(data stored in ACNUC7421 zone)

EMBL: CP000920

ID   CP000920; SV 1; circular; genomic DNA; STD; PRO; 2111882 BP.
XX
AC   CP000920;
XX
PR   Project:PRJNA28041;
XX
DT   29-MAR-2009 (Rel. 100, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Streptococcus pneumoniae P1031, complete genome.
XX
KW   .
XX
OS   Streptococcus pneumoniae P1031
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-2111882
RA   Hotopp J.D., Censini S., Masignani V., Covacci A., Tettelin H.;
RT   ;
RL   Submitted (28-DEC-2007) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; d33bdf37491f0c68dbc3159e95f99adc.
DR   BioSample; SAMN02603445.
DR   EnsemblGenomes-Gn; EBG00001145551.
DR   EnsemblGenomes-Gn; EBG00001145552.
DR   EnsemblGenomes-Gn; EBG00001145553.
DR   EnsemblGenomes-Gn; EBG00001145554.
DR   EnsemblGenomes-Gn; EBG00001145555.
DR   EnsemblGenomes-Gn; EBG00001145556.
DR   EnsemblGenomes-Gn; EBG00001145557.
DR   EnsemblGenomes-Gn; EBG00001145558.
DR   EnsemblGenomes-Gn; EBG00001145559.
DR   EnsemblGenomes-Gn; EBG00001145560.
DR   EnsemblGenomes-Gn; EBG00001145561.
DR   EnsemblGenomes-Gn; EBG00001145562.
DR   EnsemblGenomes-Gn; EBG00001145563.
DR   EnsemblGenomes-Gn; EBG00001145564.
DR   EnsemblGenomes-Gn; EBG00001145565.
DR   EnsemblGenomes-Gn; EBG00001145566.
DR   EnsemblGenomes-Gn; EBG00001145567.
DR   EnsemblGenomes-Gn; EBG00001145568.
DR   EnsemblGenomes-Gn; EBG00001145569.
DR   EnsemblGenomes-Gn; EBG00001145570.
DR   EnsemblGenomes-Gn; EBG00001145571.
DR   EnsemblGenomes-Gn; EBG00001145572.
DR   EnsemblGenomes-Gn; EBG00001145573.
DR   EnsemblGenomes-Gn; EBG00001145574.
DR   EnsemblGenomes-Gn; EBG00001145575.
DR   EnsemblGenomes-Gn; EBG00001145576.
DR   EnsemblGenomes-Gn; EBG00001145577.
DR   EnsemblGenomes-Gn; EBG00001145578.
DR   EnsemblGenomes-Gn; EBG00001145579.
DR   EnsemblGenomes-Gn; EBG00001145580.
DR   EnsemblGenomes-Gn; EBG00001145581.
DR   EnsemblGenomes-Gn; EBG00001145582.
DR   EnsemblGenomes-Gn; EBG00001145583.
DR   EnsemblGenomes-Gn; EBG00001145584.
DR   EnsemblGenomes-Gn; EBG00001145585.
DR   EnsemblGenomes-Gn; EBG00001145586.
DR   EnsemblGenomes-Gn; EBG00001145587.
DR   EnsemblGenomes-Gn; EBG00001145588.
DR   EnsemblGenomes-Gn; EBG00001145589.
DR   EnsemblGenomes-Gn; EBG00001145590.
DR   EnsemblGenomes-Gn; EBG00001145591.
DR   EnsemblGenomes-Gn; EBG00001145592.
DR   EnsemblGenomes-Gn; EBG00001145593.
DR   EnsemblGenomes-Gn; EBG00001145594.
DR   EnsemblGenomes-Gn; EBG00001145595.
DR   EnsemblGenomes-Gn; EBG00001145596.
DR   EnsemblGenomes-Gn; EBG00001145597.
DR   EnsemblGenomes-Gn; EBG00001145598.
DR   EnsemblGenomes-Gn; EBG00001145599.
DR   EnsemblGenomes-Gn; EBG00001145600.
DR   EnsemblGenomes-Gn; EBG00001145601.
DR   EnsemblGenomes-Gn; EBG00001145602.
DR   EnsemblGenomes-Gn; EBG00001145603.
DR   EnsemblGenomes-Gn; EBG00001145604.
DR   EnsemblGenomes-Gn; EBG00001145605.
DR   EnsemblGenomes-Gn; EBG00001145606.
DR   EnsemblGenomes-Gn; EBG00001145607.
DR   EnsemblGenomes-Gn; EBG00001145608.
DR   EnsemblGenomes-Gn; EBG00001145609.
DR   EnsemblGenomes-Gn; EBG00001145610.
DR   EnsemblGenomes-Gn; EBG00001145611.
DR   EnsemblGenomes-Gn; EBG00001145612.
DR   EnsemblGenomes-Gn; EBG00001145613.
DR   EnsemblGenomes-Gn; EBG00001145614.
DR   EnsemblGenomes-Gn; EBG00001145615.
DR   EnsemblGenomes-Gn; EBG00001145616.
DR   EnsemblGenomes-Gn; EBG00001145617.
DR   EnsemblGenomes-Gn; EBG00001145618.
DR   EnsemblGenomes-Gn; EBG00001145619.
DR   EnsemblGenomes-Gn; EBG00001145620.
DR   EnsemblGenomes-Gn; EBG00001145621.
DR   EnsemblGenomes-Gn; EBG00001145622.
DR   EnsemblGenomes-Gn; EBG00001145623.
DR   EnsemblGenomes-Gn; EBG00001145624.
DR   EnsemblGenomes-Gn; EBG00001145625.
DR   EnsemblGenomes-Gn; EBG00001145626.
DR   EnsemblGenomes-Gn; EBG00001145627.
DR   EnsemblGenomes-Gn; EBG00001145628.
DR   EnsemblGenomes-Gn; EBG00001145629.
DR   EnsemblGenomes-Gn; EBG00001145630.
DR   EnsemblGenomes-Gn; EBG00001145631.
DR   EnsemblGenomes-Gn; EBG00001145632.
DR   EnsemblGenomes-Gn; EBG00001145633.
DR   EnsemblGenomes-Gn; EBG00001145634.
DR   EnsemblGenomes-Gn; EBG00001145635.
DR   EnsemblGenomes-Gn; EBG00001145636.
DR   EnsemblGenomes-Gn; EBG00001145637.
DR   EnsemblGenomes-Gn; EBG00001145638.
DR   EnsemblGenomes-Gn; EBG00001145639.
DR   EnsemblGenomes-Gn; EBG00001145640.
DR   EnsemblGenomes-Gn; EBG00001145641.
DR   EnsemblGenomes-Gn; EBG00001145642.
DR   EnsemblGenomes-Gn; EBG00001145643.
DR   EnsemblGenomes-Gn; EBG00001145644.
DR   EnsemblGenomes-Gn; EBG00001145645.
DR   EnsemblGenomes-Gn; EBG00001145646.
DR   EnsemblGenomes-Gn; EBG00001145647.
DR   EnsemblGenomes-Gn; EBG00001145648.
DR   EnsemblGenomes-Gn; EBG00001145649.
DR   EnsemblGenomes-Gn; EBG00001145650.
DR   EnsemblGenomes-Gn; EBG00001145651.
DR   EnsemblGenomes-Gn; EBG00001145652.
DR   EnsemblGenomes-Gn; EBG00001145653.
DR   EnsemblGenomes-Gn; EBG00001145654.
DR   EnsemblGenomes-Gn; EBG00001145655.
DR   EnsemblGenomes-Gn; EBG00001145656.
DR   EnsemblGenomes-Gn; EBG00001145657.
DR   EnsemblGenomes-Gn; EBG00001145658.
DR   EnsemblGenomes-Gn; EBG00001145659.
DR   EnsemblGenomes-Gn; EBG00001145660.
DR   EnsemblGenomes-Gn; EBG00001145661.
DR   EnsemblGenomes-Gn; EBG00001145662.
DR   EnsemblGenomes-Gn; SPP_0015.
DR   EnsemblGenomes-Gn; SPP_0016.
DR   EnsemblGenomes-Gn; SPP_0017.
DR   EnsemblGenomes-Gn; SPP_0019.
DR   EnsemblGenomes-Gn; SPP_0020.
DR   EnsemblGenomes-Gn; SPP_0021.
DR   EnsemblGenomes-Gn; SPP_0869.
DR   EnsemblGenomes-Gn; SPP_0870.
DR   EnsemblGenomes-Gn; SPP_0882.
DR   EnsemblGenomes-Gn; SPP_1019.
DR   EnsemblGenomes-Gn; SPP_1286.
DR   EnsemblGenomes-Gn; SPP_1332.
DR   EnsemblGenomes-Gn; SPP_1604.
DR   EnsemblGenomes-Gn; SPP_1792.
DR   EnsemblGenomes-Gn; SPP_1907.
DR   EnsemblGenomes-Gn; SPP_1908.
DR   EnsemblGenomes-Gn; SPP_1909.
DR   EnsemblGenomes-Gn; SPP_1910.
DR   EnsemblGenomes-Gn; SPP_1911.
DR   EnsemblGenomes-Gn; SPP_1912.
DR   EnsemblGenomes-Gn; SPP_1913.
DR   EnsemblGenomes-Gn; SPP_1914.
DR   EnsemblGenomes-Gn; SPP_1915.
DR   EnsemblGenomes-Gn; SPP_1916.
DR   EnsemblGenomes-Gn; SPP_1917.
DR   EnsemblGenomes-Gn; SPP_1918.
