"
FT   CDS_pept        complement(603565..604737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0471"
FT                   /product="arsenite-activated ATPase ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="KEGG: amt:Amet_1480 arsenite-activated ATPase ArsA;
FT                   TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33720"
FT                   /db_xref="GOA:A9WE60"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE60"
FT                   /protein_id="ABY33720.1"
FT                   /translation="MRILFYTGKGGVGKTSIAAASALRCAQLGYRTIVLSTDAAHSLGD
FT                   SLGVDLRAEPLQVAPNLWAQEINALHELESSWGTVSRYLADLLAWQGVETIAQGELSVI
FT                   PGTEELFSLLQIKRHYDEGKYDVIVVDAAPTGETLRLLSLPDVMRWWIARLFPIARALL
FT                   RVVRPVARRVTDMPIADDDVLASAQQAIDALIDVRQLLTNQQICTARIVMNLEKMVIRE
FT                   AQRSLTYLSLFGYAVDAIIVNRILPPEVDAHFAQWRAMQQQYAPMVEEMFEPLPILRAP
FT                   HFSQEIIGTELLSRLADHLFADRDPTAFLYQGPTQRVEKTAYGYDLIVPLPFASEDQVH
FT                   LAQSDDELLISVGWHRHRIVLPQSLARLRAQDAFFEDSSLRVVFRRDVAA"
FT   gene            complement(604903..605283)
FT                   /locus_tag="Caur_0472"
FT   CDS_pept        complement(604903..605283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0472"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: rca:Rcas_1521
FT                   putative regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33721"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE61"
FT                   /protein_id="ABY33721.1"
FT                   /translation="MPIYEYLCPACNGQFQKLVRGFSDPPGLACPRCGNTGVRRAISRF
FT                   ATLKSEEDRLESLADPSTFMGLDESDPRSIARWAKRLGKELGEDAGEDWDEMVDQMLEE
FT                   ELSGKKDDESSSTGKPDDLGWA"
FT   gene            complement(605313..606625)
FT                   /pseudo
FT                   /locus_tag="Caur_0473"
FT   gene            complement(606652..608283)
FT                   /locus_tag="Caur_0474"
FT   CDS_pept        complement(606652..608283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0474"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   domain protein; KEGG: rrs:RoseRS_3410 carbohydrate kinase,
FT                   YjeF related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33722"
FT                   /db_xref="GOA:A9WE62"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE62"
FT                   /protein_id="ABY33722.1"
FT                   /translation="MSKEKLPFVVTAGQMRSAEEAAVVRGTTWAALMEQAGAGVADAVL
FT                   RYAAPLANRQVLVLVGPGNNGGDALVAARHLADAGALVTLYVWRRSGVDANLQACRERA
FT                   IPELSAATDGDGSLLAQALRKAVLVLDGLLGTGARPPTADLATIIQAVNAERTQRSDLR
FT                   VVAIDLPSGVGADDGQVPTVAIRADLTVATGLIKRGLLLWPGRGYAGEIVVAPIGLSSL
FT                   DGVLTMSELLTASQARTLLPPRPADAHKGVFGKVLVVAGSINYPGAAVLACAGAQRSGA
FT                   GLVTLATGRTVLSLATLPPEVTLLPVAEGDWGAIGPAAVDDLAEHLPGYQALLLGPGLG
FT                   QAEATRKLVLRLFGLDHTRSRARVGFVAVGEPLTNQPQQTVALPPTVIDADGLNILATA
FT                   ADWFERLPPEHCVLTPHPGEMRRLLGVSELPADRVATAAEAAQRWRQTVVLKGATTVIA
FT                   APDGRTLMYDGANPALATAGSGDVLAGVIAGLIAQGCLPFAAAALGVYLHGAAGARARM
FT                   AFGDAGVVAGDLLPLLPSVMQELRTG"
FT   gene            complement(608287..608700)
FT                   /locus_tag="Caur_0475"
FT   CDS_pept        complement(608287..608700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0475"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="TIGRFAM: holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase; KEGG: rrs:RoseRS_1045
FT                   holo-acyl-carrier-protein synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33723"
FT                   /db_xref="GOA:A9WE63"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WE63"
FT                   /protein_id="ABY33723.1"
FT                   /translation="MLYHGVDLVEVARIRHAVVRYGQRFVQRVYTATEQADCLAGSGDV
FT                   RYEALAARWAAKEACAKALGIGLRGLGALAVADRPRAGFHEIEVVRDNDGRPVLRLSGF
FT                   AAEQAAALGICALAVSLSHTDELALASVVAWAG"
FT   gene            complement(608709..610133)
FT                   /locus_tag="Caur_0476"
FT   CDS_pept        complement(608709..610133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33724"
FT                   /db_xref="GOA:A9WE64"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE64"
FT                   /protein_id="ABY33724.1"
FT                   /translation="MAAMRTSTVATHDRLVAQRRTLRIAWLTLFVFFGLFLALSSWVVW
FT                   NIRQWYLTATDVQTAILVVRGSDESIVWQPAGRTIFQGVRDQQPLSEGEAVRTLPNAGY
FT                   GQVASLRLFEGSQLDLWAGTELRLTTLRTTRWHSGTLQVALEQTNGYVRYDVRGDQPFQ
FT                   NVFFTVTVGDAQVKLLPGGSYSINLYPPERRVIRSDGRPALIADVAVRSGSAIVTGVVG
FT                   QPVRLAAGQRIEVDPAGIPGLPVPARWELIRDGGFSRFSEVEYNNTTRTDDPTLPRSTT
FT                   WQVSGTPSLPLLERGFFRLAQICRPPNDTLVCPIEDWRTAAWFYRVGGQTKGFVTSIRQ
FT                   PLGVQGAGIDVSEFRSLVFSLWARVDYQSLPAAGDRGTECPVMIRIVARRSSPADPDEE
FT                   RVVCIYTATSDDALRVRADGVFYLRVEPSTWTQFRVDLRDENWLPDYRYLRSVEIYANG
FT                   HDYDARVAEVSLVGTQ"
FT   gene            610363..611013
FT                   /locus_tag="Caur_0477"
FT   CDS_pept        610363..611013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0477"
FT                   /product="LexA repressor"
FT                   /EC_number="3.4.21.88"
FT                   /note="KEGG: rrs:RoseRS_0427 SOS-response transcriptional
FT                   repressor, LexA; TIGRFAM: LexA repressor; PFAM: LexA
FT                   DNA-binding domain protein; peptidase S24 and S26 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33725"
FT                   /db_xref="GOA:A9WE65"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE65"
FT                   /protein_id="ABY33725.1"
FT                   /translation="MRRHEMSDRQAEIYQYIVRFIKERGISPSIRDIQRDLHISSTSVV
FT                   SYNLDVLEKLGKIVRNDKISRGISLPGMVPALLRNDVGRVPLLGTITAGSPLPDPEEID
FT                   INRAEQVVVPADVVPPERLNNVYALKVRGQSMIDALIDDGDIVLLRQQETAENGQMVAA
FT                   WLIDENAVTLKKFYLEDGRVRLQPANSTMQPIYTSPDNVRIRGRVIGVLRSLM"
FT   gene            complement(611268..612344)
FT                   /locus_tag="Caur_0478"
FT   CDS_pept        complement(611268..612344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0478"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33726"
FT                   /db_xref="GOA:A9WE66"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE66"
FT                   /protein_id="ABY33726.1"
FT                   /translation="MTTQIRRPLLNPILVREARTRMRGARPYLILTLFLLLLILTTFGI
FT                   YQYMVLQARTGMVVLSSHIGQALFKGLAFTEMFFIVLVAPILTSGAISSERERLTYDML
FT                   LATPLRPGQLLAGKLIGALSYLLLLIVASIPIFSTVLIFGGVELRTLVLTVLLLGGAAL
FT                   FFGTIGLFSSALFGRTTPATILSYGIVLVICGIPLLIASVWPQFSNPQGQSPPPWLLYL
FT                   NPFSAIVAVTTVAPNVSQPDLPLFSVNDPFMIVPFLSQFSIGILRYTPEGSVVMPVYRA
FT                   TLLGFGLGTFILLWLSSHLALPVRRWRPRWSDLGFIAAIGAMILLMWVTIEWWWIVPPV
FT                   DPWLMPVEPMPIDVPKAP"
FT   gene            complement(612460..613410)
FT                   /locus_tag="Caur_0479"
FT   CDS_pept        complement(612460..613410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0479"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rca:Rcas_3059 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33727"
FT                   /db_xref="GOA:A9WE67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE67"
FT                   /protein_id="ABY33727.1"
FT                   /translation="MTLAIETINLTHRYRKFVALDHLNLQVSQGSIYGFIGPNGAGKTT
FT                   TLRLLAGLITPTSGEIRLLGERLTMRSAQRLVGYMPDFFGVYDDLRVWEYLDFFARCYG
FT                   LRGARLRQVVDELLDLVDLSAKRDAFVQTLSRGMQQRLCLAHALVHDPPILLLDEPASG
FT                   LDPRARVELRELLRTLRDMGKTIMLSSHILSELAEVCDAIGIIDHGRMIISGSLAEVQQ
FT                   QLVTGSRIRLRIVHERDLTSAVSFLQQQPLVQAISTVPADPRSLTIELTQTVNEEQCAG
FT                   LLAGLVQAGVAISEFSARSESLEEFFLRLTMTDAR"
FT   gene            complement(613407..615749)
FT                   /locus_tag="Caur_0480"
FT   CDS_pept        complement(613407..615749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33728"
FT                   /db_xref="GOA:A9WE68"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE68"
FT                   /protein_id="ABY33728.1"
FT                   /translation="MRGLRAWAGWLILLGVFCIGFGTWLPLPVAAQASDITLVVRPAFQ
FT                   GMVRPGVWLPVTVEVTNNGVDRTAEIVVGTANGPFQSTFVELPGGGRKGLILYAFIYGS
FT                   PRQLGVRVLIDGTEVTTASARLQPVTEGLLVGVIGERELRLPAQLTDGIKVTSVPVPLA
FT                   DLPPESLGLSPFDALIIADVAANEITPDQQRALQGWVQRGGTLLVNGDVGIARTLSSLP
FT                   RELIPATAGALAAPLTDPSVTSVTLTPSASAPEVYPITLPLISTPLPLAYGKRFGNGQT
FT                   VVLAFDLAAPEVVNWSGWRELWQALLPPPSFIPSGLGFGAKLYSTYVEENLASALTTLP
FT                   ALDLPSLNLIGILLACYLVVVGPVTYLVLRRLDRLAWGWVVVPVLTGIFAAGAYGIGYD
FT                   LRGGEVIVSQITLIDANAPTSAHERSFIGIFSPDRYAYRLQATESVTMVRPVSVQGPWS
FT                   SPPLTNGTYVQGSDDNLVVENLEISQWSMQAIASDRVISAPLITAQITVNGDTVQGEVT
FT                   NRSERTLEDVVLAYGEQIALINALAPGEQRSATLERPSHAFDGISLSYLIYGPQFEAMS
FT                   RVAQPVSPTLQLRSRIIDSLYGYGSITRGAQPLLLAWYQDTETSLIPVDRRATMQHLTL
FT                   VRGAVRLQVTDEIKLNSNGFIGSFEQTAGTNSPCYNGNLLGIAPDLQPTIMRFTLPADL
FT                   IGLQPSALVLNLRSDSFWSGEIELYDWTTGSWTPILTDAFQSVALDIPQPDHFLSSQGV
FT                   IRLRLKNRDFQNFTCVYADPVVRGRLP"
FT   sig_peptide     complement(615648..615749)
FT                   /locus_tag="Caur_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.549 at
FT                   residue 34"
FT   gene            616212..617063
FT                   /locus_tag="Caur_0481"
FT   CDS_pept        616212..617063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0481"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin--acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin protein ligase domain protein; biotin/lipoate
FT                   A/B protein ligase; KEGG: rrs:RoseRS_4051
FT                   biotin--acetyl-CoA-carboxylase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33729"
FT                   /db_xref="GOA:A9WE69"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE69"
FT                   /protein_id="ABY33729.1"
FT                   /translation="MVRWRYGMIDPVAIRAGLEPGALVPITIYCYDRVGSTMDLAREAV
FT                   QTLPPDALPVLIVADEQTAGRGRLGRRWVAPPGSALLFSLGLHPPAVATTMPTTLIWLA
FT                   TVALVETIEQETPLQAGLKWPNDVLVKTSTGWAKTAGILLEGGWDKNSLVWAIIGCGIN
FT                   INAAPDPQITRYPATALAIAAETAIDRLRFLHMLMRRYDYWLRRLYSGESDQLWQTWRN
FT                   RLLTLGQTVHIHTGNDLVYGTAIDVERNGSLIVREPSGTLRRIESGDVGLVDDHSRNIN
FT                   EV"
FT   gene            617305..618420
FT                   /locus_tag="Caur_0482"
FT   CDS_pept        617305..618420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0482"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator, LytR/CpsA family"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   rrs:RoseRS_0131 cell envelope-related transcriptional
FT                   attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33730"
FT                   /db_xref="GOA:A9WE70"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE70"
FT                   /protein_id="ABY33730.1"
FT                   /translation="MLIVYRRVVAGAVFIISVIAVAMMLRIGFEWRQALVDIDAMIVTP
FT                   ATLPDEVITVPTAQSVVSEEIYGPPPATPVVQPTVVPSATDNSPAATATAEAIRLSRSE
FT                   LNILLLGTDARPEETGPTRTDAIVVVHIARDTGRVSMLSIPRDLWVKYPTGGEGRINAA
FT                   YVIGENRFGPGGGAALAKSTVSKLLGIPIDYFVLINFEGFKKIIDLIGGIEVDVPRAIY
FT                   DPAYPTDDYRTIEVSFAAGRQWMDSERALIYARTRHADSDFGRNQRQQQVLMAIFQRIR
FT                   DRGLLQQLTSLDDYTGALRGYVLTDINYRMMLELASFARTIDSENILRYAIDSSSIVEL
FT                   SGGATFSVQPQALRRIVSQFTGEAVSTAGGE"
FT   sig_peptide     617305..617373
FT                   /locus_tag="Caur_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.799) with cleavage site probability 0.786 at
FT                   residue 23"
FT   gene            618430..619983
FT                   /locus_tag="Caur_0483"
FT   CDS_pept        618430..619983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0483"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   polysaccharide biosynthesis protein; virulence factor MVIN
FT                   family protein; KEGG: rrs:RoseRS_0132 integral membrane
FT                   protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33731"
FT                   /db_xref="GOA:A9WE71"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE71"
FT                   /protein_id="ABY33731.1"
FT                   /translation="MTETSTTGGVFRSIALAALLISLGNIASRLLGLVREPIIAAYFSR
FT                   GLAVDAFTLAWTIPNALYELLISGAVSAALVPVFSEYAERDRDEFWYVVSTVITLACTV
FT                   LVIASAILAWQAPLAIALLTRPTESALQAEAVALVGWLLPAVTLMGISGIVTAILHAQR
FT                   QFLLPAFVAAAFNAGMIVGIVTLAPHVGVKSLAAGTLIGAAAQLIIQLPGLRRAHIRPR
FT                   FDLHHPAVRRILRLYAPVTLGIGFSLIGVTIDRWLASGFPAAISTMRFATTLIQFPLGL
FT                   VASAVALAVLPTLSRQSAAGDEDAFRATLAMGLKVVLLLILPATAGLAALSQPITAALF
FT                   ERGAFQAQDTAITALALLAYLPGLPAAAIDQMLLFAFYARKNTLTPNLIQGAAILCYLV
FT                   VAIPLAEWTSLGFLGLVLGNSAQWIGHAIITAWLLQRSLPLNGLRLGEAMIKGLLASGV
FT                   MAGAVSGIAILTQPLPPLVQVIVAGSAGVFIYALLAMRLRLEAATFFVETIRRRLHRSH
FT                   "
FT   gene            complement(620205..621164)
FT                   /locus_tag="Caur_0484"
FT   CDS_pept        complement(620205..621164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0484"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: rca:Rcas_3042 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33732"
FT                   /db_xref="GOA:A9WE72"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE72"
FT                   /protein_id="ABY33732.1"
FT                   /translation="MSPLPRRIVLDTDPGIDDALAILLALASPEIELVGLSIVHGNCTL