DR   EnsemblGenomes-Gn; SPP_1919.
DR   EnsemblGenomes-Gn; SPP_1920.
DR   EnsemblGenomes-Gn; SPP_1921.
DR   EnsemblGenomes-Gn; SPP_1922.
DR   EnsemblGenomes-Gn; SPP_1923.
DR   EnsemblGenomes-Gn; SPP_1924.
DR   EnsemblGenomes-Gn; SPP_1926.
DR   EnsemblGenomes-Gn; SPP_1927.
DR   EnsemblGenomes-Gn; SPP_1928.
DR   EnsemblGenomes-Gn; SPP_1982.
DR   EnsemblGenomes-Gn; SPP_2030.
DR   EnsemblGenomes-Gn; SPP_2031.
DR   EnsemblGenomes-Gn; SPP_2032.
DR   EnsemblGenomes-Gn; SPP_2033.
DR   EnsemblGenomes-Gn; SPP_2034.
DR   EnsemblGenomes-Gn; SPP_2035.
DR   EnsemblGenomes-Gn; SPP_2036.
DR   EnsemblGenomes-Gn; SPP_2037.
DR   EnsemblGenomes-Gn; SPP_2038.
DR   EnsemblGenomes-Gn; SPP_2039.
DR   EnsemblGenomes-Gn; SPP_2041.
DR   EnsemblGenomes-Gn; SPP_2042.
DR   EnsemblGenomes-Gn; SPP_2043.
DR   EnsemblGenomes-Gn; SPP_2107.
DR   EnsemblGenomes-Gn; SPP_2108.
DR   EnsemblGenomes-Gn; SPP_2109.
DR   EnsemblGenomes-Gn; SPP_2110.
DR   EnsemblGenomes-Gn; SPP_2111.
DR   EnsemblGenomes-Gn; SPP_2112.
DR   EnsemblGenomes-Gn; SPP_2113.
DR   EnsemblGenomes-Gn; SPP_2114.
DR   EnsemblGenomes-Gn; SPP_2115.
DR   EnsemblGenomes-Gn; SPP_2116.
DR   EnsemblGenomes-Gn; SPP_2117.
DR   EnsemblGenomes-Gn; SPP_2118.
DR   EnsemblGenomes-Gn; SPP_2120.
DR   EnsemblGenomes-Gn; SPP_2121.
DR   EnsemblGenomes-Gn; SPP_2122.
DR   EnsemblGenomes-Gn; SPP_2288.
DR   EnsemblGenomes-Gn; SPP_2289.
DR   EnsemblGenomes-Gn; SPP_2293.
DR   EnsemblGenomes-Gn; SPP_2297.
DR   EnsemblGenomes-Gn; SPP_2298.
DR   EnsemblGenomes-Gn; SPP_2299.
DR   EnsemblGenomes-Gn; SPP_2300.
DR   EnsemblGenomes-Gn; SPP_2301.
DR   EnsemblGenomes-Gn; SPP_2303.
DR   EnsemblGenomes-Gn; SPP_2304.
DR   EnsemblGenomes-Gn; SPP_2306.
DR   EnsemblGenomes-Gn; SPP_2307.
DR   EnsemblGenomes-Gn; SPP_2317.
DR   EnsemblGenomes-Tr; EBT00001560115.
DR   EnsemblGenomes-Tr; EBT00001560116.
DR   EnsemblGenomes-Tr; EBT00001560117.
DR   EnsemblGenomes-Tr; EBT00001560118.
DR   EnsemblGenomes-Tr; EBT00001560120.
DR   EnsemblGenomes-Tr; EBT00001560121.
DR   EnsemblGenomes-Tr; EBT00001560122.
DR   EnsemblGenomes-Tr; EBT00001560123.
DR   EnsemblGenomes-Tr; EBT00001560124.
DR   EnsemblGenomes-Tr; EBT00001560126.
DR   EnsemblGenomes-Tr; EBT00001560127.
DR   EnsemblGenomes-Tr; EBT00001560128.
DR   EnsemblGenomes-Tr; EBT00001560130.
DR   EnsemblGenomes-Tr; EBT00001560132.
DR   EnsemblGenomes-Tr; EBT00001560134.
DR   EnsemblGenomes-Tr; EBT00001560136.
DR   EnsemblGenomes-Tr; EBT00001560138.
DR   EnsemblGenomes-Tr; EBT00001560140.
DR   EnsemblGenomes-Tr; EBT00001560141.
DR   EnsemblGenomes-Tr; EBT00001560142.
DR   EnsemblGenomes-Tr; EBT00001560143.
DR   EnsemblGenomes-Tr; EBT00001560144.
DR   EnsemblGenomes-Tr; EBT00001560145.
DR   EnsemblGenomes-Tr; EBT00001560146.
DR   EnsemblGenomes-Tr; EBT00001560147.
DR   EnsemblGenomes-Tr; EBT00001560148.
DR   EnsemblGenomes-Tr; EBT00001560149.
DR   EnsemblGenomes-Tr; EBT00001560151.
DR   EnsemblGenomes-Tr; EBT00001560153.
DR   EnsemblGenomes-Tr; EBT00001560154.
DR   EnsemblGenomes-Tr; EBT00001560156.
DR   EnsemblGenomes-Tr; EBT00001560158.
DR   EnsemblGenomes-Tr; EBT00001560160.
DR   EnsemblGenomes-Tr; EBT00001560161.
DR   EnsemblGenomes-Tr; EBT00001560163.
DR   EnsemblGenomes-Tr; EBT00001560165.
DR   EnsemblGenomes-Tr; EBT00001560167.
DR   EnsemblGenomes-Tr; EBT00001560169.
DR   EnsemblGenomes-Tr; EBT00001560170.
DR   EnsemblGenomes-Tr; EBT00001560172.
DR   EnsemblGenomes-Tr; EBT00001560175.
DR   EnsemblGenomes-Tr; EBT00001560177.
DR   EnsemblGenomes-Tr; EBT00001560179.
DR   EnsemblGenomes-Tr; EBT00001560181.
DR   EnsemblGenomes-Tr; EBT00001560183.
DR   EnsemblGenomes-Tr; EBT00001560185.
DR   EnsemblGenomes-Tr; EBT00001560187.
DR   EnsemblGenomes-Tr; EBT00001560189.
DR   EnsemblGenomes-Tr; EBT00001560192.
DR   EnsemblGenomes-Tr; EBT00001560194.
DR   EnsemblGenomes-Tr; EBT00001560196.
DR   EnsemblGenomes-Tr; EBT00001560198.
DR   EnsemblGenomes-Tr; EBT00001560200.
DR   EnsemblGenomes-Tr; EBT00001560202.
DR   EnsemblGenomes-Tr; EBT00001560204.
DR   EnsemblGenomes-Tr; EBT00001560206.
DR   EnsemblGenomes-Tr; EBT00001560207.
DR   EnsemblGenomes-Tr; EBT00001560208.
DR   EnsemblGenomes-Tr; EBT00001560210.
DR   EnsemblGenomes-Tr; EBT00001560211.
DR   EnsemblGenomes-Tr; EBT00001560214.
DR   EnsemblGenomes-Tr; EBT00001560215.
DR   EnsemblGenomes-Tr; EBT00001560216.
DR   EnsemblGenomes-Tr; EBT00001560218.
DR   EnsemblGenomes-Tr; EBT00001560220.
DR   EnsemblGenomes-Tr; EBT00001560222.
DR   EnsemblGenomes-Tr; EBT00001560224.
DR   EnsemblGenomes-Tr; EBT00001560226.
DR   EnsemblGenomes-Tr; EBT00001560229.
DR   EnsemblGenomes-Tr; EBT00001560231.
DR   EnsemblGenomes-Tr; EBT00001560233.
DR   EnsemblGenomes-Tr; EBT00001560235.
DR   EnsemblGenomes-Tr; EBT00001560236.
DR   EnsemblGenomes-Tr; EBT00001560237.
DR   EnsemblGenomes-Tr; EBT00001560239.
DR   EnsemblGenomes-Tr; EBT00001560241.
DR   EnsemblGenomes-Tr; EBT00001560243.
DR   EnsemblGenomes-Tr; EBT00001560246.
DR   EnsemblGenomes-Tr; EBT00001560247.
DR   EnsemblGenomes-Tr; EBT00001560248.
DR   EnsemblGenomes-Tr; EBT00001560250.
DR   EnsemblGenomes-Tr; EBT00001560252.
DR   EnsemblGenomes-Tr; EBT00001560253.
DR   EnsemblGenomes-Tr; EBT00001560255.
DR   EnsemblGenomes-Tr; EBT00001560257.
DR   EnsemblGenomes-Tr; EBT00001560258.
DR   EnsemblGenomes-Tr; EBT00001560259.
DR   EnsemblGenomes-Tr; EBT00001560261.
DR   EnsemblGenomes-Tr; EBT00001560264.
DR   EnsemblGenomes-Tr; EBT00001560266.
DR   EnsemblGenomes-Tr; EBT00001560268.
DR   EnsemblGenomes-Tr; EBT00001560270.
DR   EnsemblGenomes-Tr; EBT00001560272.
DR   EnsemblGenomes-Tr; EBT00001560273.
DR   EnsemblGenomes-Tr; EBT00001560275.
DR   EnsemblGenomes-Tr; EBT00001560278.
DR   EnsemblGenomes-Tr; EBT00001560279.
DR   EnsemblGenomes-Tr; EBT00001560282.
DR   EnsemblGenomes-Tr; EBT00001560284.
DR   EnsemblGenomes-Tr; EBT00001560286.
DR   EnsemblGenomes-Tr; EBT00001560288.
DR   EnsemblGenomes-Tr; EBT00001560290.
DR   EnsemblGenomes-Tr; EBT00001560291.
DR   EnsemblGenomes-Tr; EBT00001560293.
DR   EnsemblGenomes-Tr; EBT00001560295.
DR   EnsemblGenomes-Tr; EBT00001560298.
DR   EnsemblGenomes-Tr; EBT00001560300.
DR   EnsemblGenomes-Tr; EBT00001560302.
DR   EnsemblGenomes-Tr; EBT00001560304.
DR   EnsemblGenomes-Tr; EBT00001560306.
DR   EnsemblGenomes-Tr; EBT00001560308.
DR   EnsemblGenomes-Tr; EBT00001560309.
DR   EnsemblGenomes-Tr; SPP_0015-1.
DR   EnsemblGenomes-Tr; SPP_0016-1.
DR   EnsemblGenomes-Tr; SPP_0017-1.
DR   EnsemblGenomes-Tr; SPP_0019-1.
DR   EnsemblGenomes-Tr; SPP_0020-1.
DR   EnsemblGenomes-Tr; SPP_0021-1.
DR   EnsemblGenomes-Tr; SPP_0869-1.
DR   EnsemblGenomes-Tr; SPP_0870-1.
DR   EnsemblGenomes-Tr; SPP_0882-1.
DR   EnsemblGenomes-Tr; SPP_1019-1.
DR   EnsemblGenomes-Tr; SPP_1286-1.
DR   EnsemblGenomes-Tr; SPP_1332-1.
DR   EnsemblGenomes-Tr; SPP_1604-1.
DR   EnsemblGenomes-Tr; SPP_1792-1.
DR   EnsemblGenomes-Tr; SPP_1907-1.
DR   EnsemblGenomes-Tr; SPP_1908-1.
DR   EnsemblGenomes-Tr; SPP_1909-1.
DR   EnsemblGenomes-Tr; SPP_1910-1.
DR   EnsemblGenomes-Tr; SPP_1911-1.
DR   EnsemblGenomes-Tr; SPP_1912-1.
DR   EnsemblGenomes-Tr; SPP_1913-1.
DR   EnsemblGenomes-Tr; SPP_1914-1.
DR   EnsemblGenomes-Tr; SPP_1915-1.
DR   EnsemblGenomes-Tr; SPP_1916-1.
DR   EnsemblGenomes-Tr; SPP_1917-1.
DR   EnsemblGenomes-Tr; SPP_1918-1.
DR   EnsemblGenomes-Tr; SPP_1919-1.
DR   EnsemblGenomes-Tr; SPP_1920-1.
DR   EnsemblGenomes-Tr; SPP_1921-1.
DR   EnsemblGenomes-Tr; SPP_1922-1.
DR   EnsemblGenomes-Tr; SPP_1923-1.
DR   EnsemblGenomes-Tr; SPP_1924-1.
DR   EnsemblGenomes-Tr; SPP_1926-1.
DR   EnsemblGenomes-Tr; SPP_1927-1.
DR   EnsemblGenomes-Tr; SPP_1928-1.
DR   EnsemblGenomes-Tr; SPP_1982-1.
DR   EnsemblGenomes-Tr; SPP_2030-1.
DR   EnsemblGenomes-Tr; SPP_2031-1.
DR   EnsemblGenomes-Tr; SPP_2032-1.
DR   EnsemblGenomes-Tr; SPP_2033-1.
DR   EnsemblGenomes-Tr; SPP_2034-1.
DR   EnsemblGenomes-Tr; SPP_2035-1.
DR   EnsemblGenomes-Tr; SPP_2036-1.
DR   EnsemblGenomes-Tr; SPP_2037-1.
DR   EnsemblGenomes-Tr; SPP_2038-1.
DR   EnsemblGenomes-Tr; SPP_2039-1.
DR   EnsemblGenomes-Tr; SPP_2041-1.
DR   EnsemblGenomes-Tr; SPP_2042-1.
DR   EnsemblGenomes-Tr; SPP_2043-1.
DR   EnsemblGenomes-Tr; SPP_2107-1.
DR   EnsemblGenomes-Tr; SPP_2108-1.
DR   EnsemblGenomes-Tr; SPP_2109-1.
DR   EnsemblGenomes-Tr; SPP_2110-1.
DR   EnsemblGenomes-Tr; SPP_2111-1.
DR   EnsemblGenomes-Tr; SPP_2112-1.
DR   EnsemblGenomes-Tr; SPP_2113-1.
DR   EnsemblGenomes-Tr; SPP_2114-1.
DR   EnsemblGenomes-Tr; SPP_2115-1.
DR   EnsemblGenomes-Tr; SPP_2116-1.
DR   EnsemblGenomes-Tr; SPP_2117-1.
DR   EnsemblGenomes-Tr; SPP_2118-1.
DR   EnsemblGenomes-Tr; SPP_2120-1.
DR   EnsemblGenomes-Tr; SPP_2121-1.
DR   EnsemblGenomes-Tr; SPP_2122-1.
DR   EnsemblGenomes-Tr; SPP_2288-1.
DR   EnsemblGenomes-Tr; SPP_2289-1.
DR   EnsemblGenomes-Tr; SPP_2293-1.
DR   EnsemblGenomes-Tr; SPP_2297-1.
DR   EnsemblGenomes-Tr; SPP_2298-1.
DR   EnsemblGenomes-Tr; SPP_2299-1.
DR   EnsemblGenomes-Tr; SPP_2300-1.
DR   EnsemblGenomes-Tr; SPP_2301-1.
DR   EnsemblGenomes-Tr; SPP_2303-1.
DR   EnsemblGenomes-Tr; SPP_2304-1.
DR   EnsemblGenomes-Tr; SPP_2306-1.
DR   EnsemblGenomes-Tr; SPP_2307-1.
DR   EnsemblGenomes-Tr; SPP_2317-1.
DR   EuropePMC; PMC3088708; 21573186.
DR   EuropePMC; PMC3318815; 22307284.
DR   EuropePMC; PMC4202715; 25368607.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01335; CRISPR-DR22.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP000920.
DR   SILVA-SSU; CP000920.
XX
CC   Submission of strain to ATCC is pending.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2111882
FT                   /organism="Streptococcus pneumoniae P1031"
FT                   /strain="P1031"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:488223"
FT   gene            197..1558
FT                   /gene="dnaA"
FT                   /locus_tag="SPP_0001"
FT   CDS_pept        197..1558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SPP_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21605"
FT                   /db_xref="GOA:C1CN66"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CN66"
FT                   /protein_id="ACO21605.1"
FT                   /translation="MKEKQFWNRILEFAQERLTRSMYDFYAIQAEVIKVEENVATIFLP
FT                   RSEMEMVWEKQLKDIIVVAGFEIYDAEITPHYIFTKPQDTTSSQVEEATNLTLYDYSPK
FT                   LVSIPYSDTGLKEKYTFDNFIQGDGNVWAVSAALAVSEDLALTYNPLFIYGGPGLGKTH
FT                   LLNAIGNEILKNIPNARVKYIPAESFINDFLDHLRLGEMEKFKKTYRSLDLLLIDDIQS
FT                   LSGKKVATQEEFFNTFNALHDKQKQIVLTSDRSPKHLEGLEERLVTRFSWGLTQTITPP
FT                   DFETRIAILQSKTEHLGYNFQSDTLEYLAGQFDSNVRDLEGAINDITLIARVKKIKDIT
FT                   IDIAAEAIRARKQDVSQMLVIPIDKIQTEVGNFYGVSIKEMKGSRRLQNIVLARQVAMY
FT                   LSRELTDNSLPKIGKEFGGKDHTTVIHAHAKIKSLIDQDDNLRLEIESIKKKIK"
FT   gene            1717..2853
FT                   /gene="dnaN"
FT                   /locus_tag="SPP_0002"
FT   CDS_pept        1717..2853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SPP_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21038"
FT                   /protein_id="ACO21038.1"
FT                   /translation="MIHFSINKNLFLQALNTTKRAISSKNAIPILSTVKIDVTNEGITL
FT                   IGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQI
FT                   VLTSGKSEITLKGKDSEQYPRIQEISASTPLILETKLLKKIINETAFAASTQESRPILT
FT                   GVHFVLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETV
FT                   EIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLL
FT                   SSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKA
FT                   LNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVRTN"
FT   gene            2918..3112
FT                   /locus_tag="SPP_0003"
FT   CDS_pept        2918..3112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0003"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF06107"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20441"
FT                   /protein_id="ACO20441.1"
FT                   /translation="MYQVGNFVEMKKPHACTIKSTGKKANRWEITRVGADIKIKCSNCE
FT                   HVVMMGRYDFERKMNKIID"
FT   gene            3196..4311
FT                   /gene="ychF"
FT                   /locus_tag="SPP_0004"
FT   CDS_pept        3196..4311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="SPP_0004"
FT                   /product="GTP-binding protein YchF"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF06071; match to protein
FT                   family HMM TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21755"
FT                   /protein_id="ACO21755.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTEMITPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPLADIDTINLELILADLESVNKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTDEEQKVVKGLFLLTTKPVLYVANVDEDVVSEPD
FT                   SIDYVKQIREFAATENAEVVVISARAEEEISELDDEDKKEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGMKAPQAAGIIHSDFEKGFIRAVTMSYEDLVKYGS
FT                   EKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
FT   gene            4382..4951
FT                   /gene="pth"
FT                   /locus_tag="SPP_0005"
FT   CDS_pept        4382..4951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SPP_0005"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21419"
FT                   /db_xref="GOA:C1CN70"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CN70"
FT                   /protein_id="ACO21419.1"
FT                   /translation="MTKLLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIFQ
FT                   ADLASFFLNGEKIYLVKPTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKIRL
FT                   RAKGSAGGHNGIKSIIQHIGTQVFNRVKIGIGRPKNGMSVVHHVLSKFDRDDYIGILQS
FT                   VDKVDDSVNYYLQEKNFEKTMQRYNG"
FT   gene            4952..8461
FT                   /gene="mfd"
FT                   /locus_tag="SPP_0006"
FT   CDS_pept        4952..8461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="SPP_0006"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF02559; match to protein family HMM PF03461;