FT                   AEAVANGLSVLELSGGHHIPLFVGCDRPLLRPLTTAHDTHGQRGLGYAQLPPAQLQPVS
FT                   EHAVDFIIRTALEAPGEVTLVAVGPLTNVALALRKEPRLAGALREIVIMGGALRADGNV
FT                   TPRAEFNVYADPHAAQIVFSSGAPLVIMPWDITRLVRLHESEVNRLAQAGKPIGRFIAD
FT                   ATRFYIEFHRRYFGYDGCAINDPAALALVFLPDLATYADVHVTVETCSPLTMGFTVADF
FT                   MLSDGRQPNARAVVEFDTPRFLSLFVERMQMLEQRLYA"
FT   gene            621334..621840
FT                   /locus_tag="Caur_0485"
FT   CDS_pept        621334..621840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0485"
FT                   /product="exonuclease-like protein"
FT                   /note="KEGG: rca:Rcas_3041 exonuclease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33733"
FT                   /db_xref="GOA:A9WE73"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE73"
FT                   /protein_id="ABY33733.1"
FT                   /translation="MRAYLDIETTYSGTMSVIGIYRHDRGVIQLVGGGIRDVALYEALE
FT                   AVSTIVTFNGSSFDLPVIKRQLQADLRAEFAHRDLLHECRRRGLRGGLKGVEERLGITR
FT                   VSSGLTGRDAPRLWERYEQYADQLALQTLLDYNRDDVVNLAVLEALLDAGNPPLANPAR
FT                   FVKLW"
FT   gene            621880..623682
FT                   /locus_tag="Caur_0486"
FT   CDS_pept        621880..623682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0486"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein of unknown function RIO1; protein
FT                   kinase; tyrosine protein kinase; PASTA domain containing
FT                   protein; SMART: serine/threonine protein kinase; KEGG:
FT                   rrs:RoseRS_2631 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33734"
FT                   /db_xref="GOA:A9WE74"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE74"
FT                   /protein_id="ABY33734.1"
FT                   /translation="MQPQLLDGRYQIEQLLGEGGMARVYLGRDLRLNRPVAIKIPHPHL
FT                   MTDPDFMARFRHEAHAAAMVSHPNLVDVYDVGQDGDRHYIVMEYVAGTTLKQLINREAP
FT                   FAIPRAVRIAEQIARGLHAAHRAGLIHRDIKPQNIIVTDDGQVRITDFGVAKSRLSTAM
FT                   TETGVTLGTVDYIAPEQAQGRAATPQSDIYALGVVLYEMLTGRLPFTGDNAVAVAMKHI
FT                   SEPPPPPRRYNPQIPAALEAIILRALAKDPAQRQQSALELAEELQAYDRLVSQATVVNP
FT                   GIAPPPAQVQTRSPGPQRPAQVTAARPAPIPSPRPAATRAPRQENVGCGVFLVGMLTLV
FT                   GVLAIVFVVSSGMLNNLFSGNTNRPVTPATGTNPSETPSPTIVATAIVPDIVGRSDGEA
FT                   RTLLEQNQLIPAPTGEYNRDVPQGIVITQTISPGTIVEANSPLSYTVSLGPLLVSVPDV
FT                   TGTRSTIARDQLIAAGLTVTVVEEPSQTVDVGFVIRQSPSANLRIPQGDEVTIYVSLGD
FT                   VVRFPDVIGRSRAEAEAILNNTPGIILVYVDVQGRDRLPNFDSYAPNQVVSAARETSGG
FT                   YVGLNNGDYIPRGSRVVLGVRAEE"
FT   gene            complement(624087..624806)
FT                   /locus_tag="Caur_0487"
FT   CDS_pept        complement(624087..624806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0487"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rca:Rcas_3044 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33735"
FT                   /db_xref="GOA:A9WE75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE75"
FT                   /protein_id="ABY33735.1"
FT                   /translation="MFQQPMQMIDKTVICCEHVTKSYLEGERQRIVLRDITFQVQAGEL
FT                   IVLLGKSGSGKSTLLNLVSGIDTPDTGAIWVAGQRLDQLRERERTLFRRRSIGFVFQFY
FT                   NLAPTLTALENVLLPLELNGQRGATARAAALAMLEAVGLADRANTYPDRLSGGEQQRVA
FT                   IARALVHNPELVLADEPTGNLDSDTGAQVLDLLDQLTRQQGKTLIMVTHSREMVGVADR
FT                   VFQLRNGQIQEVALSAV"
FT   gene            complement(625211..626131)
FT                   /locus_tag="Caur_0488"
FT   CDS_pept        complement(625211..626131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0488"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: rca:Rcas_1550
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33736"
FT                   /db_xref="GOA:A9WE76"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE76"
FT                   /protein_id="ABY33736.1"
FT                   /translation="MPIQKMDYIWFNGELVEWDKATVHVLSHAIHYGTSFFEGIRCYET
FT                   PQGPAIFRLTPHMQRLIDSAKIYRTTIPYTLDQLVAAVKETVRANRLRSGYIRPVVFRG
FT                   YGEIGVNPLNNPVEVAIATIEWGKYLGAEAMEQGVDVCISSWNRFAPNTMPALAKAGGN
FT                   YMNSQLIKMEAIANGYAEGIALDADGHISEGSGENLFLVRNGVVYTPPLTSSILSGITR
FT                   DTVMTLLREMGVEVREQVLPREMLYLADELFFTGTAAEITPIRSVDRIPVGTGRRGPIT
FT                   AAVQEVFFGIVQGERPDRYGWLEYA"
FT   gene            complement(626153..626986)
FT                   /locus_tag="Caur_0489"
FT   CDS_pept        complement(626153..626986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0489"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rca:Rcas_3811 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33737"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE77"
FT                   /protein_id="ABY33737.1"
FT                   /translation="MLVASFASGSTGNALLVRAGDQALLIDAGVPIRTLTNLLHACDTT
FT                   PQQVQAVLLTHEHADHAQYALAFARRYNVPLVAPAATLTALGESPDPVALDPLPVGEYG
FT                   AIGVFNVQSFRVAHDAADPVGYRIQMAGVSVAIAVDLGSWNAETVTALAKADLIVVEAN
FT                   HARELLPLSPYPVVVRQRISSPLGHLDNTQCGQLLAQVATHGGIGDVWLAHISRRANTP
FT                   QTALNDVSQTLRQAGIQRLPRMQVLPPRARPVPGGIICWQPQERWQQPGLFTGDW"
FT   gene            complement(627018..627620)
FT                   /locus_tag="Caur_0490"
FT   CDS_pept        complement(627018..627620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0490"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   rca:Rcas_4061 non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33738"
FT                   /db_xref="GOA:A9WE78"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE78"
FT                   /protein_id="ABY33738.1"
FT                   /translation="MRELLIATHNPGKLREFAAIFADLNLRLYSLADVGIQETIEETGQ
FT                   TFAENARLKAEGYLALSGLPTLADDSGLEVAALGGAPGVYSARYGGLSGPAQLQYLLDQ
FT                   MRDIPWHQRLARFVCVIALAHPDHPTELVEGTLPGVIEFAPRGSGGFGYDPLFYVLDED
FT                   ATLAELSAERKNQISHRAQAARAAREVLARWQRSSGS"
FT   gene            complement(628015..629097)
FT                   /locus_tag="Caur_0491"
FT   CDS_pept        complement(628015..629097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0491"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   rrs:RoseRS_2868 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33739"
FT                   /db_xref="GOA:A9WE79"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WE79"
FT                   /protein_id="ABY33739.1"
FT                   /translation="MFDKLAAVAARYDELTELMAQPEVATNVTLLQQYAREQREIEDIV
FT                   NAYREYQATQRAIEEAEAMLEDSDPELRALAQEELETQRKRLASLEEQLKLLLLPRDPN
FT                   DSKDVIMEIRQGEGGDEAALFAADLFRMYTRFAESRGWKVEVDSLTENGIGGIKEVIFQ
FT                   IHGEGAYSQLKYEGGVHRVQRVPATEARGRIHTSTATVAVLPEVEETEIEIKPEDLRID
FT                   VFRSAGHGGQGVNTTDSAVRIVYKPGTPEEIVVTCQDGRSQIQNRERAMTVLRARLYAR
FT                   EQEKRQREIGASRLAQVGSGERAEKIRTYNFPQDRITDHRIGQNFSNLPAVLDGELDKI
FT                   IEALIIYDNAERLRASGVST"
FT   gene            complement(629182..629385)
FT                   /locus_tag="Caur_0492"
FT   CDS_pept        complement(629182..629385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0492"
FT                   /product="ribosomal protein S21"
FT                   /note="TIGRFAM: ribosomal protein S21; KEGG: rca:Rcas_2428
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33740"
FT                   /db_xref="GOA:A9WE80"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE80"
FT                   /protein_id="ABY33740.1"
FT                   /translation="MRVERREGETVEQLIRRFNKGVVAERITKTYREKMHFISKSEQRK
FT                   EKRRRAERNRRKKLAKAAALGL"
FT   gene            complement(629586..631493)
FT                   /locus_tag="Caur_0493"
FT   CDS_pept        complement(629586..631493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0493"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: gka:GK0703
FT                   alpha-cyclodextrinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33741"
FT                   /db_xref="GOA:A9WE81"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE81"
FT                   /protein_id="ABY33741.1"
FT                   /translation="MEQYHVSADFIFGTMATDSRRLGYVRAELAGMSHRYRMEPLAPQP
FT                   GEPVRLFVTLGPSIVADQVCVYYTTDGSEPHGERGQPAPGSHVAHGQRLSSHWDTLLWG
FT                   YAEEWAIDLPPQPADTVVRYRIEAWLREGNGSLWYSEVIGATAGDGSVVGQPGPGDHYL
FT                   HEMGYEFNLTFFRRPRTCAYRVGDEGVPGWLDDALIYHVFIDRFHPGPGRQFANPPTPM
FT                   GIYGGTLAGVTSNLDYIASLGTTTIWLSPLFPSPSHHGYDATDYYSVEPRLGTMADLQT
FT                   LIAAAHDRGMRVIFDYTANHFSNRHPIFQRAISDPHSPERDWFIFTRYPDLYVSFFGVA
FT                   ELPQLDLDYPPARQFMIDAARYWLEQGVDGYRLDYTIGPSHDFWTLFRAAMRAVRPDCV
FT                   LIGEAVDTAEVLRSYVGRLDGCLDFLLLQAIRRFFAFDEIRASQFAVFLNRHLNYFPPG
FT                   FSLPTFLDNHDMNRFLWVVRGDTRRLRLAALCQYTLPHPPVLYYGTEVGLSQRLDVRHA
FT                   DGSGHPEESRLPMRWGDEQDQELLDFYRQLGALRRATTAVWRGKRTITHIDDQRGHLAY
FT                   TCTAQDQTWLVVLNNASQAGVIPVPPGRWTVVLPSQTAELVAGKVALPPYGGAILRREA
FT                   "
FT   gene            complement(631616..632716)
FT                   /locus_tag="Caur_0494"
FT   CDS_pept        complement(631616..632716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0494"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gka:GK0706
FT                   maltose/maltodextrin transport system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33742"
FT                   /db_xref="GOA:A9WE82"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE82"
FT                   /protein_id="ABY33742.1"
FT                   /translation="MSSVTIRSRRSGSTSAGRRLKWWQQLVLQAICLFIAATVLFPVLW
FT                   IVSMSLDPRNISRPTELNLIPPGASLQAYLQVLDRPTANPVTFTELAFNSLRLAGGVSA
FT                   FALLIGVSAAYAFSRFKFPGRQFMMIAVLAITVLPSVATIAPLFALLNSIRISSAIMSI
FT                   VLILAGLMLLGLTVFAVAPAIRLGSAGPGNYLFGAIGLAISLGLIYGGITPARSEVFIL
FT                   RNSLLGVGIAMVSGALPFAIWNLKGYLDTIPKELEEAAIIDGASPSQVFFQIVLPLATP
FT                   ALAVTGFLGFTGGWTEFFLSWQFLTDPKDFTLAMSLYNMTGQYAGQIPWSRFAAFSILL
FT                   SLPVAIVYLLLQRYIIGGLTLGGVKG"
FT   gene            complement(632709..633788)
FT                   /locus_tag="Caur_0495"
FT   CDS_pept        complement(632709..633788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0495"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ade:Adeh_4135 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33743"
FT                   /db_xref="GOA:A9WE83"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE83"
FT                   /protein_id="ABY33743.1"
FT                   /translation="MATTNPELTSQSVRVPRSALREGWKQLRTPIVYLLPALIIMMVVT
FT                   FYPLAFQVWMSFTDYGVIKEEGKQTLNPFGPNGTTPPNYRPAQYVGLKNYLDIITNNPQ
FT                   FVARLGGNFDFWRLLAFNLWWTFSNVGFHVVLGVIIAVLLNVEGLWGRKIYRAIYILPM
FT                   VLPNIVVATVWRNMFDDQYGSINQLINLFITPFGLDPVQIRWFNQIQDPIPGIGLPLSY
FT                   YAMLIANIWLGWPFMTIVATGALQSIPKEMYEAASIDGATGLQQFWRITLPLLRPAMVP
FT                   AAMVGIVTTFNLFHVIYFMSGGGPLGRTEIMVTQAFKLINVNQLYGVAAAFSVIIALVL
FT                   IPIFLITNKISRATESYDV"
FT   gene            complement(634368..635600)
FT                   /locus_tag="Caur_0496"
FT   CDS_pept        complement(634368..635600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0496"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tpe:Tpen_1055 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33744"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE84"
FT                   /protein_id="ABY33744.1"
FT                   /translation="MKRLSFSLIALLALFASILAACGQAPAAQPTAAPQPTTAPAPSTG
FT                   DGMAITGTVTLWHAYGTGSAEEKAINMLIDRARAAYPDATINVLQIPFDQIFNKFNNEV
FT                   SSGGGPDMFIAPNDSLGSQIRAGVLADLSEYQSKLTDVSPTGVAGMSLDGKLYGIPESF
FT                   KAVALYYNKSKVANPPATTDELLALVKAGNTLVLNQNAYHNFGWLQAFGGQLMDANGKC
FT                   IADQAGGAEWFAFLKALKEVPTVTFSTDGGQADSLFKDGKADMIINGPWVLGDYRAVLG
FT                   DNLGVAPMPGAAKPAGPLTGVDGFYVSINSQNVAGAVALAMFLTSPESMKVYVDEAGHV
FT                   PVSTKVEISDPLVQAFAQASATGVPRPQIPELDNYWGPFGDAMTKVLDGGADPAAAVAE
FT                   ACALMNTANGK"
FT   sig_peptide     complement(635514..635600)
FT                   /locus_tag="Caur_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.309 at
FT                   residue 29"
FT   gene            complement(635668..636147)
FT                   /locus_tag="Caur_0497"
FT   CDS_pept        complement(635668..636147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0497"
FT                   /product="regulatory protein MarR"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bbt:BBta_7499
FT                   putative transcriptional regulatory protein, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33745"
FT                   /db_xref="GOA:A9WE85"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE85"
FT                   /protein_id="ABY33745.1"
FT                   /translation="MTPSGSEQHRMIQEVYVLLDDGDRRVLRQFQLNPTQYAALLLLAE
FT                   HNGVRLSDLSEYLLIDKSSTTRLVDRLSALGLVERIADASDRRVQRIVLTRQGREHLGV
FT                   VRSAFTESVRRRWSTLDSTEHETLIRLLLKLRRELTILQHGTNGVKGGDISPERD"
FT   gene            636313..637866
FT                   /locus_tag="Caur_0498"
FT   CDS_pept        636313..637866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0498"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="KEGG: rca:Rcas_0390 transcriptional regulator, CdaR"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33746"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE86"
FT                   /protein_id="ABY33746.1"
FT                   /translation="MVTITVRDVVRLALPEGTNIVAGAAGLGRQVSWIATLRATLPAFA
FT                   ELRGGELALLSVEAALALDPRLTLAVLVRRLAQAPVPIAGVAVLGTITPEDQQAAEDAR
FT                   LPLLQLPEGVDLREVEREITRLITDYEAQFERRAARLYDLLTQCSLQGGGISGLLDILH
FT                   ERTGQSVAFYASNGVLRAQRGRGQSRLALQALRPNGRGETTLLNQQIWVEPIGNSGLPI
FT                   GYVAIAGTLLDPWDRTAAQRGALALALELAKEQAVQAAEERLRGDFIAGILAGAPGDLA
FT                   AVIQRGQELGYTLHLPHTAMLVHIDDASTATLARAATNIQNELKRLGVNAPISRRESNV
FT                   LCMLPTTSVTRLRELTEQLRERLRLDHPNVVIAIGTPATHLTEWRRSVEEAEQSLSLGR
FT                   QIFGNDRVLAFGDLGVYRLLIRLRETPELWSFYRETLSSLAEYDKRQHADLIKTLEAYF
FT                   NHLGNLRATSEALHVHRNTLLYRLERIKEISGMDLDNAEEHFALWLAVRAHRILATLEE
FT                   "
FT   gene            complement(638397..639815)
FT                   /locus_tag="Caur_0499"
FT   CDS_pept        complement(638397..639815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0499"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator, LytR/CpsA family"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   rrs:RoseRS_0249 cell envelope-related transcriptional
FT                   attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33747"
FT                   /db_xref="GOA:A9WE87"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE87"
FT                   /protein_id="ABY33747.1"
FT                   /translation="MPDKPSNGQYVTPRGGTPYTGETRVMRRLNAPSGSPSTPPRRRWA
FT                   LGRILLGLMTIIILVIGLGYWQVWQLAQRVVVSDPRGPALSSPLLGANILVVGVDIRRD
FT                   RPEEGVRSDTLMLIRFDGMGGWVNLLSIPRDTQVELDELGPSKINAAYAYGYRHATELY
FT                   GDGVTPEQAGMAYAADTVSRFLNFDQRGMRVDYVVQVDFDGFAALIDALGGITIDVPRR
FT                   IVDEAYPTPDYGVMRVEFEPGPQRMDGARALIYARTRHADSDFGRTERQQQVVQAIVQE
FT                   IQQRNWFERILLIPRLRDAITQDGETPAIVTTLPIANVDTLLAVARIAANLDPALIGRY
FT                   RIEPGTVAVQTNGSNLIWDANDVAALVTRWLTPPGEASEQAQVQVFNGAGVVGLARRTS
FT                   EKLAANGFTLLSPADAPPGEYPRTVVYQIGNTPFTARRLAQLLGADLVVGSPPGISSQA
FT                   DIVVILGNDAANGE"
FT   gene            640248..641150
FT                   /locus_tag="Caur_0500"
FT   CDS_pept        640248..641150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0500"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: NADP oxidoreductase coenzyme
FT                   F420-dependent; 6-phosphogluconate dehydrogenase domain
FT                   protein; 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: rrs:RoseRS_4286 6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33748"
FT                   /db_xref="GOA:A9WE88"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE88"
FT                   /protein_id="ABY33748.1"
FT                   /translation="MEVGLIGLGRMGANMAIRLRRGGHRVIVYNRTVAKARELAAEHDL
FT                   IAAEELSDLVAMLTPPRVVWLMLPAGSATDEHLAALTPLLTPGDIVIDGANNNYKASIA
FT                   HAEQLTAQGLRFLDIGVSGGIWGLQIGYCLMVGGDEETFHYVEPLLQTLAPPEGYLLCG
FT                   PHGAGHFVKMIHNGIEYGMMQAYAEGFEILRQSRYDFDLAKISHLWNQGSVVRSWLLEL
FT                   AERAFTADADLSSIRGYVEDSGEGRWTVQESIDLDVPAPIITLSLQMRFRSRQEDSFSM
FT                   KVLAALRQQFGGHAVKKVE"
FT   gene            641157..642677
FT                   /locus_tag="Caur_0501"
FT   CDS_pept        641157..642677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0501"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: rca:Rcas_1852 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33749"
FT                   /db_xref="GOA:A9WE89"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE89"
FT                   /protein_id="ABY33749.1"
FT                   /translation="MTTNVLDNPLRAGLRIGRTPEPCTMVIFGASGDLTSRKLVPALYN
FT                   LARERRLPGGFSVVGFARRDWTDETFRELLREAVNANSRSGAVDPDLWASFAQGIQYHR
FT                   GSFDDADAYTRLAERLATIDAERGTGGNRVFYLATPPEAYPTIIAQLGAHGLAHSHGWT
FT                   RIIIEKPFGHDLNSAQALNAEVLSVFSEDQVYRIDHYLGKETVQNILIFRFANGIFEPI
FT                   WNRSHIDHVQITVAETIGVEDRGGYYDTSGALRDMIQNHLMQLLCLVAMEPPAVYDADA
FT                   VRDEKVKVLRAIRPLSVNDTVRGQYGPGSANGRPVRGYREEKGVSPTSQTETYVALKLF
FT                   IDNWRWAGVPFYLRSGKRLPRRVSEIAIQFKAAPTMIFADTPLNDLEPNVLAMKIQPDE
FT                   GISLKFSSKVPGQPQIRPVTMDFRYGASFGVTSPEAYERLLLDCMLGDGTLFTRRDEVE
FT                   TSWALLTPILRDWAEGPPQPFPNYEAGSWGPAAADEFIARDGRFWRRL"
FT   gene            642692..643846
FT                   /locus_tag="Caur_0502"
FT   CDS_pept        642692..643846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0502"
FT                   /product="glucose-6-P dehydrogenase subunit-like protein"
FT                   /note="KEGG: rrs:RoseRS_2561 glucose-6-P dehydrogenase
FT                   subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33750"
FT                   /db_xref="InterPro:IPR004555"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE90"
FT                   /protein_id="ABY33750.1"
FT                   /translation="MSEVAIDISAIERELRQMWQEQANHPDAGGQAVIRALTVNLIVRA
FT                   PDDSWAEQILAVAPELTAQHPNRTVVVIDQPGTPPMLQANVQALCTLTNAGCPQVCGEQ
FT                   ITIHSRGTPAGQLSGIVLPLLVPDLPVVLWAPGPQPLAQPLIQRLYRLCDRLIVDSTTF
FT                   ADPIAELADLAIFEQRANGAPAVSDLGWTRLTPWRELTAQFFDTRSFLPHLHRIDEIEI
FT                   EYAADAVANPVAALLFVGWLASCLKWTPLKDAVGIEGDSIRLYLRRPAVGVGPAAIRLV
FT                   SVTIRPAPDRHGEGLQRISLRAIDNQRAEFVVEATDDAGHACTRATIAGASPIERTAKI
FT                   DHATLADLLSSELRLLSRDRTFAAALGLAGGLARRLVNRNNTAH"
FT   gene            644270..644638
FT                   /locus_tag="Caur_0503"
FT   CDS_pept        644270..644638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33751"
FT                   /db_xref="GOA:A9WE91"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE91"
FT                   /protein_id="ABY33751.1"
FT                   /translation="MFPFTELIFSPIGVGLLVLMLLLEWLTLVQIKWQPLFRALGDAAI
FT                   ASTVSAIVTLLLGQLLLALVNPLAVIVAAFALAVAVEGFVFMLIRKRKAAASYMAALVA
FT                   NTVSFIFFLIFYLSFLVM"
FT   gene            complement(645024..646064)
FT                   /locus_tag="Caur_0504"
FT   CDS_pept        complement(645024..646064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0504"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: rrs:RoseRS_2867 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33752"
FT                   /db_xref="GOA:A9WE92"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE92"
FT                   /protein_id="ABY33752.1"
FT                   /translation="MLTAELAAFIERMPKVELHLHLEGAVMPQTFLALSRRNNISLPVQ
FT                   TEEELLALFHYDDFHNFLETFMALAATIVSGEDFELLAFELGMALARQYVAYAEVMISP
FT                   MQHVRRGVDLREALAGAASGFARARRQGGPHVGIVLDYGRQYGAEAAWPILETAIACRS
FT                   LGVVGWSIGGNEIGHPPEEFAELFAAARRAGLGLMAHAGEVVGPASVWGAIDVLEVSRI
FT                   GHGIRSVEDPLLLKALAERDVVLDVCPSSNIRTKAVTSWQTHPLRQLYNAGVPVTINSD
FT                   DPTFFETTLSEEFRRIAHHFGFTADDFCRMTLTAVRATFLSPAERDALLTTVAQEQQRL
FT                   RAALGV"
FT   gene            646433..647386
FT                   /locus_tag="Caur_0505"
FT   CDS_pept        646433..647386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0505"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: rrs:RoseRS_2248
FT                   UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33753"
FT                   /db_xref="GOA:A9WE93"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE93"
FT                   /protein_id="ABY33753.1"
FT                   /translation="MKNLSGSQSIERVAPLSARSLQALIRTMRPRQWIKNIFVFAAIAF
FT                   SEGRLWYTEPVQLLRVIGAFIAFCMAASAIYLINDLVDIEKDRAHPKKRHRPLAAGILS
FT                   PTLAMVTAAILIIAVFPFAFWLDGDLDFMLVLAIYIAVQGFLYSYWLKNVVIFDILIIA
FT                   AGFILRAVAGAVVIDIVITPWLIVCMGLLALFLGIGKRRHELKLLEDGAGNHRRILDEY
FT                   SIPLLDQMQAIVTASIVMAYSMTAFSAPVAPQKPFPMLMITIPFVVYAIFRYLYLIHQR
FT                   DGGGAPEDLVLQDRPLALSIVLWGVTVLGVLVLFPS"
FT   gene            647393..648202
FT                   /locus_tag="Caur_0506"
FT   CDS_pept        647393..648202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0506"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   rca:Rcas_4059 aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33754"
FT                   /db_xref="GOA:A9WE94"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR024192"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE94"
FT                   /protein_id="ABY33754.1"
FT                   /translation="MYTFIKFGGSVITDKTGREAADLVVIERLAHAVAEARAADPNLAL
FT                   VLGHGSGSFGHHYAARYGVHRGIPLSADHTGFALTAAAALRLNRIVVDTLLAAQVPAVS
FT                   FQPSASLQSTNGQIITWETAPIAEALQRRLVPVIHGDVAFDTAQGTAIISTEALLSFLA
FT                   LRSPLQPRRIILVGEAAVYTADPHRDPTAQPIPLINQENIAQVLVMTGGSRAADVTGGM
FT                   RSKIELMWHLIERLPELEVTLIGPDPALLTAALLGQSLAMGTVIKRW"
FT   gene            648196..649152
FT                   /locus_tag="Caur_0507"
FT   CDS_pept        648196..649152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0507"
FT                   /product="protein of unknown function DUF95 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF95
FT                   transmembrane; KEGG: rrs:RoseRS_3801 protein of unknown
FT                   function DUF95, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33755"
FT                   /db_xref="GOA:A9WE95"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE95"
FT                   /protein_id="ABY33755.1"
FT                   /translation="MVTPDQQIRQRSTAWQRLEELIDRARGGIAQLSAAELQELGQLYR
FT                   QTCTDLAIARRDYPDHLLTSYLNQLVARAHGVVYRYSLNEPQRIVTFFRFTLPQTFRAT
FT                   WPMTLVAAILLLLPAIAAFITTFRDPALGEVLIPGIEVLVDQIRAGEEWWLRINEGPAA
FT                   ATAEIMTNNINVAIRAFAGGVTFGLYTAYILVINGLLLGTVSGIAQRLDFAPNLWGFVV
FT                   GHITLELSAIFIAGGAGLQLGWAILRPGLLSRRQALVVAGRRAVVLLIGCGLILIGAGL
FT                   IEGFISPTGLPFIVKLIVSIGSGVLLYTYLLFSGHHR"
FT   gene            complement(649280..651250)
FT                   /locus_tag="Caur_0508"
FT   CDS_pept        complement(649280..651250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33756"
FT                   /db_xref="GOA:A9WE96"
FT                   /db_xref="InterPro:IPR021280"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE96"
FT                   /protein_id="ABY33756.1"
FT                   /translation="MSSPYMTILDPIGKQRRLSPYWSVLLLGVAFAGLYSATLTEVHTY
FT                   DALSYILDVDRKPWPELFHPHHLLYGPLGAVIRAIATALGWQGSVEIWLQLVNAVAGAI
FT                   GVSFLFAICRSVTGSGMAALAATLWVGFSYAYWYYAVEVEVYTLAAIALIGVLWLLFKM
FT                   AQQPTTHLSIWLGMTQGLAVLGHQTNVLLSVPIFLTIVLAETNLQRRLRLFVSYLIPLL
FT                   IVVGSAYLWVAIGVSGMRRWEDIWLWLTGYAQTGFWGGAIDGSKLIGLLKGWSATLAFF
FT                   GGGVIGLAGIGLLVTGREGIARLPLPLRAGIVGWLGVYGLFFLWWEPDNIEFWIACLPP
FT                   LALLLSAALTVRWIGWVGLLLSLSLLALNLPTIIERGAAGRDLQRRIAAALAAISQPGD
FT                   LIIVPDGVLELYLPHYWQHDNVYGLNQAMTASNGDWEAACSRIQQRIEATLTAGYAVII
FT                   ADEAQRPLPAPPDQPPTPAERFGLSAETVARCYAPVQGMLRLAPLPADLPTYRLIPRAN
FT                   ELAVAEGWDFRHGRWGWQVGGVEVDTLTEVGWHMIPTLDPMLTSPPLLLATADIEAIEV
FT                   RLATTTTNRDAQIFVIDPAGRTDEDYSLRFTLTGMEMATYRLPFDEIRERLTQIGGLRF
FT                   DPVALGDGGAVLVESIRLIRR"
FT   gene            complement(651848..652228)
FT                   /locus_tag="Caur_0509"
FT   CDS_pept        complement(651848..652228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0509"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   rca:Rcas_1679 protein of unknown function DUF192"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33757"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE97"
FT                   /protein_id="ABY33757.1"
FT                   /translation="MGWEIKARMVQVVNQTRRAILASQCEVARSFFARGRGLLGRQSLP
FT                   VGGGLLIEPCNSIHMLFMRFAIDAIFVDRNGTVVALYPDLPPWRIYAGHRQARYVLELP
FT                   VGVIAATNTVVGDQIVVQELQE"
FT   gene            complement(652212..653147)
FT                   /locus_tag="Caur_0510"
FT   CDS_pept        complement(652212..653147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0510"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   rca:Rcas_1680 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33758"
FT                   /db_xref="GOA:A9WE98"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE98"
FT                   /protein_id="ABY33758.1"
FT                   /translation="MMDLLIVAGIVVIGASLIIVAVRQMNQSRAISERLDQYTDISLSL
FT                   EELELQQPFRERVLVPLFRSLLNTLGRFGLKQNQERLRINLQLAGNPGNISPNMFIGLR
FT                   MALAIVLFVVIGLLVFGRLPFMQALMGALIAGMIGYILPGIWLDRKIKERKKNILKALP
FT                   DALDLLCISVEAGLAFDLALQRVAQKWDNELSREFQRVLQDIRLGRTRREALRDLVTRT
FT                   GVEDVQTFVSAVIQADQLGVSMSKILRIQSDQLRVRRRQRAEEAAQKAPVKMLIPMVFL
FT                   IFPALFVVILGPAVPRIMQALGVMNSGMGN"
FT   gene            complement(653157..654155)
FT                   /locus_tag="Caur_0511"
FT   CDS_pept        complement(653157..654155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0511"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   rrs:RoseRS_1275 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33759"
FT                   /db_xref="GOA:A9WE99"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A9WE99"
FT                   /protein_id="ABY33759.1"
FT                   /translation="MDLLLSPEMMPVTLGALGLLLFLLVITVVVLMRQSATADVAQRLE
FT                   TFAGGKAQERSNEPIARQAIERIDAVVAKSKQGSSIQRELARADLKLTVAEFIGLKLGA
FT                   ALLGVVFGFILGRANFLAQIGAATAAAIVFSFLPNLYVNMRAAQRIKAFNNQLGDVITM
FT                   MANALRGGYSFLQTLDMVSREAPPPAATEFRRVVQEVGLGRSTEEALQNLLRRMPSDDL
FT                   DLLITAVTIQMEVGGNLAQILDTIGHTIRERVRIKGEISTLTAQGRISSWIITGLPIGL
FT                   AMFITVVNPDYMAPLFTFGFPPQAWCCMPVASLFMIAMGYFAIQKIIDIEV"
FT   sig_peptide     complement(654039..654155)
FT                   /locus_tag="Caur_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.893 at
FT                   residue 39"