FT                   match to protein family HMM PF04851; match to protein
FT                   family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20596"
FT                   /protein_id="ACO20596.1"
FT                   /translation="MVTLLDLFSENDQIKKWHQNLTDKKRQLILGLSTSTKALAIASSL
FT                   EKEDRIVLLTSTYGEAEGLVSDLISILGEELVYPFLVDDAPMVEFLMSSQEKIISRVEA
FT                   LRFLTDSSKKGILVCNIAASRLILPSPNAFKDSIVKISVGEEYAQHAFIHQLKENGYRK
FT                   VTQVQTQGEFSLRGDILDIFEISQLEPCRIEFFGDEIDGIRSFEVETQLSKENKTELTI
FT                   FPASDMLLREKDYQRGQSALEKQISKTLSPILKSYLEEILSSFHQKQSHADSRKFLSLC
FT                   YDKTWTVFDYIEKDTPIFFDDYQKLMNQYEVFERELAQYFTEELQNSKAFSDMQYFSDI
FT                   EQIYKKQSPVTFFSNLQKGLGNLKFDKIYQFNQYPMQEFFNQFSFLKEEIERYKKMDYT
FT                   IILQSSNSMGSKTLEDMLEEYQIKLDSRDKTSICKESVNLIEGNLRHGFHFVDEKILLI
FT                   TEHEIFQKKLKRRFRRQHVSNAERLKDYNELEKGDYVVHHIHGIGQYLGIETIEIKGIH
FT                   RDYVSVQYQNGDQISIPVEQIHLLSKYISSDGKAPKLNKLNDGHFKKAKQKVKNQVEDI
FT                   ADDLIKLYSERSQLKGFAFSADDDDQDAFDDAFPYVETDDQLRSIEEIKRDMQASQPMD
FT                   RLLVGDVGFGKTEVAMRAAFKAVNDHKQVVILVPTTVLAQQHYTNFKERFQNFAVNVDV
FT                   LSRFRSKKEQTATLEKLKNGQVDILIGTHRVLSKDVVFADLGLMIIDEEQRFGVKHKET
FT                   LKELKKQVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLEKNDSVIRD
FT                   AVLREMERGGQVYYLYNKVDTIVQKVSELQELIPEASIGYVHGRMSEVQLENTLLDFIE
FT                   GQYDILVTTTIIETGVDIPNANTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRP
FT                   EKSISEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNLLGKSQSGFIDSVGFELYSQ
FT                   LLEEAIAKRNGNANANTRTKGNAELILQIDAYLPDTYISDQRHKIEIYKKIRQIDNRVN
FT                   YEELQEELIDRFGEYPDVVAYLLEIGLVKSYLDKVFVQRVERKDNKITIQFEKVTQRLF
FT                   LAQDYFKALSVTNLKAGIAENKGLMELVFDVQNKKDYEILEGLLIFGESLLEIKESKEE
FT                   NSI"
FT   gene            8519..8785
FT                   /locus_tag="SPP_0007"
FT   CDS_pept        8519..8785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0007"
FT                   /product="ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S subunit"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20271"
FT                   /protein_id="ACO20271.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVND
FT                   QVEIRFGNKLLLVKVLEMKDSTKKEDAAGMYEIISETRVEENV"
FT   gene            8778..9146
FT                   /locus_tag="SPP_0008"
FT   CDS_pept        8778..9146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0008"
FT                   /product="septum formation initiator"
FT                   /note="identified by match to protein family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21562"
FT                   /protein_id="ACO21562.1"
FT                   /translation="MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIMLLF
FT                   ILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKY
FT                   YYSKSREKVYTIPDLLQR"
FT   gene            9151..9273
FT                   /locus_tag="SPP_0009"
FT   CDS_pept        9151..9273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20982"
FT                   /protein_id="ACO20982.1"
FT                   /translation="MENLLDVIEQFLSLSDEKLEELADKNQLLRLQEEKERKNA"
FT   gene            9266..10534
FT                   /locus_tag="SPP_0010"
FT   CDS_pept        9266..10534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0010"
FT                   /product="beta-lactamase class A"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20487"
FT                   /protein_id="ACO20487.1"
FT                   /translation="MRKFLIILLLPSFLTISKVVSTEKEVVYTSKEIYYLSQSDFGIYF
FT                   REKLSSPMVYGEVPVYANEDLVVESGKLTPKTSFQITEWRLNKQGIPVFKLSNHQFIAA
FT                   DKRFLYDQSEVTPTIKKAWLESDFKLYNSPYDLKEVKSSLSAYSQVSIDKTMFVEGREF
FT                   LHIDQAGWVAKESTSEEDNRMSKVQEMLSEKYQKDSFSIYVKQLTTGKEAGINQDEKMY
FT                   AASVLKLSYLYYTQEKINEGLYQLDTTVKYVSAVNDFPGSYKPEGSGSLPKKEDNKEYS
FT                   LKDLITKVSKESDNVAHNLLGYYISNQSDATFKSKMSAIMGDDWDPKEKLISSKMAGKF
FT                   MEAIYNQNGFVLESLTKTDFDSQRIAKGVSVKVAHKIGDADEFKHDTGVVYADSPFILS
FT                   IFTKNSDYDTISKIAKDVYEVLK"
FT   gene            10531..11808
FT                   /locus_tag="SPP_0011"
FT   CDS_pept        10531..11808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0011"
FT                   /product="tRNA(Ile)-lysidine synthase
FT                   (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine
FT                   synthase)"
FT                   /EC_number="6.3.4.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432; match to protein
FT                   family HMM TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21994"
FT                   /db_xref="GOA:C1CN76"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CN76"
FT                   /protein_id="ACO21994.1"
FT                   /translation="MREPDFLNHFLKKGYFKKHAKAVLALSGGLDSMFLFKVLSTYQKE
FT                   LEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFSEARARNFRYDFFQ
FT                   EVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQ
FT                   KKDFPSIFHFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIA
FT                   ELSNNINVEDLQQLFSYSESTQRVLLQTYLNRFPDLNLTKAQFAEVQQILKSKSQYRHP
FT                   IKNGYELIKEYQQFQICKISPQADEEEDELVLHYQNQVAYQGYLFSFGLPLEGESIQQI
FT                   PVSRETSIHIRHRKTGDVLIQNGHRKKLRRLFIDLKIPMEKRNSALIIEQFGEIVSILG
FT                   IATNNLSKKTKNDIMNTVLYIEKIDR"
FT   gene            11812..12354
FT                   /gene="hpt"
FT                   /locus_tag="SPP_0012"
FT   CDS_pept        11812..12354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SPP_0012"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20898"
FT                   /protein_id="ACO20898.1"
FT                   /translation="MLENDIKKVLVSHDEITEAAKKLGAQLTKDYAGKNPILVGILKGS
FT                   IPFMAELVKHIDTHIEMDFMMVSSYHGGTASSGVINIKQDVTQDIKGRHVLFVEDIIDT
FT                   GQTLKNLRDMFKAREAASVKIATLLDKPEGRVVEIEADYTCFTIPNEFVVGYGLDYKEN
FT                   YRNLPYIGVLKEEVYSN"
FT   gene            12370..14328
FT                   /gene="hflB"
FT                   /locus_tag="SPP_0013"
FT   CDS_pept        12370..14328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /locus_tag="SPP_0013"
FT                   /product="ATP-dependent metallopeptidase HflB"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20292"
FT                   /protein_id="ACO20292.1"
FT                   /translation="MKKQNNGLIKNPFLWLLFIFFLVTGFQYFYSGNNSGGSQQINYTE
FT                   LVQEITDGNVKELTYQPNGSVIEVSGVYKNPKTSKEETGIQFFTPSVTKVEKFTSTILP
FT                   ADTTVSELQKLATDHKAEVTVKHESSSGIWINLLVSIVPFGILFFFLFSMMGNMGGGNG
FT                   RNPMSFGRSKAKAANKEDIKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAAPA
FT                   IIFIDEIDAVGRQRGVGLGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAEDVDLKLVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKSIIDASDIDEAEDRVIAGPSKKDKTVSQKERELVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMGGRVAEEIIFNV
FT                   QTTGASNDFEQATQMARAMVTEYGMSEKLGPVQYEGNHAMFGAQSPQKSISEQTAYEID
FT                   EEVRSLLNEARNKAAEIIQSNREIHKLIAEALLKYETLDSTQIKALYETGKMPEAVEEE
FT                   SHALSYDEVKSKMNDEK"
FT   gene            14450..14929
FT                   /locus_tag="SPP_0014"
FT   CDS_pept        14450..14929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0014"
FT                   /product="competence-specific global transcription
FT                   modulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20162"
FT                   /protein_id="ACO20162.1"
FT                   /translation="MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISRE
FT                   EGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRRYDKEPYEEVGEISHRISEGGLWLD
FT                   DYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH"
FT   gene            15024..15098
FT                   /locus_tag="SPP_0015"