FT   gene            complement(654198..655595)
FT                   /locus_tag="Caur_0512"
FT   CDS_pept        complement(654198..655595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0512"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   rrs:RoseRS_1274 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33760"
FT                   /db_xref="GOA:A9WEA0"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEA0"
FT                   /protein_id="ABY33760.1"
FT                   /translation="MSLLKRIGGGVPATTEPAVPRTPVRPEATGRLQPPVGAFGTDDTF
FT                   RELRSRVQDRLINELNPQIDLSNPAKVRKQVEEIFNAILDSESIVLSRTERQRLFESIT
FT                   ADIIGLGPIEPLLADEDVSEIMVNGPKQVYIEKKGKLIKTDITFTDDDHVMRIIDRIVA
FT                   PLGRRVDESSPMVDARLKDGSRVNVVIRPLALNGPTITIRKFRKDKLTVQDLVRFGSMS
FT                   QDMADFLAACVQARLNIVVAGGTGSGKTTLLNVLSSFIPEDERIITVENAAELQLRQDH
FT                   VVTLESRPPNVEGKGEVTIRDLVINCLRMRPERIIVGECRGGETLDMLQAMNTGHDGSM
FT                   TTIHANTPRDAVSRIETMCLMAGMDLPARAIREQIASAIHVFVQQSRLKDGSRKVTQIT
FT                   EVAGMEGDVVVLQDIFVFEQTGIDEKGKIVGQLRPTGVRPRFLEKFEALNIFLPPTIFG
FT                   SSERFSF"
FT   gene            complement(655650..656901)
FT                   /pseudo
FT                   /locus_tag="Caur_0513"
FT   gene            complement(657034..658086)
FT                   /locus_tag="Caur_0514"
FT   CDS_pept        complement(657034..658086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0514"
FT                   /product="SAF domain protein"
FT                   /note="PFAM: SAF domain protein; KEGG: rrs:RoseRS_1272 SAF
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33761"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEA1"
FT                   /protein_id="ABY33761.1"
FT                   /translation="MRRGALLFLLIGLIVIIGGLAAFLLLRGGAATSTTSQTPEVPPPP
FT                   TAVPLVSVVQARVDLEANTLLNDPSLLDVVEVPVTEFDEANEFSNINDVLGKLLINPVV
FT                   AGQSIRKDNIREAGLAQRIPTAEPGQAQVKAYPLIVNSLSGVADQVAVNDFVDVIATFS
FT                   VERQIIRPGPVQVITVNDVDQLVREYQYGENQTFFSTKTIIQRAQVLQIVRPALPAPTE
FT                   GEETTTEAVTPPASSSLPQVDASGQPITGAQTAEGGATTPSTLTEGVWVVVLALTDQEI
FT                   ELLEFALQSQARIVLALRGANDDAIESTSGVTLDLLVREYGLPLPRPLPPRVYGEDEVF
FT                   VPEPTPTPLP"
FT   sig_peptide     complement(657994..658086)
FT                   /locus_tag="Caur_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.301 at
FT                   residue 31"
FT   gene            complement(658354..659238)
FT                   /locus_tag="Caur_0515"
FT   CDS_pept        complement(658354..659238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0515"
FT                   /product="alpha/beta hydrolase fold-containing protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   rrs:RoseRS_2485 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33762"
FT                   /db_xref="GOA:A9WEA2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEA2"
FT                   /protein_id="ABY33762.1"
FT                   /translation="MSTSSTLWEIESPLGPVAFRVSGQGRPLIFIHGWGASSRYWQAAP
FT                   AFLPNRRLIAIDLPGCGASPAPLEPVSLESSARAVLAVADALDIDRFALVGHSLGAAVA
FT                   LAVAGLAGARVERLGLVSFGIGANLYEDALVTLAGAQWQVAAAYWRPLLVWWRPWWEYT
FT                   STWRQALWALPPTPDLLARPLVRQPLDRSLLAQGIADLAAMDPLVAIETAAIMGHPRLK
FT                   RLLQLPLPPVVLISGSDDPVFPPVNVEMLSRVLPDVQVVFIPNCGHVPMVEEPAACYQT
FT                   IARFLDGENDYLS"
FT   gene            659476..660162
FT                   /locus_tag="Caur_0516"
FT   CDS_pept        659476..660162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_3416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33763"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEA3"
FT                   /protein_id="ABY33763.1"
FT                   /translation="MSSIIHNLVNDLAAMAAPPHTVNMYAHQAADEQEAHGNAIRRNNL
FT                   VLALTLALERGPDLLLIGEAPGYNGARRTGVPFTSEQILLAGVDPPGQFGTTRGFALAT
FT                   TDGRISREQTATIVYRELQALNRFAVGWNAFPLHPHRPGQPQSNRTPLQREVMLGLPFL
FT                   LRFCLLFPRCPVVAMGRIADQALSRLGIVHAVVRHPAQGGAQMFAAGLRRLFMQSDEST
FT                   PAQNPV"
FT   gene            660201..661952
FT                   /locus_tag="Caur_0517"
FT   CDS_pept        660201..661952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0517"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: rca:Rcas_4246 alpha
FT                   amylase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33764"
FT                   /db_xref="GOA:A9WEA4"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEA4"
FT                   /protein_id="ABY33764.1"
FT                   /translation="MHRIIVTLLTISVLVACGAPAAGPTAPAASPTVAGTPTNSRPPTP
FT                   TRDPRLPTLPPRITPGPTATPFPLEAGWWDGAVCYEIFVRSFYDSDGDGNGDLNGIIAK
FT                   LDYLNDGDPNTTTDLGINCIWLMPVAEAASYHGYDTIDYYTVERDYGTNEDFKRLVAEA
FT                   ERRGIKIIIDLVLNHTSTQHPWFQEALRDPNSPYRDWYLWSAIDPGYRGPFGNNVVWHK
FT                   SPIRDEYYYGVFWGGMPDLNYRNPAVTAEAYKIARFWVEEMGVAGFRLDAIKHLIEYYT
FT                   LQEDTVETFEWLREFRRFLDRELPGTFTIGEVFNGNPRTLAPYYPDQLDYYFEFEVANQ
FT                   IRGAANTGLSRLFMQAVQDAYTKLPYQRWAPFLTNHDQNRVMSVLGDDVAKAKLAALAL
FT                   LTMPGLPFIYYGEEIGMLGVKPDERIRTPMQWTKEEFGGFSAGIPWQQPQSDYPVKNVM
FT                   LQDQDPESLLNTYRQLIHLHVNTPALATGDFWPLTANGASVAAYIRRSGEDMVLVVINF
FT                   DKVPTPPFTLSSGESDLPAGTYQVTALFGTPPAPPVPLTIADGRIVEYQPGIEIPAQTG
FT                   YIFRLER"
FT   sig_peptide     660201..660305
FT                   /locus_tag="Caur_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.558 at
FT                   residue 35"
FT   gene            661952..662728
FT                   /locus_tag="Caur_0518"
FT   CDS_pept        661952..662728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll2767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33765"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEA5"
FT                   /protein_id="ABY33765.1"
FT                   /translation="MLRKVTATRYVTPLREGGSLPAIVEADDDGLYVVKFRGAGQGPKV
FT                   LVAELICGELARALGLPVPELVLIEIDPALGRNEPDGEIQDLITASAGLNLAVDFLPGA
FT                   LAFDPTSVRALDRKLASLIVWFDAFITNVDRTPRNTNLLWWHRRLFLIDHGAALYIHYT
FT                   WNDYQNHARKPFSQIRDHVLIAAASDLEAADRELADHINTDLLWRIVANVPDEWLIDQR
FT                   FSSVEDHRAAYVEYLSLRLAAPRAFVQEAIDVHERL"
FT   gene            662709..663137
FT                   /locus_tag="Caur_0519"
FT   CDS_pept        662709..663137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33766"
FT                   /db_xref="InterPro:IPR021398"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEA6"
FT                   /protein_id="ABY33766.1"
FT                   /translation="MSTSAFEYALLRLVPRVERGEQINIGVVLLCRQHRFLGIRIHLNE
FT                   ARIAALWPDLDLAPVHEQLAAFEMVCAGGAGAGPIGELPIYERFRWLTATRSTMIQPSA
FT                   VHCGLCDAPQVMLDHIFQQMVVLPGQAIDERAHEAGAL"
FT   gene            complement(663132..663503)
FT                   /locus_tag="Caur_0520"
FT   CDS_pept        complement(663132..663503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33767"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEA7"
FT                   /protein_id="ABY33767.1"
FT                   /translation="MNVNTILNEAITGVKGAQFAGIIGTDGLSVAIAYHPGAAELDFDI
FT                   ELAELELADLASRAAAAADRIGVGYVRDLVLETDALLMLASQIIPGYYGILGVLSETAN
FT                   LGKARFALQAMIERVRVEL"
FT   gene            complement(663898..664512)
FT                   /locus_tag="Caur_0521"
FT   CDS_pept        complement(663898..664512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0521"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: rrs:RoseRS_1533 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33768"
FT                   /db_xref="GOA:A9WEA8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WEA8"
FT                   /protein_id="ABY33768.1"
FT                   /translation="MTVRTDQLIAAPVARLIEEFAKLPGIGPKTASRLTFYLLRAEPKQ
FT                   ALALAQAILDVKEQVGYCRRCFNITVGELCAICLDPSRDQTKICVVEEPLDVLAIERTG
FT                   AYRGLYHVLHGHIAPLEGIYREDLKIEELLARVRSEPVQEVILATNPNTEGEATAFLLL
FT                   RDLAPLGVRVTRPARGLPTGGDLEWADPETLGSAFEGRREL"
FT   gene            complement(664592..664894)
FT                   /locus_tag="Caur_0522"
FT   CDS_pept        complement(664592..664894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rrs:RoseRS_1534 conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33769"
FT                   /db_xref="GOA:A9WEA9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WEA9"
FT                   /protein_id="ABY33769.1"
FT                   /translation="MNQRQLMQMAQQMQRQMQKVQEELAATIVEGTAGGGAITVKMNGH
FT                   REVQSITISPEVVDPDDVEMLQDLLLVAINDASRKAQQLAEERMQPLTGGLKGLF"
FT   gene            complement(665030..666859)
FT                   /locus_tag="Caur_0523"
FT   CDS_pept        complement(665030..666859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0523"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rrs:RoseRS_1535 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33770"
FT                   /db_xref="GOA:A9WEB0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEB0"
FT                   /protein_id="ABY33770.1"
FT                   /translation="MLCGSRSSESVMAVQSLYRKWRSQTFAELVGQEHVVQTLRNAIAE
FT                   DRVGHAYLFTGPRGVGKTTMARLLAKAVNCLNPDPTARPCGVCEMCAAIAEGRAVDVIE
FT                   MDAASHTSVEDAREIIERVQFRPAEARMKVYIIDETHMLSTAAFNALLKTLEEPPDHAL
FT                   FILATTEVHKVPATILSRCQRFTFVRHSVSAMAAHLRRIAAAEGIVLADGVPEAIARAA
FT                   TGSMRDALGILEQLASFVEGPITLPQVQSLLGMTAAAEVDALITALVNHDLTAALRAVH
FT                   GVANQGADVRQFTRDLVERLRAVMVLKATGDRTLLDLSDDEVALLGQWVQQADMAALVH
FT                   WVKLFSNLDAQLRTTPYGQLPLEVAVVEALLVPPPVAQPASSSASRSASLAGRTPTSRP
FT                   SAAVPAIVPQTEPVRAPAHPEPVPPSVVAPPPPPVPEPVSASGSEVPSDVTPVSDPPPP
FT                   PPEAWAATRQMRPPADPAVARAADADMSVLEQLEAIWEDFKRDVRPRSPTVQALLNSAR
FT                   PYDVEGNTIVLLVTSSFHKERLEEPKNRSLLEDLLRRRLGKTYAVRCTIEEKSVEPTDL
FT                   RGKIREARKDELVRAALNIFDAHIVDIEPLDPE"
FT   gene            666951..667601
FT                   /locus_tag="Caur_0524"
FT   CDS_pept        666951..667601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33771"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEB1"
FT                   /protein_id="ABY33771.1"
FT                   /translation="MLTYEQLISVLIEELEHQQINIVHTQELIDAHTLGRSLHVTCFPP
FT                   NIDKRGPWVRLPLRAVISLQWPAELTVISLHGQAMIETFNQLVGQPIDTRNLLGFELTY
FT                   HLPLSHAEQATADASALTKKVIDLFADQPDIEQNLDINATIQYSVNQEPVLAQLTVTRQ
FT                   FPILRLDRDLVEEAAIALAIELREMLPRLTIVFHAGQNESGLDPQLYLRPPTA"
FT   gene            667601..669223
FT                   /locus_tag="Caur_0525"
FT   CDS_pept        667601..669223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0525"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; KEGG: rca:Rcas_4197 ATPase associated
FT                   with various cellular activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33772"
FT                   /db_xref="GOA:A9WEB2"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEB2"
FT                   /protein_id="ABY33772.1"
FT                   /translation="MPFSSAALHALLQPGVSERWQAVQRLLHPEMLVLANRAAERAAAL
FT                   LPQQWPLYELSFKSRRAIDRGGGRRDPITDYWFAFDRPPRGAGVMLTVSGIERTVTVGL
FT                   QLWGVRRPQLAHLWSQARPVWEALIDRIEHEGQARFAGRRPPMTGMRWIDHYLNSRAHY
FT                   LWAGFVYDWNALPTAERLIDDICALLPLNEALMEQAEIDLATTNTLRETPARYLTGAPS
FT                   VAQIVMSIKRRGMIIDERTLHAFHLAVQARPLVILAGPSGSGKTWLTRLYADALIGIGE
FT                   GQPNPCYLLVAVQPDWHSARDLLGYYNSLTGLYQPTPFLNFLLKAAADPDQTYIVCLDE
FT                   MNLARPEYYLAPILSAMEAVEGLIDLGTPLAETPLAGGGVVRNPIRLPINLRLIGTINV
FT                   DESTFALSDKVLDRANLIELGTVDMAALRSQYPIANDQVWQILSDIQHHLTAAGKPAGY
FT                   RALREILGFVGQATDMNVLEALDLQILQRLLPRLRGEDSPRFRQALNGLHAICAGRLSR
FT                   SAERLAQMMARLEREGYTDFYGY"
FT   gene            complement(669361..669975)
FT                   /locus_tag="Caur_0526"
FT   CDS_pept        complement(669361..669975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1547 glycosyl hydrolase, BNR
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33773"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEB3"
FT                   /protein_id="ABY33773.1"
FT                   /translation="MAKAGVLYVGTDNGLYIFSDPGGTGRWRLLPDVALANEQIIGLVA
FT                   ADSQSLVVATKQAFQRSDDGGRQWQEADAEDRMLFNFLNSQRVPVATVQGMGVWRHSEP
FT                   PLSDCSLLAVLSGKQEVLLAVTAEGKRMLRSDDGGKTWQDVSVTFQGRLSAFAPSSYHI
FT                   DVVWAGTDTGQILRSDDRGRSWQHVGNVPHAVRCLAAVRVA"
FT   gene            670318..671388
FT                   /locus_tag="Caur_0527"
FT   CDS_pept        670318..671388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0527"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: eba:ebA2987
FT                   putative two component sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33774"
FT                   /db_xref="GOA:A9WEB4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEB4"
FT                   /protein_id="ABY33774.1"
FT                   /translation="MSFASIRHFWRTNEPIASAIRLTGWYLLIAGSWVLFSDRLLVAII
FT                   VNIDELTNWQTIKGWFFVLLTAGWLGIERWRTMKHQQRINDELRAANAALQELNASLEQ
FT                   RIMERTAPLQMANQALSELNQELETFTATISHDLKAPLRVIDGYSQLLLRFHIQRLDED
FT                   GQQCLHSIRTAVAQMNQLIDDLLEYTHVERKTLHHSVIDLSGLIDELLGYYADQILEHH
FT                   IVIERDLRCTHLYADATGLALALRNLIDNAIKFSARVPQPRLAIGSDVHNEMVRLWVKD
FT                   NGIGFDMRDHERIFTIFQRLHPQETYPGSGVGLAIVRKAIERMGGRVWAESSPGVGAVF
FT                   YLEIPHVGLSEPSAAH"
FT   gene            671354..673579
FT                   /locus_tag="Caur_0528"
FT   CDS_pept        671354..673579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0528"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: rca:Rcas_3604 putative PAS/PAC sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: response regulator
FT                   receiver; metal-dependent phosphohydrolase HD sub domain;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein; metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33775"
FT                   /db_xref="GOA:A9WEB5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEB5"
FT                   /protein_id="ABY33775.1"
FT                   /translation="MLAYPNHLLLIEDNPFDADLFRRTMQFYHPEIAITHFSSYRAAYE
FT                   HLQTLSPATTPYAGVVLDLHLRDGDGLDLLALIRARNLPLAVVILTGGGGDHMVISALK
FT                   AGADDYVVKRDDYLDRIGAIVEQACQRFHSQQARRSQTIQVSFIALATTDSEATIQHLQ
FT                   RSAPHLHCTLIHGWRTFLHHLDHQRAVGDVILIDCAQPNLAMLDLVKELIQFRHLEQPV
FT                   LVLAQPGNEEFPLQTLRLGAADYIIKSEGFRNHLAVAIENAYYRAQIHQQHYQLQLQAQ
FT                   ALNAAANTIVITDRNGIIEWANPAFTTLTGYEVSEVIGHSTRILRSGKHDNEFYSALWN
FT                   HILSGQPWRGRIINRRKDGSLYHEEMTITPVTDEHGEIRRFIAIKQDISDQVAQEQRRI
FT                   ILANIGTALRPAQLWVELTPILLDQVREVMQADSIALLRPQGATLAIDLAYNCLGHLAS
FT                   QPTILAALAERLAQSDGPTDVTDVVQSTTKIVVGVPLNAANRTIGALLITRATPLNSFE
FT                   VDLLRDIAELAANALHRTDLFEQLRAANAELRAAYDETIEGWSRALDLRDRETEGHSRR
FT                   VTELTVRIAARMGFSDEELLHVRRGALLHDIGKMGIPDAILLKPGPLDEQEWAIMRTHP
FT                   TLAVELLRPIAFLAPALDIPWCHHEKWDGTGYPRGLRGEEIPLAARIFAVVDVYDALTS
FT                   DRPYRAAWPRERALAYIREQAGHHFDPHVVDVFEQIITETDSNAIMK"
FT   gene            673662..676649
FT                   /locus_tag="Caur_0529"
FT   CDS_pept        673662..676649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0529"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SEC-C motif domain protein; SecA DEAD domain protein; SecA
FT                   Wing and Scaffold; SecA preprotein cross-linking region;
FT                   KEGG: rca:Rcas_0657 preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33776"
FT                   /db_xref="GOA:A9WEB6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WEB6"
FT                   /protein_id="ABY33776.1"
FT                   /translation="MMNFLRRLLGDSNEKELRRLQPIVEEINRLGPEFAALSDAELRAK
FT                   TDEFRQRLADGETLDDILPEAFATVREAAHRTIGLRHYDVQLIGGIVLHQGKIAEMKTG
FT                   EGKTLVATLPLYLNALEGKGVHLVTVNDYLAKVGAGWMGPIYHFLGLTVGFIAHDQSAL
FT                   YDPDFIDPDANPEDQRLVHWRPCTRREAYLADITYGTNNEFGFDYLRDNMAYEKSQLVQ
FT                   RELHYAIVDEVDNILIDEARTPLIISGPAQKSSDLYRQMAQLVRQLRRSSVTAKQVKEE
FT                   GLEPDGDFFVDERTKSIYLSEKGIEKLERLLRIPPGESLFDPEHYEKTHYIENALKAQF
FT                   IYQRDRDYMVTPNGEVVIIDEFTGRAMPGRRWSDGLHQAVEAKEGVAIKNENVTLATIT
FT                   FQNYFRMYKKLAGMTGTAYTEREEFAKIYNLEVVVIPTHKPMIREDLPDQIYATEEAKF
FT                   NAVLREVQEMHEIGRPVLIGTTSVETSERISAMLKRAGIPHNVLNAKHHEREAAIIAQA
FT                   GRKGAVTVATNMAGRGTDILLGGNPDGLLEEFLRKEGLTIETATPEQKRAAWEKARAQT
FT                   EAEGEEVRRLGGLHVIGTERHEARRIDNQLRGRAGRQGDPGSSRFFLSLEDELLRRFGP
FT                   VDRIKGLMERFVDSDVPLQAGLLDRTIEGAQTRVEGYNFDVRKHTVEFDDVMNKQRQII
FT                   YADRKAILDEADMRERVLDLMAEEIQRQIDEHLIDGFEEEDLTNLLRAYRRINSTLPAS
FT                   VTAETLKGKTKEEIEQYLLDHLETTYAERERAVTPELMRTIERRVMLGAIDRQWVDYLT
FT                   AMDELRQNILLQAYAQRDPLVEFKRESFRMFDELKQNIARDIVYNIIPATFQYEAYLRQ
FT                   IAEEQARRLATAQTVSSDGNGEVVRKPQRRSTPQIGRNELCPCGSGKKFKHCHLGREHE
FT                   LASLLNAQPSAPPASKALKSTPATQTAVAEEAAKIQAAINSGKLPPTQTTPRGRQAPSV
FT                   PRGKKR"
FT   gene            678095..679648
FT                   /locus_tag="Caur_0530"
FT   CDS_pept        678095..679648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0530"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rrs:RoseRS_1317 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33777"
FT                   /db_xref="GOA:A9WEB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEB7"
FT                   /protein_id="ABY33777.1"
FT                   /translation="MTQNGQERPVVLEARGITKRFPGVVANDNVSIKLYKGEVLALLGE
FT                   NGAGKSTLMNILYGLYHQDEGEIFVKGEPIRISNPHESIARGIGMVHQHFQLVPVMTVT
FT                   ENVILGNEVTSGPFLDRKRAAERIRQISTQYGLAVDPDALVADLDVGAQQRVEIIKALY
FT                   RNADILILDEPTAVLTPQEADDLVRVMRTLTAQGTSIIFITHKLREVLEVADRIMVLRG
FT                   GKVVGETTPDQATEASLAAMMVGRDVILKVDKQPARPGEPVLEVQGLQVRDDRQLLAVK
FT                   GVSLEVRAGEILGIAGVQGNGQTELVAALTGLRPSEGGTIRIAGVDVTNASPRTISELG
FT                   VAHIPEDRQRDGLVTSYPLTDNSVLELYYLPPFANGIVRNEPAINDHCSRLVQEFDVRT
FT                   PSIHVPASSLSGGNQQKLIVAREFTRQLKLLIASQPTRGIDVGSIEFIHNQIVKKRDEG
FT                   VAVLLVSAELDEILSLADRIAVMYHGQIVATVKNGELSREELGLLMAGATIDRSVSVEA
FT                   "
FT   gene            679688..680827
FT                   /locus_tag="Caur_0531"
FT   CDS_pept        679688..680827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0531"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rrs:RoseRS_1319 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33778"
FT                   /db_xref="GOA:A9WEB8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEB8"
FT                   /protein_id="ABY33778.1"
FT                   /translation="MAQAATETGIRPSALRQFWERWSGILVPILAVFTALVVGAFIIGI
FT                   TGADWQAAYIGLWEGAFGSPRAFADTVVRSTPFIICGLCVALAFKAGLFNIGAEGQLYA
FT                   GAVAAVVIGTTLQMPAIFHIPAALIAGALGGAAWAAIAGFLKARTGAHEVINTIMLNYI
FT                   ALRMTDWLIRSKTPYILGDPADTTGARSRLIAETARLPGIQVGSSTILHLGIPLALILV
FT                   FVVAWLLYRTTLGFEMRTAGTNPNAARYAGISVPRTIILAMAIAGGLAGIAGSIEVIGV
FT                   RGALSADFFSGLGFDAIAVALLARANPVGIIFSGLLWGGLLTGARLMQVRASLSIDVIK
FT                   IVQALIIMFVAADQIVRFVYRLPKRKPGEETQLSKGWGG"
FT   gene            680946..681452
FT                   /locus_tag="Caur_0532"
FT   CDS_pept        680946..681452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0532"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   xac:XAC4070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33779"
FT                   /db_xref="GOA:A9WEB9"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEB9"
FT                   /protein_id="ABY33779.1"
FT                   /translation="MDNTTFPNRPARAANEERMAEIILPHQTNGYGTMFGGDVMALMDK
FT                   AAAIAALRFCRLPVVTASTERIDFRTPIGQGEIVEAFSRVIYVGRSSMVVRVHLFAEHP
FT                   LIGDRRLCTTGYFSMVAINREGGPAPVVPQLLLLDDDARAEHAVGAEIHAAIAARRNSR
FT                   TTGRS"
FT   gene            681449..681916
FT                   /locus_tag="Caur_0533"
FT   CDS_pept        681449..681916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0533"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: rrs:RoseRS_4322 flavin reductase domain protein,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33780"
FT                   /db_xref="GOA:A9WEC0"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEC0"
FT                   /protein_id="ABY33780.1"
FT                   /translation="MIDESLFRQTMSHFASGVTVVTTALGERLAGLTVSSFASLSLNPP
FT                   LVLICIDHAASSHDVIAAAGKFAVNILAEDQEYLSRRFAMHDGAKFAPHSYTLSENGLP
FT                   LLEGVLAQIECRLHSALPGGDHTIFVGEVIAARVFGGRPLLYYRSGYHQLG"
FT   gene            681957..682754
FT                   /locus_tag="Caur_0534"
FT   CDS_pept        681957..682754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33781"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEC1"
FT                   /protein_id="ABY33781.1"
FT                   /translation="MLLCFFLYGLIFLLTACTVTPTPGTPTTIVPTLMPTPTPDASTSS
FT                   GWRTLRTGIAFRQLEAPGLPVQVVRIDPAHVRFVVGYDPTSPLTLSAWVARYGAVAAIN
FT                   GGFFDQQGEPVALLISNQQVFGYSYVDQGGMFAIDEQGKPHLWSLADQPYDGTPFVQAI
FT                   QGWPLLVRTNGEAAYTDDDGQRARRSAIALDRNGYVLLIVAPGATFSLAEWSQFLASAD
FT                   LDIEIAVNLDGGSSSGLIAQSDQGGVRVDSFTPLPFALLILEL"
FT   gene            682834..683877
FT                   /locus_tag="Caur_0535"
FT   CDS_pept        682834..683877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rca:Rcas_0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33782"
FT                   /db_xref="GOA:A9WEC2"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEC2"
FT                   /protein_id="ABY33782.1"
FT                   /translation="MRHWKLWLGLIISIFFLGIALYGLDLAHFWEALREANYWWLIPGI
FT                   LVYFITVWVRTWRWQSMLSHMARVPLRTLFPIVVIGYMGNNVYPARAGEVLRSYVLRRN
FT                   CGIAMSASLATVVLERLFDGLVMLLFVAVTLPFAPLPPVFRSLVIGFSALFLCAFLGFV
FT                   VLAARPQLMSRWYTMIVDRFAPGWLRPHIHGLFDRFIIGLQSLRSPRDMITILLTSTFI
FT                   WLGETLKYWFVMHAFPFEVSFLVLMLMTAIVNLFTTIPSTPGYIGTFDAPGIATLTQFG
FT                   VPHAIAAGYTLVLHVALWLPITLLGAWYMLRQSLTWRDLDRAAAIQAQSTPNVETNDTV
FT                   NSQKVLP"
FT   sig_peptide     682834..682905
FT                   /locus_tag="Caur_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.631) with cleavage site probability 0.542 at
FT                   residue 24"
FT   gene            683874..685193
FT                   /locus_tag="Caur_0536"
FT   CDS_pept        683874..685193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0536"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: rrs:RoseRS_0088 amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33783"
FT                   /db_xref="GOA:A9WEC3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEC3"
FT                   /protein_id="ABY33783.1"
FT                   /translation="MRIAIVGAGIAGLSAAYDLAGQGYAVTIYEAGDQVGGLASGFRDA
FT                   AWDWPLERFYHHIFTTDHAIIELTNDIGMRDRLFFRAPVTAQWWRGRGYALDGVLPVLR
FT                   FPGLPFIDRLRFGLTAFYLKFITQNWQRLEQTTAMAWTERVSGRNVARVIWRPLLEGKF
FT                   GPHADEVNMAWLWARLRARSFQLGYFRGGFQAFADELCAACVRRGVQVWRQTPVKSVCQ
FT                   TATGWQISAAQHPPADYDAVLVTGAPGLLARLVTTLPAEYLGQLRRLNSMGAVVMTIAL
FT                   RRPLTNGIYWLNLPKDEFPFLALVEHTNFIEPDYYGGDHLIYCGDYLDPNHEYFRLDAS
FT                   ALLERFLPALRRINPAFQPEWVRAYWLHRETYAQPIVPVNHSRNIPPIATPLPGLFWAS
FT                   MSQVYPWDRGTNYAVELGRRAARVMHEFAGQYQQTVPSGY"
FT   sig_peptide     683874..683936
FT                   /locus_tag="Caur_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.690 at
FT                   residue 21"
FT   gene            685367..686416
FT                   /locus_tag="Caur_0537"
FT   CDS_pept        685367..686416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0537"
FT                   /product="LamG domain protein jellyroll fold domain
FT                   protein"
FT                   /note="KEGG: rrs:RoseRS_1123 LamG domain protein jellyroll
FT                   fold domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33784"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEC4"
FT                   /protein_id="ABY33784.1"
FT                   /translation="MQRFGKITLFLCIICWLISCSTGSPAVSSATGETISPSPTPQPTL
FT                   PPVTTTLQPSPAPTAPAASPATVGFSVRFYGFYTSNGNGVADSDRIKIPLGPVNSNGQI
FT                   SSSRPVNVSGDMTLEFWMKANPGDNDAPPCDSWYYGNIVIDRDVYGDGDYGDYGVAICG
FT                   NKLVVGFNVGQDDRLLKGNAIVTDGQWHHIAITRSASGPVRLYIDGQLDSEMDGPPGRI
FT                   DYRLNRPTSYPNSDPYLVFAAEKHDVTGSLYFNGWIDDLRLSNIVRYSGAFARPTAPHA
FT                   LDANTVALYRFDEGSGTTINDATAGNQSPGELKPRAGGAAQHWSSDTPFTTSSVPLTPR
FT                   AYIPFIANS"
FT   sig_peptide     685367..685456
FT                   /locus_tag="Caur_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.614 at
FT                   residue 30"
FT   gene            complement(686581..687897)
FT                   /locus_tag="Caur_0538"
FT   CDS_pept        complement(686581..687897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0538"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   bfr:BF2711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33785"
FT                   /db_xref="GOA:A9WEC5"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEC5"
FT                   /protein_id="ABY33785.1"
FT                   /translation="MKAAQLLADYTNHPAFRELCRAAKQMLREGLDPATVRRQIAAQYG
FT                   EPPVELRLRAQPQPLKIIGAHLIEPGAIEQMQTALRLPPAIRGALMPDAHQGYALPVGG
FT                   VIAYDRAVAPYQVGVDIGCRMHLSIFADMTPDEAHRDRHHLLDTLTKVTVFGIGSPKKP
FT                   VADHPILADPRWRATKLLRELHDLATYQIGTSGGGNHFAEIVVGEWLDTHRTFVGLLTH
FT                   SGSRGVGAKIANYYATLADRETAVIASGIPKTYGWLGTDTEAGQEYLLAMRLAGDFARA
FT                   NHEVIHARFARAAGVAVERVIEHHHNFAWEQPDGTVIHRKGATPAEAGTYGLIPGSMAT
FT                   ASYIVEGLGEPTSLASASHGAGRRFSRSEARRTITPAMAAAVVREAGVLVRGLAVDESP
FT                   LAYKDIETVMELQVAAGLIRPVARMRPLVVIMSGSAGED"
FT   gene            complement(688184..688474)
FT                   /locus_tag="Caur_0539"
FT   CDS_pept        complement(688184..688474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0539"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   pca:Pcar_1036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33786"
FT                   /db_xref="GOA:A9WEC6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEC6"
FT                   /protein_id="ABY33786.1"
FT                   /translation="MGWTFLTNHAQVLLCIARNPRVTAQEIARTIGITERAVQRILHDL
FT                   HEAGYISHVREGRHNHYTIYGDQPLRHPTVQNITVRELLAALTNGAAVMAK"
FT   gene            complement(689575..690951)
FT                   /locus_tag="Caur_0540"
FT   CDS_pept        complement(689575..690951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0540"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_406480 hypothetical protein Pfam:
FT                   Peptidase_C24 Cytadhesin_P30 PT PROSITE: PRO_RICH THR_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33787"
FT                   /db_xref="InterPro:IPR032178"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEC7"
FT                   /protein_id="ABY33787.1"