FT   tRNA            15024..15098
FT                   /locus_tag="SPP_0015"
FT                   /product="tRNA-Glu"
FT   gene            15373..16806
FT                   /gene="rrs1"
FT                   /locus_tag="SPP_0016"
FT   rRNA            15373..16806
FT                   /gene="rrs1"
FT                   /locus_tag="SPP_0016"
FT                   /product="16S ribosomal RNA"
FT   gene            16944..17021
FT                   /locus_tag="SPP_0017"
FT   tRNA            16944..17021
FT                   /locus_tag="SPP_0017"
FT                   /product="tRNA-Ala"
FT   gene            17142..20043
FT                   /gene="rrl1"
FT                   /locus_tag="SPP_0019"
FT   rRNA            17142..20043
FT                   /gene="rrl1"
FT                   /locus_tag="SPP_0019"
FT                   /product="23S ribosomal RNA"
FT   gene            20120..20235
FT                   /gene="rrf1"
FT                   /locus_tag="SPP_0020"
FT   rRNA            20120..20235
FT                   /gene="rrf1"
FT                   /locus_tag="SPP_0020"
FT                   /product="5S ribosomal RNA"
FT   gene            20241..20317
FT                   /locus_tag="SPP_0021"
FT   tRNA            20241..20317
FT                   /locus_tag="SPP_0021"
FT                   /product="tRNA-Asn"
FT   gene            20422..20751
FT                   /locus_tag="SPP_0022"
FT   CDS_pept        20422..20751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0022"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF01710"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21636"
FT                   /protein_id="ACO21636.1"
FT                   /translation="MAYSIDFRKKVLSYCERTGSITEASHVFQILRNTIYGWLKLKEKT
FT                   GELNHQVKGTKPRKVDRDRLKNYLTDNPDAYLTEIASEFGCHPTTIHYALKAMGYTRKK
FT                   EPHLL"
FT   gene            21178..21312
FT                   /locus_tag="SPP_0023"
FT   CDS_pept        21178..21312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20754"
FT                   /protein_id="ACO20754.1"
FT                   /translation="MGSYQKAPQKGITKLQYLLRGFFILLLFQLTILEARHFSVLCQL"
FT   gene            complement(21652..21795)
FT                   /pseudo
FT                   /locus_tag="SPP_0024"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            complement(21843..22049)
FT                   /pseudo
FT                   /locus_tag="SPP_0025"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            22365..22601
FT                   /locus_tag="SPP_0026"
FT   CDS_pept        22365..22601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0026"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21443"
FT                   /protein_id="ACO21443.1"
FT                   /translation="MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRY
FT                   GIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC"
FT   gene            22790..24118
FT                   /gene="purA"
FT                   /locus_tag="SPP_0027"
FT   CDS_pept        22790..24118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SPP_0027"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21906"
FT                   /protein_id="ACO21906.1"
FT                   /translation="MYVRKEEPEGSDKIMTSVVVVGTQWGDEGKGKITDFLSANAEVIA
FT                   RYQGGDNAGHTIVIDGKKFKLHLIPSGIFFPEKISVIGNGMVVNPKSLVKELSYLHEEG
FT                   VTTDNLRISDRAHVILPYHIELDRLQEEAKGDNKIGTTIKGIGPAYMDKAARVGIRIAD
FT                   LLDKDIFRERLERNLAEKNRLFEKLYDSKAIVFDDIFEEYYEYGQQIKKYVIDTSVILN
FT                   DALDNGKRVLFEGAQGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKIDKVVGVCKA
FT                   YTSRVGDGPFPTELFDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNL
FT                   SLNSIDVLSGLDTVKICVAYDLDGQRIDYYPASLEQLKRCKPIYEELPGWSEDITGVRN
FT                   LEDLPENARNYVRRVSELVGVRISTFSVGPGREQTNILESVWS"
FT   gene            complement(24350..25498)
FT                   /locus_tag="SPP_0028"
FT   CDS_pept        complement(24350..25498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0028"
FT                   /product="integrase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20479"
FT                   /protein_id="ACO20479.1"
FT                   /translation="MKYNKTKYPNIYYYETAKGKRYYVRRSFFFRGKKREKSKSGFTTL
FT                   PQARAALVELEQQIQEQELGINTNLTLDQYWDIYSEKRLSTGRWNDTSYYLNDNLYKNH
FT                   IKAKFGSILLKNLDRNEYELFIAEKLQNHTRYTVQTLNSSFMALLNDAVKNGNLLSNRL
FT                   KGVFIGQSDIPAANKKVTLKEFKTWIAKAEEIMPKQFYALTYLTIFGLRRGEVFGLRPM
FT                   DITQNDSGRAILHLRDSRSNQTLKGKGGLKTKDSERYVCLDDIGTDLIYYLIAEASKIK
FT                   RKLGIIKEQHKDYITINEKGGLINPNQLNRNFNLVNEATGLHVTPHMMRHFFTTQSIIA
FT                   GVPLEQLSQALGHTKVYMTDRYNQVEDELAEATTDLFLSHIR"
FT   gene            complement(25673..26485)
FT                   /locus_tag="SPP_0029"
FT   CDS_pept        complement(25673..26485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0029"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20991"
FT                   /protein_id="ACO20991.1"
FT                   /translation="MQKTVEKILFRVAGVTKYKKAVKEACNMIAEDNGIPEYAKYYSNL
FT                   STKELREELEEYGLKVFKYQDLDFFNIELVPEVDNRYDPNAIKVLIFDNHVGYVPATIA
FT                   KTIRKYFDNKKYNFVIEGEIKGGPYKEWDEYEEKVVTNNDLDVGFEIYLTIVDSSQKEV
FT                   IQSESSEIIDDNISNKEVTETEAIETKTTETEHIEQNIVSDSVADIVNEINLSETSPKK
FT                   KLPANKIIFSALYLFLVFFGVVGIPIAPFLAVPLTAWSLYKLYKLFRK"
FT   gene            complement(26523..26669)
FT                   /locus_tag="SPP_0030"
FT   CDS_pept        complement(26523..26669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0030"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21700"
FT                   /protein_id="ACO21700.1"
FT                   /translation="MIHHLVKDALESLDDPTEFDYLKFMSYYNLKTMTNEVMVKEEYLA
FT                   LVN"
FT   gene            complement(26745..26903)
FT                   /locus_tag="SPP_0031"
FT   CDS_pept        complement(26745..26903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0031"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21282"
FT                   /protein_id="ACO21282.1"
FT                   /translation="MILAKLCEEYQVELCLFDGSNWHSSGFYNPDTNVLAIDHNLAPEQ
FT                   QIQVALH"
FT   gene            complement(26916..27179)
FT                   /locus_tag="SPP_0032"
FT   CDS_pept        complement(26916..27179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0032"
FT                   /product="plasmid addiction system poison protein"
FT                   /note="identified by match to protein family HMM PF05016;
FT                   match to protein family HMM TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21728"
FT                   /protein_id="ACO21728.1"
FT                   /translation="MYRLDIDKKALKQLKKLDTPTRKQILSWLAKNIENTTNPRQHGKA
FT                   LKANLAGYWRYRVENYRIICDIQDDKLVVLAVEIAHRRDVYK"
FT   gene            complement(27179..27412)
FT                   /locus_tag="SPP_0033"
FT   CDS_pept        complement(27179..27412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20410"
FT                   /protein_id="ACO20410.1"
FT                   /translation="MTITINFTEKNSYITDYLTKHGIDTTTMDFDDFMVLMEDIEDARA
FT                   ADQAYMEYLADPATYTMDEVLDELGLSREDIA"
FT   gene            complement(27412..27780)
FT                   /locus_tag="SPP_0034"
FT   CDS_pept        complement(27412..27780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0034"
FT                   /product="phage transcriptional regulator, Cro/CI family"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20854"
FT                   /protein_id="ACO20854.1"
FT                   /translation="MFVAFDKIKELADKQGISINILEEKLGYGTNTLYRLKRSNPSSKV
FT                   LKEIADYFNVSADYLLGRTDNPAIAGSDEFAQVNGQIIDLRKAAANTMLFDGKPLNEDD
FT                   IDFITSVLSAHFKSKGER"
FT   gene            28065..28211
FT                   /locus_tag="SPP_0035"
FT   CDS_pept        28065..28211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0035"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21566"
FT                   /protein_id="ACO21566.1"
FT                   /translation="MNEEDLKELLELLATDYGRGYLDGVVGGLSMLLKISKEAEKYRKE
FT                   KYE"
FT   gene            28622..28825
FT                   /locus_tag="SPP_0036"
FT   CDS_pept        28622..28825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0036"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20969"
FT                   /protein_id="ACO20969.1"
FT                   /translation="MSKELKIIKAKIKTRLIELDMTQVELAKQVSVASSVISELLKYGK
FT                   GSDYVKEKVVDILGIENPWENS"
FT   gene            28842..29039
FT                   /locus_tag="SPP_0037"
FT   CDS_pept        28842..29039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0037"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21674"
FT                   /protein_id="ACO21674.1"
FT                   /translation="MNNAAQKVTRIDKDAWEIATELANEYGVSICHIISESVRYCAENA
FT                   EFKEMDVVVKRLVVGSKVLE"
FT   gene            complement(29206..29631)
FT                   /locus_tag="SPP_0038"
FT   CDS_pept        complement(29206..29631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0038"
FT                   /product="phage protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22114"
FT                   /protein_id="ACO22114.1"
FT                   /translation="MEYQALIQPVISIILAIISGLWSYVASKANNKAEIEKQAKEHSHT
FT                   VEKLEREFHHQIDTLKQQHAFELEKIKQAHELRLQELEKVSQLDTETDKSMKMNDLTYK
FT                   VFTGEVDFDKALKIANKASNSKQNLNKRFIQKTSKKS"
FT   gene            29685..30398
FT                   /locus_tag="SPP_0039"
FT   CDS_pept        29685..30398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0039"
FT                   /product="gp15"
FT                   /note="identified by match to protein family HMM PF02498"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20880"
FT                   /protein_id="ACO20880.1"
FT                   /translation="MNEIFNFHGQEVRTLIIDDEPWFVGKDVADILGYSKARNAIALHV
FT                   DEDDALKQGLTDNLGRVQETIIINESGLYSLILSSKLPQAKEFKRWVTSEVLPAIRKQG
FT                   GFIREDLDEDAFIALFTGQKKLREQQATMLEDIDYLKSEQPIHPSYAKSLLKKRKARVV
FT                   VCLGGIDSPAYADKTFAQSVFRQAEIDFKDHFNINRYDLLPKKFADAALAYWMTWEPST
FT                   NTKMKIMKLNSFDEG"
FT   gene            30411..30668
FT                   /locus_tag="SPP_0040"
FT   CDS_pept        30411..30668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0040"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21200"
FT                   /protein_id="ACO21200.1"
FT                   /translation="MDNVLLSLSEWIKSIIKDTITRLVEIEKDSDHYPELMDVNTTCDF
FT                   LGIKYATFSDNYRYLKGFPKELPGKKWSKRAIKEWLSNQI"
FT   gene            30754..31074
FT                   /locus_tag="SPP_0041"
FT   CDS_pept        30754..31074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21840"
FT                   /protein_id="ACO21840.1"
FT                   /translation="MFEPPILDQLMGVGALLLGFAGACRHIKLQEQRKEEERREEQEFA
FT                   SMIIQVRNHAYERGREDKWQEIRKNIRREFKGFTYDNEPPVGLRPEPLALPEPKQSAIR
FT                   FL"
FT   gene            31090..31386
FT                   /locus_tag="SPP_0042"
FT   CDS_pept        31090..31386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0042"
FT                   /product="gp18"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20587"
FT                   /protein_id="ACO20587.1"
FT                   /translation="MQELIESLDNLIMIVKELEGRESTSRHFITIWENDYKNLLRVKEY
FT                   LTDYEKLAKDYRYMTLKNKLLKIEKMELEGRYIYEDMRMKYRANRRKWGARYV"
FT   gene            31370..32206
FT                   /locus_tag="SPP_0043"
FT   CDS_pept        31370..32206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0043"
FT                   /product="gp19"
FT                   /note="identified by match to protein family HMM PF04271;
FT                   match to protein family HMM TIGR01446; match to protein
FT                   family HMM TIGR01714"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21175"
FT                   /protein_id="ACO21175.1"
FT                   /translation="MLGMSEIKWIKIKTDIFDDEKMCLIDASPDRDAIIVIWIKLITLA
FT                   GKLNTKGVLTISKNIVYTDEMLAQTFHRPLNTVRMALEVFEKFGMVEKIDGVIMLPNWE
FT                   KHQNIDGMEKIKEQNRNRAARHRQKQKLLAQNNESNVTDNVMDNVTVTHGNALDKELDK
FT                   DIEINNNKVMISSSLSENLKNSGIHLTDKSHQQLLDYVGLDGMSFDMLNRAVEKTSGSH
FT                   KPSFNYLIAILESWKKKGFTSIEQVDEDDRKYKEGKKSRQQNDKTSEQEVRDEWGF"
FT   gene            32194..32352
FT                   /locus_tag="SPP_0044"
FT   CDS_pept        32194..32352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0044"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21525"
FT                   /protein_id="ACO21525.1"
FT                   /translation="MGILELIEQFEIDYYPLSYEKKTLLADQPIHPVVACLSEMASWHE
FT                   CGGRLVW"
FT   gene            32475..33116
FT                   /locus_tag="SPP_0045"
FT   CDS_pept        32475..33116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0045"
FT                   /product="gp21"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20305"
FT                   /protein_id="ACO20305.1"
FT                   /translation="MCESERIHEENQERVNELANAENERERKYYLEKFSLYDEILKNAT
FT                   LDNFETPTEKEAEKLAFAKRICREWSEGARNNIVLQGEAGTGKSHLAFAMVKALSEYTK
FT                   EIAIFINVTDLLMKIKADFSQEEFLVNKIASAKFLVLDDLGMEKDSEWSFTILYNILNK
FT                   RSNTIITTNLISADIQKRYGRPFMSRLMKGVDKDHLMVFNDLTNKRKQYF"
FT   gene            33131..33325
FT                   /locus_tag="SPP_0046"
FT   CDS_pept        33131..33325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0046"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20545"
FT                   /protein_id="ACO20545.1"
FT                   /translation="MFILKHGTREDKPFLRSAIISVTGLDISCSEEKKAMRFISRAAAL
FT                   QVSKALRGSFGNFYPVEVE"
FT   gene            33325..33552
FT                   /locus_tag="SPP_0047"
FT   CDS_pept        33325..33552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22059"
FT                   /protein_id="ACO22059.1"
FT                   /translation="MLELYFVYNGHCKFFLGRFDNVDDLIEQMEDHQWAFSAITHPRFQ
FT                   KHIGQRTTRFDYGSKDCYYLATFSGGEKND"
FT   gene            33679..33846
FT                   /locus_tag="SPP_0048"
FT   CDS_pept        33679..33846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21460"
FT                   /protein_id="ACO21460.1"
FT                   /translation="MVGVTYQEIHLFVEFLKEQYGQGRPDYIEALNDLDGLVEVSYREA
FT                   IERFLEDEVR"
FT   gene            34014..34343
FT                   /locus_tag="SPP_0049"
FT   CDS_pept        34014..34343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0049"
FT                   /product="gp24"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20797"
FT                   /protein_id="ACO20797.1"
FT                   /translation="MMEELKQKVNEVYNWTVEDGKPQPPKQDLPQAVKDRADYFWEMAE
FT                   DGMTFMGAMECIFADEKPTDYDLGATKGWLPKSKEFDDWVGYSPSMSQLVIAVYLIYRG
FT                   SEDET"
FT   gene            34333..34758
FT                   /locus_tag="SPP_0050"
FT   CDS_pept        34333..34758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07852"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22062"
FT                   /protein_id="ACO22062.1"
FT                   /translation="MKLNELIKKYKKLEGVWNAEGAELVRQIFLQDLEQLDKPQPVKVP
FT                   QCVAEYIEFKKKNNFHVYGLAWLNGYEVEKEKRYFVKIKGNIKENMLVYGELLKRYFFT
FT                   KSFSLDDVIYSHTRKELEAANFGWVFDCPGIEIEEVE"
FT   gene            34758..35272
FT                   /pseudo
FT                   /locus_tag="SPP_0051"
FT                   /note="DNA N-4 cytosine methyltransferase M.NgoMXV,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error"
FT   gene            35314..35658
FT                   /locus_tag="SPP_0053"
FT   CDS_pept        35314..35658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR01671"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20614"
FT                   /protein_id="ACO20614.1"
FT                   /translation="MSVKCMFFQDSEIEEFELNDALMNDYITAYPDEIELMQSTGLKDK