FT                   /translation="MEQRSGHLTIIQCWCVCLIIAGLLIACSPPVPVPPSPTVAATPAL
FT                   MVPSPTVQPSPTVVQIPTQQPTVVVAPSPTAIPTSVPQPIATAPTPVFPVPTPDPALMQ
FT                   RKPPLGTFFFYWYNCPQQECDSSQLLAVPPGWLTPLPADPDPRDGFSYSSYNYDWYENE
FT                   LRTMASIGISMVFPVSWGDHPHPWFRNDRLNLLVQANGVLEHPLTIGMFLDTTAQQGMY
FT                   QEFLGNGYRFGPDAPRLPLSDPRSGYFFYNLHIRDFFTRVPREMWATIDGRPIIITYTA
FT                   LCCDNLELSGTLWQAVKDAFRADFGVEPWLILEETWLNPQALAPPEGLPDSAQVADGVY
FT                   RWGTALLGPHTAELRGFKVSSVGPGFDNSRIPWVREPRGQPRDEPPGGGSPAPGAFLRA
FT                   SLAAIPPDTDLVLIETWNEWPENSAVAPAAYTDRDGRPLPPDFYLQIIRQWREQFVPQP
FT                   "
FT   gene            complement(692299..694452)
FT                   /locus_tag="Caur_0541"
FT   CDS_pept        complement(692299..694452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0541"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: rca:Rcas_2264
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33788"
FT                   /db_xref="GOA:A9WEC8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019899"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEC8"
FT                   /protein_id="ABY33788.1"
FT                   /translation="MSTSAQSVFRNRMARYYGYFTIGFIAVSLLMLLLEVFAGLPTQLI
FT                   GWAFLLLTFALYATIGVLSRTKVLDEYYVAGRNVPAVFNGMATGADWMSAASFISMAGT
FT                   LWLIGYDGLAYIMGWTGGYVLLALLFAPYLRKFGQYTIPDFVGARFGGNTARVVAAICA
FT                   IIVSLTYVTAQVVGVGIIMQRFVGVDYMIGVILGLSGVLVCSFLGGMKAVTWTQVAQYI
FT                   ILITAYLIPVTALSIQLTGFPLPQLSYGQALQRIQVLEQEQGLSKASESPVVPGKFVTS
FT                   GYIPPFNEGLSNVAAIDAVRQLNTQFGLNVTPPAAQAIPDANKPELGDWRGTPWNFLAL
FT                   MACLMLGTAGLPHILIRFYTVPSVRESRLSVGWSLFFIFLLYFTAPAYAAFSRWQILEN
FT                   VVGKEISQLPEWTSTWARNGLIVIRDLKVLDGVEVGKEPTWVKNLINAGSVVVEDANGN
FT                   GRIDLAAWEDAGDGKGRAGEISGSAVTKARVDGILQLNELGRTAGDGIDGDLVVLSTPD
FT                   IAGLPFTIGALIAAGGLAAALSTADGLLVVIASAVAHDIYFRTINPKASLNTRIVLGKT
FT                   MIVVAAVIAALLAIPRLALIAQMVAWAFSMAASTFFPVVLLGIFWKRANGAGAIAGMIG
FT                   GLAVTIFYMANNYLNPAFNVLGISHLGSGIFGLPVAIILIVVVSLLTKEPSKEIQDLVE
FT                   NLRNPITDDEGMTKMIDKMAPAK"
FT   gene            complement(694492..694773)
FT                   /locus_tag="Caur_0542"
FT   CDS_pept        complement(694492..694773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0542"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: rrs:RoseRS_1629 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33789"
FT                   /db_xref="GOA:A9WEN0"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEN0"
FT                   /protein_id="ABY33789.1"
FT                   /translation="MSDLSKLPVAERNRLYWSENLRLISILLVIWFAVSYVPVLFVEAL
FT                   NNIVIAGFPLGYYMGSQGSLVVFVIEIFYYAYAMNKLDAKYGLSDRDR"
FT   gene            complement(695151..695805)
FT                   /pseudo
FT                   /locus_tag="Caur_0543"
FT   gene            696530..698257
FT                   /locus_tag="Caur_0544"
FT   CDS_pept        696530..698257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33790"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEN1"
FT                   /protein_id="ABY33790.1"
FT                   /translation="MSQRVIRLALSLSMSQTLSFTLTILLILTACATPTSALTPTPQPS
FT                   PQPTALTETPDSKLTPIPDPTLSTLPTEPAQPLPAGAYDPGAYVVSDIWVDPINGDDTR
FT                   AGFPQDQAVRTLAEAWNRIPRDTPLNETGYRINLFPGTYTPEYTPNYWESRYGSAQFPI
FT                   IIQPAGGNGTVTLPSVNIYDVRYLYIFGINFQSENDVFHCEKCDHILLRGVTITGTPPE
FT                   TGSTQEAVKFNQSQNIFIENSAISGGWDNAVDFVAVQYGHVLDSEIFGSGDWCMYAKGG
FT                   SAYLRVEGNEFHSCGTGGFTAGQGTGFQFMVAPWLQYEAYDVKVVNNIFHDLEGAAFGV
FT                   NGGYNILIAYNTAYRVGARSHVIEVAFGGRSCDGQPGDEGRERCDEYAAQGGWGNNLVP
FT                   DGNNYVRIPNRNVFIYNNLIFNPDGYQSQWQHFFIPGPAPASGGVPAPVTADNNLVIKG
FT                   NVIWNGPATHPLGVDDTTGCAAENPTCNPTQILSDNAINTVKPELRAPDSGDYHLFNRL
FT                   NVTPAVIPPFVWEIGTVPQGNLDNSVPTDRDGYPRTNSDNAPGAYLERWLVWLSLLFG"
FT   sig_peptide     696530..696643
FT                   /locus_tag="Caur_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.934 at
FT                   residue 38"
FT   gene            699532..700509
FT                   /locus_tag="Caur_0545"
FT   CDS_pept        699532..700509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0545"
FT                   /product="deoxyhypusine synthase"
FT                   /note="PFAM: deoxyhypusine synthase; KEGG: cyb:CYB_2420
FT                   deoxyhypusine synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33791"
FT                   /db_xref="GOA:A9WEN2"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEN2"
FT                   /protein_id="ABY33791.1"
FT                   /translation="MTNGAVSQFVRHHFRHFNAAALVDAADAYRRHLDQGGQMMITLAG
FT                   AMSTAELGLSLAEMIRQGKVHAISCTGANLEEDIFNLIAHDFYERVPHYRDLSPQQEQE
FT                   LLERHMNRVTDTCIPEEEAMRRLEKALLDEWMQADRNGECYFPHEFIYRILRAGKLEQY
FT                   YQIDPRDSWVYAAMERNLPIYVPGWEDSTTGNMYAAHCITGEIRNVHTVRTGIEYMIDL
FT                   ADWYTRTSAQASIGFFQIGGGIAGDFPICVVPMLHQDLGREGVPVWGYFCQISDSTTSY
FT                   GSYSGAVPNEKITWGKLAVDTPKFIIESDATIVAPLMFALILGW"
FT   gene            complement(701310..702029)
FT                   /locus_tag="Caur_0546"
FT   CDS_pept        complement(701310..702029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0546"
FT                   /product="cyclic nucleotide-binding"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: nca:Noca_1641 cyclic nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33792"
FT                   /db_xref="GOA:A9WEN3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEN3"
FT                   /protein_id="ABY33792.1"
FT                   /translation="MSVGTLQSDRLDDKVRYLRDIDIFRDLDPDEIELLGKRAPMQRVP
FT                   AGTVFFSPEQRAEVLFILKEGRVRIYRLSTDGKMLTTAILNEGTIFGEMALLGQQLHQH
FT                   YAEALTPCLLCLMSREDVKRLLLSDPRIATRIVEILGQRLISAEQRLSDFAFKSLPQRI
FT                   ATLLLQMAQPAKPRLFRPGSSQREVALTHEALAEMLGTYRETTTKILNDLRTQGLIELR
FT                   RGRIVLLDEIGLQKLSE"
FT   gene            complement(702042..702299)
FT                   /locus_tag="Caur_0547"
FT   CDS_pept        complement(702042..702299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33793"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEN4"
FT                   /protein_id="ABY33793.1"
FT                   /translation="MLPLRVYVSATCTVCKYTYELIERLRTIRPDYPVEVIDLDQDSSK
FT                   RPAFVFGTPTYVVGETVIALGNPELSTLLAWLDHIARVSI"
FT   gene            complement(702389..702826)
FT                   /locus_tag="Caur_0548"
FT   CDS_pept        complement(702389..702826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbu:CBU_1950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33794"
FT                   /db_xref="GOA:A9WEN5"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEN5"
FT                   /protein_id="ABY33794.1"
FT                   /translation="MMDTIQTQQNLMSKVIGGVVGGLVGGVVFGIMMAMMGMLPMIAGL
FT                   VGSSSAVVGFLIHMVISAIIGAGFGFLFAARSTNITQGVLWGLGYGFIWWILGPMVLMP
FT                   LMMGMGLQFAAAFTPPMLMSLVGHLVYGGLAGATCAWYLHR"
FT   gene            complement(704369..705538)
FT                   /locus_tag="Caur_0549"
FT   CDS_pept        complement(704369..705538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nca:Noca_2086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33795"
FT                   /db_xref="InterPro:IPR021516"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEN6"
FT                   /protein_id="ABY33795.1"
FT                   /translation="MKRPLLLTTFLTLVLVACSTSSVQVTSTSTPANPTALASLLADLP
FT                   DGAGQFRTDFSRHSVPFAEIRSGGPPKDGIPAIDNPRFVSVTAANEWLRPREPVIALVI
FT                   GQEARAYPIQILMWHEIVNDTVNDIPVTVTFCPLCNTAIVFERRLSSQILDFGTTGLLR
FT                   YSNLVMYDRQTESWWQQATGEAIVGELTGHRLAFIPAAIVAWETFAAGYPDGRVLSRET
FT                   GYVRDYGRNPYLGYDDIERSPFLYDGPPTPDALPAMARVLTVDHNGEAVAYPFDTLAAM
FT                   QVIHDEVGGLPIVVVWRAGAASALDSAQIADGRDVGMAIAYQRIVNGQTVQFTIADDHL
FT                   IDSETGTRWDLFGRAIDGPLAGVTLTPVPAIDHFWFSWAAFRPDTRIYR"
FT   sig_peptide     complement(705467..705538)
FT                   /locus_tag="Caur_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.239 at
FT                   residue 24"
FT   gene            706039..707520
FT                   /locus_tag="Caur_0550"
FT   CDS_pept        706039..707520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0550"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-C domain protein; sodium/hydrogen
FT                   exchanger; KEGG: rrs:RoseRS_0407 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33796"
FT                   /db_xref="GOA:A9WEN7"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEN7"
FT                   /protein_id="ABY33796.1"
FT                   /translation="MTTEPLLLITGLLLAISVAATRASNRFGVPALILFMAVGMLAGSD
FT                   GPGGIAFTDAGVAQLIGVIALIYILFSGGLDTDWQIIKPVLTEGLILANVGVLVSTVIV
FT                   AVGAHFMLGFDWPLALLLGAIVSSTDAAAVFSVMRTRGIHLKHRLEPLIELESGSNDPI
FT                   AVFLTIGLTNLVINPQASLLTLIPSFIIQMILGAAGGYAFGRLMIWVVNRIRLQQEGLY
FT                   VVLTMALTLLTYGFTAIIGGNGFLAVYLAGIILGNANIVHKRSILRFHDGVAWLSQIAM
FT                   FLILGLLVFPSQLPAVAGQGLAMALWLVFVARPVSVIIALGWKRRSLPQLLMIAWAGLR
FT                   GAVPIVLATFPLLAGVPDAPLLFNLVFFIVLISVLLQGISIGWVARRLGVMTDQAEVID
FT                   SHLFVPEVSGASQILEAQIPPDSALVGKSLIDADLPRGLLIVQIQRADGYIIPNGSTVF
FT                   APNDRLVLLVAPTAMPAVTELCASCSLNPIGSLLK"
FT   sig_peptide     706039..706110
FT                   /locus_tag="Caur_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.378 at
FT                   residue 24"
FT   gene            complement(707710..708360)
FT                   /locus_tag="Caur_0551"
FT   CDS_pept        complement(707710..708360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0551"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   rrs:RoseRS_0992 phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33797"
FT                   /db_xref="GOA:A9WEN8"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEN8"
FT                   /protein_id="ABY33797.1"
FT                   /translation="MRPREHFDQELDALRKQVLDFGNAVVGALDRAITALEKGDVELAQ
FT                   AVVAGDAAFNEARDAIEQHAVNLIATQQPVARDLRRIVAAMAISYELERIADYAKSTAK
FT                   MVAGSPDPNRGALHAPPDLVALGRVARANLERTLAALGNGNPDAIKEIILNEDEIDHEY
FT                   KRLKRALVSQLTPPEIADLLFIAHNFERVSDRALNMAEKMIFVSSGNQVELND"
FT   gene            708756..709301
FT                   /locus_tag="Caur_0552"
FT   CDS_pept        708756..709301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0552"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   rrs:RoseRS_0374 nuclease (SNase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33798"
FT                   /db_xref="GOA:A9WEN9"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEN9"
FT                   /protein_id="ABY33798.1"
FT                   /translation="MVQRIFTIFFIQIIFFISGCSRPVATEQTSLSDYPPLPDNLTRAQ
FT                   VVRVVDGDTIIVRIGRDEERVRLIGINTPESADPRRPVECFGKEAASNARKLVDRQTVL
FT                   LEDDPSQDSRDRFGRLLRYVWLEDGRMVNLEQIRQGYAYEYTYDVPYRYQAIFRAAEAE
FT                   ARNAQRGLWAPETCNGQR"
FT   repeat_region   complement(709627..731166)
FT                   /rpt_unit_range=709627..709663
FT                   /note="CRISPRs"
FT   gene            complement(731350..732156)
FT                   /locus_tag="Caur_0553"
FT   CDS_pept        complement(731350..732156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0553"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bxe:Bxe_C0489 putative transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33799"
FT                   /db_xref="GOA:A9WAT6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A9WAT6"
FT                   /protein_id="ABY33799.1"
FT                   /translation="MTRTAYPSDGSDEEWAFVAPSVTLMDEAAPQRNYPLRDVANGLRS
FT                   MLRTGAPWRMLPTAVPPWPVVYHQPQRWLKAGVGAQMVHDVRMLLRDITDRAPQPRAVM
FT                   VDSRTLQSTPERGGRAGYDGHNRRNGATVHLAVATLGHLPAVVVTPATDHDRAQVAALA
FT                   QRMQEIPGDTVAVAVVDQGYTGAQPAAEAAAHGSRLAVVTLPTATRGVGVLPRRWVVER
FT                   RFAWMTRFRRLVRDDDRVAATLAGLHVVAVAIVVAHRFVSLMVQRS"
FT   gene            complement(732201..732482)
FT                   /locus_tag="Caur_0554"
FT   CDS_pept        complement(732201..732482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0554"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   protein of unknown function DUF196; KEGG: rca:Rcas_1985
FT                   CRISPR-associated protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33800"
FT                   /db_xref="GOA:A9WEP1"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9WEP1"
FT                   /protein_id="ABY33800.1"
FT                   /translation="MFYLISYDISVDQRRLKIAKLLEGYGQRVLESVFECDLELPAYRQ
FT                   LRQKLNRLIKDEEGDRLRIYRLCASCREQIEIIGDGPPPETSQDIYII"
FT   gene            complement(732502..733521)
FT                   /locus_tag="Caur_0555"
FT   CDS_pept        complement(732502..733521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0555"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: rca:Rcas_1984
FT                   CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33801"
FT                   /db_xref="GOA:A9WEP2"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEP2"
FT                   /protein_id="ABY33801.1"
FT                   /translation="MATLYLIEQGAEIGCDGERIVVRRAGEIIGSVPLVKVDDIVIFGN
FT                   IGISTPAIKRLLDRSIEVTFMTVDGSYQGRLVGQVTAHVALRQAQYACAADSDRTLRLA
FT                   QSFVEGKLRNQRALLQRFSRNRATPPAEALAAADDLDAYIKRVRRTTRLSALLGVEGSA
FT                   TARYFAGLRSLIEPEWDFRSRQRRPPPDPVNLLLSFGYTLLTHKTLGAVQAAGFDPYLG
FT                   FLHSLDYGRPSLALDLMEEFRPLLIDSLVVRVCNDGRLRLEHFQPGDEARPVIITDEGK
FT                   RAFLTAFEERMRTEATHPEGADSGPGKVTYQRCIALQARRLARVIRGQQERYEPFTAR"
FT   gene            complement(733499..734362)
FT                   /locus_tag="Caur_0556"
FT   CDS_pept        complement(733499..734362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0556"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas6; KEGG:
FT                   rca:Rcas_1983 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33802"
FT                   /db_xref="GOA:A9WEP3"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEP3"
FT                   /protein_id="ABY33802.1"
FT                   /translation="MPQAIVFTLRPLTTAQVAGNLSRAAHAAILRLIQQADPALAARIH
FT                   DDNGRKPLTVSNIWGLAGEPKVIVDPARDYHLRVTLLSAELEQIATDWTPAALAPLDLD
FT                   GLAWRITARADNSAEHSWAGRATYQELAQPLLSRPNQLPSVWTFQLASPTTFRQRGLNV
FT                   PLPLPDLVFGSLLEQWNASSELALPDEVRRFAAECLAINRYDLRSVASPTSGGVIQIGA
FT                   VGRCSFRAINPDRYWRACIDVLARFAFFSGIGAGTTRGFGQARLLTKTDQPRQREAVDN
FT                   GDTLSD"
FT   gene            complement(735373..736827)
FT                   /locus_tag="Caur_0557"
FT   CDS_pept        complement(735373..736827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1982 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33803"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEP4"
FT                   /protein_id="ABY33803.1"
FT                   /translation="MNALLICNVGGRDVLHPALPKNGHSERQWAQTALERYPELCGTFS
FT                   LPIISKALHYLATRRVVIDHVILIASDQPPPPVGNAKFWSSDTIYSAQIIAHLLCDGLT
FT                   PYPRLDGQQITIWTIQTEDGQGCDPSDYDLTLRFLERRLAELRRVYPHHTAFFEVTGGT
FT                   PAMTTGLLIAGTEIFGSQTEILSVHPNQELPIALNTGKRLLATPLRASLRSHAASYAYA
FT                   AAARTFLEHEAIITDRLEPTAARLIAPLLAYAHHRFNFDFASARSALQRVRNAGPWRAE
FT                   LDSLLAQVNQPVRQFLLAEVVRGAAARYQIGLYADFLTQVVRFEENLLRYLCLQQGAWF
FT                   CNRQRQLDPDGTYLAREWLSQQTFTLSRDRDPNRDLIADRSVMRELLGNLLGRAQPGQH
FT                   NLLTAIDRLGELVKRRNELTHHLEGVQKAGLARAFAGPQASPSAADQIVPHLEQLYEQV
FT                   CHQPLPPSPYQHINRLLDRLLQATQT"
FT   gene            complement(736824..738296)
FT                   /locus_tag="Caur_0558"
FT   CDS_pept        complement(736824..738296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1982 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33804"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEP5"
FT                   /protein_id="ABY33804.1"
FT                   /translation="MTILVMCNLGNSDLNADSKRPSKPRPEGEQLWRSFTEHQFELPII
FT                   EPCLRFIIGRHPGDQLRLVCFYTDQPENPETTKADRFGVSLRDKDTIWLAHIAQRLIRE
FT                   KFAGQVSEVEIVRIENSRGPDLNPSVYDEVFEAYAYLLQRFVNQQVDRCYILTAGGIPA
FT                   CNFALQLQAMIAFADRCHFIYPPEGGRVTELRIGEEMSKAFQRVNALNALDQRNFPAAL
FT                   LSARAARVGEWIVALLEYAVYREAFDFQQATQAGARAQRHASGSIREFCRELQDDLQQL
FT                   IRNDAAALLREVAYNADIAYRNGRYADLLGRLFRFQEGVLRLIVEKYLGLPTDFSKEQR
FT                   DASLARYLELIDGNPALRDFLDQRTLDGKPLRYRDGPNRPVMQALLEFVLNGGTRADGT
FT                   PFATKKDRERLSGVRERLNRLDALAELRNQSVIAHGFAGVAREAIDSAYKGGADQIVPD
FT                   LYKTIELLDNPVHKSPFDRIAETVQRELRRGT"
FT   gene            complement(738293..739708)
FT                   /locus_tag="Caur_0559"
FT   CDS_pept        complement(738293..739708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0559"
FT                   /product="CRISPR-associated RAMP protein, Csm5 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm5
FT                   family; KEGG: rca:Rcas_1981 CRISPR-associated RAMP protein,
FT                   Csm5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33805"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010173"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEP6"
FT                   /protein_id="ABY33805.1"
FT                   /translation="MPSINQVYQVRVEVISPLCVLDGGRLHEEVDFYLDAQTTYVINSD
FT                   AVLELAFQRWYERQPSREQLLAKLAEREERLLRRRQRNVEDIKRFDEAPPKDPRKRAEQ
FT                   EQRLSVEAHNIREELKRLRQERAELESGTAQSVTIPPELLQNSGVSDLFKTGLLTIDDI
FT                   RTIPGLLRYSYLGRPEVKSGRSEILTCVKDPADRLYLPGSSLKGALRTVLAWALAPQRA
FT                   AQALNEFNNARDRRQAAHSLEQRIFYGRKQRDDKRVNHDLLRDVMRTFHIGDSQPVAQS
FT                   PQLLQIRVFPRGSPITVEAIPDGTTLLATLRIEQYPFTDAAARAVIDFGNWPQYLQPAQ
FT                   LAAFGRQRARVLIEGEQAFFRNRPDATQISRFYADLAERLAALENTNAFLLPIGWGAGW
FT                   RSKTLDTILREGTREEVFVSAVRGYNMKLNSQRSQRFRAGDLFPASRRVIMRNGQPWLP
FT                   PGWVCLTIEERGK"
FT   gene            complement(739717..740802)
FT                   /locus_tag="Caur_0560"
FT   CDS_pept        complement(739717..740802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0560"
FT                   /product="CRISPR-associated RAMP protein, Csm4 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm4
FT                   family; KEGG: rca:Rcas_1980 CRISPR-associated RAMP protein,
FT                   Csm4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33806"
FT                   /db_xref="InterPro:IPR005510"
FT                   /db_xref="InterPro:IPR040932"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEP7"
FT                   /protein_id="ABY33806.1"
FT                   /translation="MPTLSVYHLIPPAGAANLSFHFGRQGIGLEETGETLASDSFFAAL
FT                   VVQAALNDPRRTADGAPVWVEPFLADQPPLRHSSLLPRIGDLPLLPRPLLPIHLPPTAE
FT                   LAGKQLKKLRYLSPSLFVAVCKGETLPADPISLQQGKIWLSEEDARRLPAPWKQTATES
FT                   SDAWRARLTATPLWHVEATPHVTLDRLSAASAYYEVGRISFAVGAGLSLLVAFADAQAR
FT                   PSFEHLLTLLGESGLGGKRTNGYGAFAWQHGTALTLDLPSPHKRAVLLSRYIPTPTELP
FT                   LVRNERSTYQLTRVSGWFLAADGSTYRRQAVMMLTEGAVLVCDERLPGGQILDVRPDAS
FT                   VSHPIYRSGLALAVGLPADSK"
FT   gene            complement(740820..741638)
FT                   /locus_tag="Caur_0561"
FT   CDS_pept        complement(740820..741638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0561"
FT                   /product="CRISPR-associated RAMP protein, Csm3 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm3
FT                   family; PFAM: protein of unknown function DUF324; KEGG:
FT                   rca:Rcas_1979 CRISPR-associated RAMP protein, Csm3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33807"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013412"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEP8"
FT                   /protein_id="ABY33807.1"
FT                   /translation="MSTRMVTLHGRIVLRASIELLTGLHIGGAAGGLEIGGLDKPVIRN
FT                   PITNQPYIPGSSLKGKLRSLMEKVYGAPQTFRINEGVFIHVPTNPEEYQRYYQIAGVFG
FT                   TLPNHKQLTIDVPTRLIVRDVPLTRESEQELRRLRTDLPYTEIKWEAAIDRVTSAAAPR
FT                   QIERVPAGAVFGPAEVVYSLYVGNGEQLSDVIRLFGSVYEAFTYLEDDYLGGMGSRGNG
FT                   QVRLRDITVLARRLESGRYGELTTIREAKELRELDRNGLLEELQRFFNPA"
FT   gene            complement(741656..742108)
FT                   /locus_tag="Caur_0562"
FT   CDS_pept        complement(741656..742108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0562"
FT                   /product="CRISPR-associated protein, Csm2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csm2 family;
FT                   PFAM: protein of unknown function DUF310; KEGG:
FT                   rca:Rcas_1978 CRISPR-associated protein, Csm2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33808"
FT                   /db_xref="InterPro:IPR010149"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEP9"
FT                   /protein_id="ABY33808.1"
FT                   /translation="MTMGRSSNPQAVGVKRISSENLQRIMTESSEEAMKLLVQEADRLG
FT                   KELGRNGLTTSQIRNIFGEVRSIEQEVLPTDQQLSLDVQRRLLMLKPKMAYQVGRFSNN
FT                   QALQELVETLSDAIGLIGNDKNRFQTFVNLFEAILAYHRRYGGKTN"
FT   gene            complement(742145..744319)
FT                   /locus_tag="Caur_0563"
FT   CDS_pept        complement(742145..744319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0563"
FT                   /product="CRISPR-associated protein, Csm1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csm1 family;
FT                   KEGG: rca:Rcas_1977 CRISPR-associated protein, Csm1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33809"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013408"
FT                   /db_xref="InterPro:IPR041062"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEQ0"
FT                   /protein_id="ABY33809.1"
FT                   /translation="MTHAEDPSTVAWQVLHSWTLAALGERNDAVSESLRESAWRVVGQQ
FT                   PQATWPPLQPALSSVFTRLRAGVKDCWQPPAMLRCREEVLFPQATAQPPSAELKQALQS
FT                   GLAAAQRETDPTRRLECLLITLQRYAWAWPSPLPGVSLYDLARLHAAVQAAQSATTDGL
FT                   ICLLGGDLSGLQEFLYSIPAAGAARQLRGRSFYLQLLTEACAYWVLRNSGMPLCNLLYA
FT                   GGGRFYAVLPGSIAAQVLEWRQHLGRILLQSHDGSLYLALGSTEPFAPEQYTDETWREL
FT                   SDAIDRDKRRRFAALDDSEFARMFQPRPPRPPRSDGSEAPDALGESLAELGRQLTRAAV
FT                   LAVNLTASQSDGATWRQAITALGVDYRLSEELSSVRSLSQRLLALNDDTVPQLPADASA
FT                   IGQRYTVTEAYRLREDDLPLYRKLDPDQAPEIQVGDVAPFNLLAHLSDGVPRIAVLRMD
FT                   VDNLGDLFGKGLQRPAGMGGLAVTAALSSALSRFFEGWVGELCRRRNQQGKGGIYAVYS
FT                   GGDDLFLVGSWHLIPELAQQIRNDFIRYATGAGPTVQPPVSLSAGITLHQAGYPLYQAA
FT                   EDAGNALDAAKAYRHPDGRSKDAITFLGQTLSWDAFAQAARFKDELLDLIANGAPRGLL
FT                   MTVQRLVLLARTRYNRAGAAQLTVGPWVWQGAYQLTRLAERSPESIRSRVVDLREQLIS
FT                   PEAIVQRTVIPAGLAARWAQLLLRGSERER"
FT   gene            complement(745775..746995)
FT                   /locus_tag="Caur_0564"
FT   CDS_pept        complement(745775..746995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0564"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rca:Rcas_1338 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33810"
FT                   /db_xref="GOA:A9WEQ1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEQ1"
FT                   /protein_id="ABY33810.1"
FT                   /translation="MLRSHWHATLHQAPLPGIDLPSTADVVVVGAGVVGAATALWLTRA
FT                   GLQPLVIDRHGPAAGASGHNGGILAAGLAENYLAATARYGASTARELYALSLAGQRLMV
FT                   DLIQQEQIECDLRLHGNLNLAIGEAQLTIAGATVAALQGDGFPAQLLDRTTAQELVAIP
FT                   LGAAVSGARFNPAAGTLHSGRLVYGLLAAAQRHGALCSWGVTLRQVITANGRLHLITDR
FT                   GTIDTAAAVIAVNAWSGDVLPELARRITMVRGQVLCTVPVEPFIACGFGASFTPTGEYG
FT                   QQTVTGQVLFGGCRAIAPNHDVGVQPGEVSPEVQGALETSLGRLFPTLAGINIERRWSG
FT                   AMAFTADYLPIVVNPVPGLFAIGGFSGHGMPFAAIVGRHLAEAVQTGTIPSALAPFRID
FT                   RPTLAVE"
FT   gene            complement(747069..747467)
FT                   /locus_tag="Caur_0565"
FT   CDS_pept        complement(747069..747467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33811"
FT                   /db_xref="GOA:A9WEQ2"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEQ2"
FT                   /protein_id="ABY33811.1"
FT                   /translation="MAHPFQQRLPIISRFPSRIVVLFVAIAMIAIGGSLLWQATTNRQR
FT                   QLVFEIPPGTAARLAAGEEVTIFPSTIIIDLRQHDTLVIQNNDSAEVTIGPFRIVPGQR
FT                   FVQRYWSPGVYELICSVHQGEQLRIEVR"
FT   sig_peptide     complement(747351..747467)
FT                   /locus_tag="Caur_0565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.735) with cleavage site probability 0.608 at
FT                   residue 39"
FT   gene            complement(747541..748137)
FT                   /locus_tag="Caur_0566"
FT   CDS_pept        complement(747541..748137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0566"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; electron transport protein
FT                   SCO1/SenC; KEGG: rca:Rcas_2982 electron transport protein
FT                   SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33812"
FT                   /db_xref="GOA:A9WEQ3"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEQ3"
FT                   /protein_id="ABY33812.1"
FT                   /translation="MKHLITLILAVLSALLLSGCGAYEFRGTVLEPPNPAPEIPLVDQF
FT                   GNEFRLSNYRDKIVLVFFGFTHCPDICPTALGDLKRVMEKLGNDAAKVQVVFVSVDPER
FT                   DTPDLMQRYLAAFNPTFLGLNGDRAVLEQVYKSYGVTVIKRELPNSGLGYTIDHSGYIY
FT                   AIDQAGNWRLLWAHGTPVDDIVSDVQALLRNPPRG"
FT   sig_peptide     complement(748069..748137)
FT                   /locus_tag="Caur_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.840 at
FT                   residue 23"
FT   gene            complement(748371..748922)
FT                   /locus_tag="Caur_0567"
FT   CDS_pept        complement(748371..748922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0567"
FT                   /product="protein of unknown function DUF461"
FT                   /note="PFAM: protein of unknown function DUF461; KEGG:
FT                   rrs:RoseRS_3482 protein of unknown function DUF461"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33813"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEQ4"
FT                   /protein_id="ABY33813.1"
FT                   /translation="MRRLFFLSITAALLVVLVGCGANQSGTTGSGITVRDPWVRAAMMN
FT                   MAGDQSGAMGNMGNQATPMAGMGNSHGNGHANAGSSAVSAAYMVIVNNGAADAIVKAES
FT                   DVAASVELHNVVMENNVMQMRQVEAIEVPANGQVELKPGGFHVMLIGLNRDLKEGDEVT
FT                   IKLTTRSGQTIEVKAPVRMP"
FT   sig_peptide     complement(748845..748922)
FT                   /locus_tag="Caur_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.584 at
FT                   residue 26"
FT   gene            complement(748992..749369)
FT                   /locus_tag="Caur_0568"
FT   CDS_pept        complement(748992..749369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33814"
FT                   /db_xref="GOA:A9WEQ5"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEQ5"
FT                   /protein_id="ABY33814.1"