FT                   NGKEVFIGDIVKCTRGCLHEVYLEKEYGGTFIGGMPAVYLKGLGDGYAWTEYEEIIGNI
FT                   YENPELLEDK"
FT   gene            35658..35894
FT                   /locus_tag="SPP_0054"
FT   CDS_pept        35658..35894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0054"
FT                   /product="gp29"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21845"
FT                   /protein_id="ACO21845.1"
FT                   /translation="MNPEIIDNINKPSHYQGANGLEAIDVVHNFVGSLSGASAFFWGNA
FT                   IKYMLRFQKKNGLEDLKKARKNLDWLIEEMEHE"
FT   gene            35906..36049
FT                   /locus_tag="SPP_0055"
FT   CDS_pept        35906..36049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0055"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21541"
FT                   /protein_id="ACO21541.1"
FT                   /translation="MKATPLLPWGRLRKSAKKQELLNGASISEFAIEDICTFFGIEIQE
FT                   RK"
FT   gene            36851..37393
FT                   /locus_tag="SPP_0056"
FT   CDS_pept        36851..37393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0056"
FT                   /product="prophage LambdaSa2, site-specific recombinase,
FT                   phage integrase family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20379"
FT                   /protein_id="ACO20379.1"
FT                   /translation="MEFVSPIKDNDNIQAMKDYLREWNEMYYMLFITGLNTGLRVGDIL
FT                   TLKVKDVQGWHIKLRERKTGKQITRRMTKELKKEMRRYVEGKPFHHFLFKSRQGQNKAI
FT                   TRERAYQIIHEAAEELGIDNVGTHTMRKTFGYKYYNKTKDVGTLQKMFNHSSPAITLRY
FT                   IGIEQAELDDALRNFVI"
FT   gene            37557..37748
FT                   /locus_tag="SPP_0057"
FT   CDS_pept        37557..37748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0057"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20417"
FT                   /protein_id="ACO20417.1"
FT                   /translation="MVKEYRDDFLGEKAFEKLNKDIDANPEVGFEIVGYTQTAFVNGMH
FT                   IPLTAILVKWNNFFKESE"
FT   gene            37868..38188
FT                   /locus_tag="SPP_0058"
FT   CDS_pept        37868..38188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22052"
FT                   /protein_id="ACO22052.1"
FT                   /translation="MYNKPIRPSLKSKKWEKFRDRIMRKHDYLCQESLRYGISVQAEMV
FT                   HHIFPVSEYPELEFVEWNCLPLTNKKHNTFHDRVNDRVINQGLYWQKKRKKEFLNFFKN
FT                   EK"
FT   gene            38326..38718
FT                   /locus_tag="SPP_0059"
FT   CDS_pept        38326..38718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21611"
FT                   /protein_id="ACO21611.1"
FT                   /translation="MAKPITAKSIKSKVVKQMKDLGTYRKEFEMIIDIFAGMLYQYQKL
FT                   AQDYADMGYPVTDTYVNKAGAENERKVPILTAMEILRKDILSYSNQLMMNPKSLGEVVE
FT                   QEGESVLTEVLKFKNEIKKKRVTGNG"
FT   gene            38711..40441
FT                   /locus_tag="SPP_0060"
FT   CDS_pept        38711..40441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0060"
FT                   /product="putative phage terminase, large subunit"
FT                   /note="identified by match to protein family HMM PF03354"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21140"
FT                   /protein_id="ACO21140.1"
FT                   /translation="MGNLDKAKKYAQHVLTHREEHCEENILAAERFFRDLENPTFEMDE
FT                   DMVDFVIHFIENVIVHQQGDDMFAVSIRNKPLLLQPWQHFVVVNLFGFYYKGTNERRFK
FT                   EALIMLARKNGKTSFTAAIALAYQILDTDSGSKCYIVANSVKQAMEAFGFLRFNVERWN
FT                   DKNIRIKDNNQEHSITANFGDEGSFFIQALANDESRLDSLNGNVIILDEAHTMRNSKKH
FT                   GLMKKTMSAYRNSMLFVISTAGDIPTGFLANRLKYCQKVLKQLVTDDSFFIFICKANQS
FT                   ADGDVVNYLDENILKMANPSWGVTVSLKALKEEAEQAMNDPQTRNEFFNKTLNIFTNSM
FT                   NAYFNPDEFIASDSCYDWSLEELARLPIRWYGGADLSRLHDLTAAALYGVYHDGEKDVD
FT                   ICITHAFFPRINAQKKANDDGIPLFGWQSDGWLTMSNTPTVLYDDIVKWFIKMREKGFK
FT                   IAAVGMDRKFGREFLTKMKQARFKMIDQPQLFYLKSEGFRRIEFKVKNKEFYYLHSDAY
FT                   EYCVSNVRAIEKVDDAVQYEKLDGDGGTARIDLFDASVFACIQALANLGKGGDVMRFFD
FT                   "
FT   gene            40449..40667
FT                   /locus_tag="SPP_0061"
FT   CDS_pept        40449..40667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0061"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20406"
FT                   /protein_id="ACO20406.1"
FT                   /translation="MNEIVLSEHEINLLINKGRVKVILNGEVVTIRQRHMKNLMAETVK
FT                   WEKQVIDVSQNIVRNKHFDSLFQNTFR"
FT   gene            40685..41887
FT                   /locus_tag="SPP_0062"
FT   CDS_pept        40685..41887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0062"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="identified by match to protein family HMM PF04860;
FT                   match to protein family HMM TIGR01537"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21789"
FT                   /protein_id="ACO21789.1"
FT                   /translation="MGIFEKFWKRNKPSKSINMLSHSDLGLSNLMDSYVPLARNPDVVT
FT                   AVNKIADLVSNMTIHLMENTDKGDIRIRDGLARKIDINPCKHMTRKSWIFKIVRDLLLY
FT                   GDGNSVLHVEYEPVTDYISNLRPFPMREVSFQTDKDSYVISFRGEEYSPDEVVHFVINP
FT                   DPDIPYIGTGFRVTLTDVVQSLNMATKTKKSFMNGKNIPSLIVKVDSSSAELDSEQGRE
FT                   RIAEKYLSTSRVGAPWIVPEALLDIQQVKPLSLTDIALNESVELDKRTVAGLLGVPAFI
FT                   LGVGEFNKTEYNNFVNTTVMSIATTITQTLTRDLLLSSNRYFKLNPRSLFSYNITELSA
FT                   VAQQMANSAAMRRNEWRDWLGMAPDPEMEELIVLENFLPQEKLGDQNKLKGGEEENAKA
FT                   K"
FT   gene            41871..42446
FT                   /locus_tag="SPP_0063"
FT   CDS_pept        41871..42446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0063"
FT                   /product="phage prohead protease, HK97 family"
FT                   /note="identified by match to protein family HMM PF04586;
FT                   match to protein family HMM TIGR01543"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22086"
FT                   /protein_id="ACO22086.1"
FT                   /translation="MQKRNSYRATQFQTREEESGDLILSGYFIKFDEETELWPGYCEVI
FT                   KRAGVEKAVTDADIRALFNHDDSLVLGRTGNGTLTLGVDDVGLFGDIIINKDDPQAVGA
FT                   YARVKRGDVIGCSFGFIPVKIETEEREDGSYLDTVLELEIFEVSPCTFPAYPQTEIAAR
FT                   QKDFESQKRANREALDKRKKEIKEKFNL"
FT   gene            42443..43615
FT                   /locus_tag="SPP_0064"
FT   CDS_pept        42443..43615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0064"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="identified by match to protein family HMM PF05065;
FT                   match to protein family HMM TIGR01554"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20866"
FT                   /protein_id="ACO20866.1"
FT                   /translation="MNKLLILGARMRNKADKVVELEESIKELNKRSELEAKKLEQAGTD
FT                   EEVSAVEKNLEDIQKESDEKEAEKEQLEKEIEDLKNQVEELNRKAPTYPSQEKRGGQKL
FT                   ERRDAIAKYIRTGQTRDIVGLKTTDSGSAALIPTEVLKPHFVNKTRNPLLDLVERVKVN
FT                   SGSGKYPVIKKTDGVMVSIDELKSNPELGKPAISEIDYSIKTYRGYVPVSQEMIDDADY
FT                   DIMSIVEDEVFNQGDNTELSLVTAVLKTATQADAAGFDGIKDIYNKKLKSIYKASIVVT
FT                   KSMFAALDKVKDKDGRYMLQTDVASPTGYSFGGKTIYKVDDTVFGNEGDMKFFIGDVTE
FT                   FVKEFDRSQVSVKWVNNDIYGQLLGLFIRLDIKKADEEAGFFGTYTDVVA"
FT   gene            43627..43917
FT                   /locus_tag="SPP_0065"
FT   CDS_pept        43627..43917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21091"
FT                   /protein_id="ACO21091.1"
FT                   /translation="MSYKVIRPFKDLADPENHDYAVGDIFPREGYEPTDSFTNGLLTGA
FT                   NTAGSIFLEVLGDDEPKKPAPETKEVKEEPAVEQEETVEETAEESAEEVEE"
FT   gene            43920..44201
FT                   /locus_tag="SPP_0066"
FT   CDS_pept        43920..44201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21545"
FT                   /protein_id="ACO21545.1"
FT                   /translation="MDQGQLLELLKLKLGISTDLRDKPLKKIISSVITELTDNLGIELV
FT                   GERADHEMFIVDYAAYRYEGGVDMPRHLQWRLHNLQIASKKEVKNVES"
FT   gene            44188..44487
FT                   /locus_tag="SPP_0067"