FT                   /translation="MMIVHFGANKVPLRFSRTVILWTLAFLIGPWPALSCIIHCLHLSS
FT                   VNRAGVEYFLCDAPHRHADHADTPAPPVRYDILPLLLIAVAIGSIVIQRISAVITVSFR
FT                   SVLYAPEPPPPRTPRPGLLVG"
FT   gene            749679..751406
FT                   /locus_tag="Caur_0569"
FT   CDS_pept        749679..751406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mla:Mlab_0294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33815"
FT                   /db_xref="InterPro:IPR025584"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEQ6"
FT                   /protein_id="ABY33815.1"
FT                   /translation="MQRLLAGCFIGVLGFITACSAPLVSSTSSTTTTQITAESVAEQPA
FT                   TTTNIPQLTPAAAVVVTSAAEAIPIELHGDQISAGTGVEVNGTVATITSGGAYRISGQL
FT                   QAGSIVVNAAATDDVTLYLDGVTIHSVESAPLYIDRAGQVTIVLVDGSINTLSDEARTA
FT                   DQSSAPNATLYSDADLVITGQGQLIVAAHFNDGIASTKGLVIEDGHIQVTAVDDGLRGK
FT                   EYLLLRGGQIDMTAGGDGFTADADGQGVIMIEGGQVTITANGDGVQAAADIVVQGGMLD
FT                   IIAGGGSTATLSADASAKGLKAAGQIIINDGEIRLDVAEDGLHADTSITINGGTFTIAA
FT                   ADDAIHAEQQVTITAGEMNVTDSYEGIEGQHIRIDGGTITIIASDDALNAADGSGAQGG
FT                   GFGGMGGGQWTLTMTGGSLTVDAGGDGIDVNGSITMSGGVMVVYGPTESMNAALDYDRA
FT                   FTISAGQLIAVGSAGMAMAPDTSSTQPAVLINLSTVQTAGTSIAIVNAAGEPIVSLTPD
FT                   KSYQSLVYSGTGLTVGEQYQVVVGGAVNTSFVQNDIITRVGTTTGPGGPGNPMRPPRP"
FT   sig_peptide     749679..749756
FT                   /locus_tag="Caur_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.277 at
FT                   residue 26"
FT   gene            complement(751429..752622)
FT                   /locus_tag="Caur_0570"
FT   CDS_pept        complement(751429..752622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0570"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gka:GK0925 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33816"
FT                   /db_xref="GOA:A9WEQ7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038764"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEQ7"
FT                   /protein_id="ABY33816.1"
FT                   /translation="MTDSTLTAHYLDPTAPDWSATIDRLWQQSGAPQNPTLLPPHFVKS
FT                   TFPRMGGIVVEFRAGDCTVGFGMLFPRTIINGQRHYTLRLHELHERLPDDVLRALIAAT
FT                   PATVYRPADGVTFAPKRPRPAGLWIGTPQADDTTAITALYRSVWGSQPYPTDLFSAEFA
FT                   PGTALVATVDGQVAGFLLGFWRFGCHPIADNELAIESQVMAVDPAYRNHGLATRLKQEQ
FT                   ARLALSQGVRCIHWTVDPLQLPNALLNFNHLHAVAGEFVRGYYPVHNELNLVTASRFGI
FT                   TWLPASAHGSKGLHNQRDRLLITDLPDIAILNDGPRLLRAPHAPAQIAIAIPQQWTELQ
FT                   HRDRNLAIAWRDATDELFARWIGWDAGKYVIYAVARDPAGTGYLVGKPAGSWVWEEG"
FT   gene            753317..753562
FT                   /locus_tag="Caur_0571"
FT   CDS_pept        753317..753562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0571"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: ace:Acel_0524 SirA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33817"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEQ8"
FT                   /protein_id="ABY33817.1"
FT                   /translation="MTTPNVTIDKEIDARGSHCPGPMMELIRGIKSVPLGSVVAVLSSD
FT                   PGSAKDIPIWVQKAGHEFIGAFPEQGFTRFVVRKVR"
FT   gene            753743..754882
FT                   /locus_tag="Caur_0572"
FT   CDS_pept        753743..754882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0572"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ace:Acel_0523 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33818"
FT                   /db_xref="GOA:A9WEQ9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9WEQ9"
FT                   /protein_id="ABY33818.1"
FT                   /translation="MTTKQIVVLGGGVGGTLVANLLAGQLTRKQAQITLIDRTGKHVYQ
FT                   PGWLYVPFGGPPPERWERSERSLLRRSVDLIVGDAVRIEPNERYVEMADGTQIPFDYLI
FT                   IATGARLEPSAVPGYTEGAHHFYSAEAALRLHAALREFNGGKIVIGVADIPYKCPPAPL
FT                   EFTFMLEDELRKRGLREKTEITYLSPIGRVFTIESVAQFVTPMMEERGINYELFFNTEQ
FT                   IDPVERTISSLEGTTLPYDLLVLVPPHRGARIISESGLGDGQGWLPTNRETLQHKQFPY
FT                   IYGLGDATDLPVSKSGAAAHFEAKVIAHRIIGEIKGKPSDERYQGQVMCFLETGYGQAT
FT                   QLVFDYNHPPQPPKPSAYYHYEKALLNRAYWHLVPTGIV"
FT   sig_peptide     753743..753814
FT                   /locus_tag="Caur_0572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.924 at
FT                   residue 24"
FT   gene            755120..756538
FT                   /locus_tag="Caur_0573"
FT   CDS_pept        755120..756538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0573"
FT                   /product="tyrosine phenol-lyase"
FT                   /EC_number="4.1.99.2"
FT                   /note="KEGG: rca:Rcas_0866 tyrosine phenol-lyase; TIGRFAM:
FT                   tyrosine phenol-lyase; PFAM: aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33819"
FT                   /db_xref="GOA:A9WER0"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR013441"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018176"
FT                   /db_xref="UniProtKB/TrEMBL:A9WER0"
FT                   /protein_id="ABY33819.1"
FT                   /translation="MQEQDYPRTMGQQFGRRSWAEPWKIKMVEPLRVTSRAEREAALKA
FT                   AGYNTFLLRSEDVYIDLLTDSGTNAMSDRQWAALMMGDEAYAGSRSFYRLEATVQQVYG
FT                   YRHIIPTHQGRGAEHLISQVAIRRGQYVPGNMYFTTTRLHQELAGGIFVDVIIDEAHDP
FT                   QSQYPFKGNVDLDKLQALIDKVGPQQIAYISLAGTVNMAGGQPVSMANVRALRALCDRY
FT                   GLRIFLDSTRLVENAFFIKEREPGYAEQRIAAIVREFCSYTDGAWMSAKKDALVNIGGW
FT                   LALNDDQLADEARNLVVVYEGLHTYGGMAGRDMEALAVGIEESLQEDYIRARIGQVRYL
FT                   GELLLDWDIPIVVPIGGHAIFLDARRFYPHLPQDLFPAQTLAAELYLDSGVRAMERGIA
FT                   SAGRDPKTGQNYYPKLELTRLTIPRRVYTQAHMDVVAESVKAVYDQRHQARGLRMVYEP
FT                   RYLRFFQARFEPVE"
FT   gene            complement(757073..758721)
FT                   /pseudo
FT                   /locus_tag="Caur_0574"
FT   gene            complement(758748..759650)
FT                   /locus_tag="Caur_0575"
FT   CDS_pept        complement(758748..759650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0575"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: sde:Sde_2639 protein
FT                   of unknown function UPF0031"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33820"
FT                   /db_xref="GOA:A9WER1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A9WER1"
FT                   /protein_id="ABY33820.1"
FT                   /translation="MTHAPLYGGIEAGGTKWVCAIGTGPDDIRAEVRFPTTTPAETLAN
FT                   AIAFFRAHEPEHLAAIGVGSFGPVDLNPASPSYGSITTTPKPGWAHTDVVRTLHQALGR
FT                   PIGFDTDVNVALLGERQWGAARDCDVAVYITVGTGIGGGAVVGGKLVHGLIHPEMGHMR
FT                   LVRDPARDPFPGICPYHSDCLEGLACGPALKARWQTPAEELPADHPAWELEADYLGQAL
FT                   ANLLCILSPERIIIGGGVMSQPQMFPLVRAATQRWLNGYLQHPHILDHPDRLIVPPALG
FT                   QRAGVLGAIALAMHTAGGV"
FT   gene            complement(759720..761024)
FT                   /locus_tag="Caur_0576"
FT   CDS_pept        complement(759720..761024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0576"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: rrs:RoseRS_0406
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33821"
FT                   /db_xref="GOA:A9WER2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A9WER2"
FT                   /protein_id="ABY33821.1"
FT                   /translation="MTLASHVWPETVSVVDGRLWIGGCDTVALAEQFGTPLYLLDDLTL
FT                   RGAMRAYRQAFATAYPGPSIVHYAGKALLNTALAQIVAQEGLGLDVVSATELLVAQRAG
FT                   LPMDRVHLHGNAKSDQELERAIAWRVGAIVVDNLDELQRLCALTSHLTTPQGVLLRVAP
FT                   AIEADTHAHIATGSATAKFGLPLEALDEAVAQTLAAPSLRWLGLHAHIGSQLFALEQVT
FT                   ATVEVLVALAARIRDRFGVAPVELSPGGGLGVPYTADQPATDIGRYAQVVSAALCAACE
FT                   RYRLPLPRLTVEPGRSIVARAGVALYRVVGRKGEHWVHIDGGMADNIRPALYGARYSAV
FT                   LANKPASPPAMTVNVGGRYCESGDVLLRDIALPTVQPDDLLAVATAGAYTLSMSSTYNL
FT                   VPRPALVLVADGQARLIQRRETEADVLARDLLLDR"
FT   gene            complement(761021..761659)
FT                   /locus_tag="Caur_0577"
FT   CDS_pept        complement(761021..761659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0577"
FT                   /product="metal dependent phophohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; KEGG:
FT                   rrs:RoseRS_3456 metal dependent phophohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33822"
FT                   /db_xref="GOA:A9WER3"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:A9WER3"
FT                   /protein_id="ABY33822.1"
FT                   /translation="MLTDTARQIMHEWIASDSLRKHCEAVAACMTHFATKQGADVDLWT
FT                   AVGLLHDLDFERYPHMPEAGPATTAIAEALLRGEEVPAELPGHPFYGVAYLRSAGWSPE
FT                   VLRAILSHADYSGIAPESPLERTLYAVDELSGFVTAVALVRPDKSIYSVEVSSVRKKMK
FT                   DKAFAAKVSREGIVHGAEVIGMELDALIGEVIAALRAAAPRLGLAGNNA"
FT   gene            complement(762539..765091)
FT                   /locus_tag="Caur_0578"
FT   CDS_pept        complement(762539..765091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0578"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: rrs:RoseRS_3774 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33823"
FT                   /db_xref="GOA:A9WER4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9WER4"
FT                   /protein_id="ABY33823.1"
FT                   /translation="MAEREVILPITGMTCASCSARVEKALRKAPGVLAAEVNLAGEQAL
FT                   VRYDPGLVQPEALQAAVEQAGYGVVVDEITLAITGMTCASCSARVEKALRKLPGVLAAE
FT                   VNLASEQALVRYVPGMVERTDLVAAVEQAGYGVILPSATDEAAEDVEARAREAEMTVRR
FT                   RRLLVGVVFGLPLFVLSMARDFGLIAPWLIGEGAAMMATMRDAAMGEIMAMVAARDDLL
FT                   NWLFLALATPVQFYSGRDFYRHAWRALRARTATMDTLIALGSSAAYFYSLAMLLSGAPG
FT                   HVYFETAALIITLILVGKYLEARAKGQTSAAIKALIGLQPKTARVVRGGQEVDVPLTEV
FT                   RVGEMIIVRPGEKIPVDGVIVSGESTIDESMLTGESLPVEKRSGDPVFGATINRSGSFQ
FT                   MRATRIGKDSALAQIIRLVQEAQGSKAPVQALVDRVSAVFVPIVIVIALITFLGWLWAG
FT                   VGLTQALIFAVAVLVIACPCALGLATPTAIMVGTGTGASHGILIRNAEALERAASLHAV
FT                   VFDKTGTITHGRPAVTDVVMVARPVLAQGTQSDGTGDQVLLQIAAAAESRSEHPLGVAI
FT                   VKAAQERGLAVERPTRFQAVSGAGVEAEVGGQTVLVGTLRWLRERGVEIHALEAIVDQL
FT                   QNEGKTAIAVAVDSEAWGVIALADTVKPTAAEAVAKLHQAGIEVALLTGDNQRTAAAIA
FT                   AAVGIPATAVYAEVKPDEKAAIVARLQQSGPHGKPRRVAMVGDGINDAPALAQADVGIA
FT                   MGSGTDVAMETADITLMRSDPRGVVQAIALSRATVRTIRWNLFWAFAYNVLLIPVAAGV
FT                   FYPLTGWQLSPVLAAAAMAFSSVFVVTNSLRLRRVRMG"
FT   gene            complement(765208..765432)
FT                   /locus_tag="Caur_0579"
FT   CDS_pept        complement(765208..765432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0579"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: rca:Rcas_0294 copper ion binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33824"
FT                   /db_xref="GOA:A9WER5"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A9WER5"
FT                   /protein_id="ABY33824.1"
FT                   /translation="MVTEQFRVPGVSCQHCVHAVRKEVSALQGVSQVEVDLSSKIVTVV
FT                   HDDAVDITDIVSAIKEAGYEDVTPLGTAC"
FT   gene            complement(765451..765777)
FT                   /locus_tag="Caur_0580"
FT   CDS_pept        complement(765451..765777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0580"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   bha:BH0558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33825"
FT                   /db_xref="GOA:A9WER6"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A9WER6"
FT                   /protein_id="ABY33825.1"
FT                   /translation="MLASTTTQRLFSLEEGLNMDQDQKQQILNRLNIIEGHIRGVKRMV
FT                   EEDAYCIDVLNQTRAIAQALAKLDALILNRHLHSCVITAIRSEDVGERERVIAELMQVF
FT                   ERIH"
FT   gene            766609..767988
FT                   /pseudo
FT                   /locus_tag="Caur_0581"
FT   gene            complement(769217..770065)
FT                   /locus_tag="Caur_0582"
FT   CDS_pept        complement(769217..770065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0582"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pde:Pden_4360 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33826"
FT                   /db_xref="GOA:A9WER7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9WER7"
FT                   /protein_id="ABY33826.1"
FT                   /translation="MLITLAEPATDQPVVKPLQPAIEIHGVTKCYRTRTGDVQALAGID
FT                   VVVAAGEVVALVGPSGCGKSTLLRIVAGLEQPDTGDVRLFGLAPAQARREHRFGIAFQA
FT                   AALLEWRDAAANVALPLELAGWPPAARAERVAALLARMGLSDAAGRLPRQLSGGMQQRV
FT                   ALARALALAPPVLLLDEPFSALDELTREQLQGELLDLLATIEPRPAVLLVTHNLAEAVL
FT                   LADRVVVLSRRPARVLAEVVVDLPHPRRADARDDEQLHRLVARLRTVLRRDQDEVMGSG
FT                   E"
FT   gene            complement(770090..771634)
FT                   /locus_tag="Caur_0583"
FT   CDS_pept        complement(770090..771634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caur_0583"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase_; KEGG: rrs:RoseRS_3204
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caur_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABY33827"
FT                   /db_xref="GOA:A9WER8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A9WER8"
FT                   /protein_id="ABY33827.1"
FT                   /translation="MSKIIAPECEWSHLLAQLRSVVPEAFNSEGHVLNLIEGTWGWPGH
FT                   GKHYSTPIDGTELGRMPMIDLETAKRAVRFAAREHETWARTDLDERRRRVRETVDGLRQ
FT                   HRDLIAYLLMWEIGKPYHLACDDVDRCLDGVEWYIDQIEWMLSNRQPLGLISNIASWNY
FT                   PYSVLVHAVLVQALAGNAVIAKTPSDGGLFALTLGFAIARRAGLPVSLVSGSGGALSDA
FT                   LVRNADVACLAFVGGKTNGRDIAASLYDRNKRYMLEMEGVNCYGIWDFSDWASLAQQIK
FT                   KGFAYGKQRCTAYIRYVVQRR