FT   CDS_pept        44188..44487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0067"
FT                   /product="phage head-tail adaptor, putative"
FT                   /note="identified by match to protein family HMM TIGR01563"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22213"
FT                   /protein_id="ACO22213.1"
FT                   /translation="MWNHEITLISKKVTGKDKLLQPISEDVEVTLLCRKKRVTRSEFYQ
FT                   ANQVGLKPSLVVEIRNFEYENQELAKFEGKQYHILKTYPIDSEILELTLSEVLK"
FT   gene            44484..44831
FT                   /locus_tag="SPP_0068"
FT   CDS_pept        44484..44831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0068"
FT                   /product="prophage pi2 protein 37"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20594"
FT                   /protein_id="ACO20594.1"
FT                   /translation="MSNDLADLIAKELAAYSDEVTEEVDKIAEQVTDETVDELKETSPK
FT                   RYGKYRRSWKKKKLANGSFVVFNAVASLTHILENGHLSRNGGRVAGIVHIKPAEEKAIQ
FT                   NFEKRIKEIGK"
FT   gene            44828..45151
FT                   /locus_tag="SPP_0069"
FT   CDS_pept        44828..45151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21360"
FT                   /protein_id="ACO21360.1"
FT                   /translation="MKLSDFAAILEQANLPVTYRAFKIGNAPDLPYLVYYESSPVINSA
FT                   DNTVNHQIKSVTVELAFESKDEDLEERLEELWANHKLFFEVQEETFIETERLYVKSYTV
FT                   YLY"
FT   gene            45163..45741
FT                   /locus_tag="SPP_0070"
FT   CDS_pept        45163..45741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0070"
FT                   /product="prophage pi2 protein 39"
FT                   /note="identified by match to protein family HMM TIGR01603"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20156"
FT                   /protein_id="ACO20156.1"
FT                   /translation="MTQENKVTFGLENVHIAPIKTLAADGVITYGDVFRFPGAIELILD
FT                   TKGETTPIKADNKDYHFMNSNEGYEGKLKIPHIIDEFATKILGEIKDPQTGVMTEKADA
FT                   SLTEFAMMFQFEGDKNKTRYVMYYCFASRPSLGSKTKNGTSTNERELSFKASPRPLDTV
FT                   VKRSITSADDKDAYDNWFKKVYEPTAVAA"
FT   gene            45753..46172
FT                   /locus_tag="SPP_0071"
FT   CDS_pept        45753..46172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0071"
FT                   /product="prophage pi2 protein 40"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20726"
FT                   /protein_id="ACO20726.1"
FT                   /translation="MRKIVLVGDQEYELGTNGYTPIAYKQQFGKDYFQDLFSMLKNQSF
FT                   MNELNKLETDKELTATNIDISMLSDFDMTFFNRLFWTFAKSANPHIKPYEQFFMEMEIF
FT                   PIQEVGPVLMEMLNASMTTKKHQMSQNQLAKKSSQ"
FT   gene            46450..49209
FT                   /locus_tag="SPP_0072"
FT   CDS_pept        46450..49209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0072"
FT                   /product="prophage LambdaSa04, tail tape measure protein,
FT                   family"
FT                   /note="identified by match to protein family HMM PF05017"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21310"
FT                   /protein_id="ACO21310.1"
FT                   /translation="MAGNIKGIKIEIDGDTQPLQKALKNVNKAATDASQELRQIDKALK
FT                   FDTGNVTLLTQKQEVLQKQVSTTKEKLETLRQAQSQVEQQFKNGDIGADQYRAFQREVE
FT                   VTQNVLKGYEGKLANVNQALNENGSATQNNKNQLKELQNEQSQLASEMSKVTSSFKLQE
FT                   SALGSNASEAERNALAQKKIGAQSEIVSKQISNLEQQLEITKKEFGENSTQANKMESEL
FT                   NQAKTAFNHLNDEMKGTKSAADSTQESLSEISRNLRAELLQQFSEKLSAISEKLVEVGK
FT                   EALEAAAQMQASNAQFTTVFGDMETQAREALNAIGQEMDIVPERLQGSFTQMASFAKTS
FT                   GLDTAQALDLTSRATRAAADGAAFYDKSIESVSESLQSFLKGNFANDAALGISATETTR
FT                   NAAANKLYGKSFKDLSEAQKQLTLLQMVEDGNKLSGALGQAARESDGLENVMGNLKQAG
FT                   TNALSAIGQPLLEMMIPVFQTLATIVKGVAELFNSLPDPVKDFVVILGTVVTAVGVIAP
FT                   IFLTLQALAEFLKISIGEMIIAALPIIGTAIAIAAAVAAIIVIVKYLWETNEGFRDAVT
FT                   TVWNAILAVINTVVSEISDFIMSIFGTVVTWWTENQELIRTSAETVWNAIYTVISTILD
FT                   ILGPLLQAGWDNIQLIITTTWEIIKIVVETAINVVLGVIQAVMQIITGDWSGAWETIKG
FT                   VFSTVWQAIQSIVQTIFSAIQSYISNILNGISGTVSNIWNSIKDTVSNVLNAISSTVSS
FT                   VWEGIKSTISSAINGARDAVSSAIEAIKGLFNFNISWPHIPLPHFYVSGSANPLDWLSQ
FT                   GVPSIGIEWYAKGGIMTKPTIFGMNGNNIMVGGEAGNEAVLPLNDKTLGAIGRGIAQTM
FT                   GGTSPTINITITGNTVREEADISRIADEVAQRIADELQRRRQLRGGFA"
FT   gene            49206..49928
FT                   /locus_tag="SPP_0073"
FT   CDS_pept        49206..49928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22198"
FT                   /protein_id="ACO22198.1"
FT                   /translation="MIKHNELVIDGVRTSSFPFKIIVHDSPSIALGESKTALLEHGGVS
FT                   GAIVQTNKHRELVKKTYTIYLVKPTEEQMNQFMSLFIREKFWLESERVKTTRLWCYKVN
FT                   VSDLEEVQPGLYMTKATFTCHPTKYFKDSDTQRLTRSGTLTVQGSALAFPKITIVGQSA
FT                   SETSFTIAGQVIRLERLTESLVMVNNPDNPSFKTTTGKPVKWSGDFITVDPAKVKNIGV
FT                   VLGPGIQSIEIETVWGWA"
FT   gene            49929..53150
FT                   /locus_tag="SPP_0074"
FT   CDS_pept        49929..53150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0074"
FT                   /product="host specificity protein"
FT                   /note="identified by match to protein family HMM TIGR01665"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22172"
FT                   /protein_id="ACO22172.1"
FT                   /translation="MLYLLNKDVRTVRWNGEPLHEATSAIVKETMNGDFTLTVKYPISD
FT                   SGIYQLIQEDMLIKAPTPVLGAQLFRIKKPVEHNDHLEITAYHISDDVMQRSITQMSVT
FT                   SQSCGMALARMVQNTKTALGDFSFNSDIQDRRTFNTTETETLYSVLLDGKHSIAGTWEG
FT                   ELVRDNFAMTVKKSRGENRGVVITTHKNLKDYQRTKNSQNVVTRIHARSTFKPEGAEKE
FT                   TTIRVTVDSPLINSYPYINEKEYENNNAKSVEELQKWAQSKFSNEGIDKVSDAIKIEAY
FT                   ELDGQVVHMGDTVNLKSWKHNVDAFKKAIAYEFDALKEEYISLTFDDKAGIGGSRSSGG
FT                   LSSAADAILGVTESAQEIALEKALQNADLDFDHKAGLLRQEISDDIELAKARAEEVKRE
FT                   LSDTINQRFNSFDNGPLKETKRKAEEALRNAGASTLLAQEAKRIGLDSVARLEAFKSQT
FT                   TSAQTALSGDLDALKRTIANDIRPKQAQAEAEIAKQAEALSRTKNELAGASTLLAQEAK
FT                   RIELDSVARLEAFKSQTTSAQTALSGDLDVLKQTIANDIRPKQAQAEAEIAKQVEALSR
FT                   TKNELAGVKSAQATYKETTTRRLSELTNLANGKASKSELTQTAEELASRIASVQAGSSR
FT                   NYFRNSRSRTFTTGGQAVYDYRTFIVPDFWKNSDRFKRDYVRISFDVTFPVALVNDMPA
FT                   MVHFSAHPWYAYRNLIFKGGTVERQHFEFTIDLSSSSEDYQTNNVFIRFGTNYGFPAGL
FT                   QVVIENAMLSVGNYFPAYQPAYEDQEDRVSVVESNFKQRADSLDAGVRSLTEGLRTKAD
FT                   ISSLNVTAENIRQSVKSLETDTQNKLNQKLSQAEFEVRAGSIRQEILNATKDKASKSEL
FT                   TQTAEELASRIASVQASGRNLFLNSLFKQDIPKTGIWTTSTYTATIDSESKYLGHKALK
FT                   IIGLNPSGRDGGNPKVTYPALGQFGKVIPGSTTNQDVTISFYAKANKNGIMLRSRLGNI
FT                   GYKTGNVTLSTEIKRYVVHIPKGWTNESKQTTNEWLFNFNQEGTIWIWMPKFEISDVDT
FT                   SYSEAPEDIEGQISTVESTFKQRAN"
FT   gene            53196..55844
FT                   /locus_tag="SPP_0075"
FT   CDS_pept        53196..55844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0075"
FT                   /product="PblB"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20432"
FT                   /protein_id="ACO20432.1"
FT                   /translation="MDISSLNVTAENIRQSVKSLETDTQNKLNQKLSQAEFEVRASGIR
FT                   QEILNATKDKADKTLVTAEAGKLREELTSLSVGENLFVNSDFKNLRDNGQRYTANGKTY
FT                   QNMIAPYWYNPYNAGIPNAQNIQHGYFDTETFSDTVFAFNESDGSRHWKALSTDFKIGV
FT                   ISAGEYYFSADLYATDLGTHIKFGFYYHNSTGKLNFYAGRTKIEVTEKGRWTRLGIDLK
FT                   VNDDIDLTKKVQFYIYGYNFASNSILYLKKPKVSKGRLKSDWSPALEDTEGLITEAKAT
FT                   FERTAQGLRTDLSAIQEYVNKDGQRQEALQRYTREESTRQATAVRELVNRDFVGKATYQ
FT                   EDVKGINQRIEAVKTSANKDIASQIASYRQSVDGKFTDISSQITTYKQDVGGQISGLSN
FT                   RLTSSEQGTTTQISNISNRINSNKQGTDNQISNLKTQVATNKDNAERQMGRISDQVSAN
FT                   KANADSQFANVTNQLARKVETTDFQRVKETSKLYERILGNTENGIADKVARMALTNQLF
FT                   QVEVGKYSVSGPNLIKNSDFKNGTNEWGSTQNLGRLVKHSFYHNGQKDLMRLSNATKNE
FT                   NFLYSHRFNLERNTDYVLNFRGFNNSALASYDVYILGRRAGESDGFTIVKKVVSSKKLS
FT                   TSRCEDVSVTFNSGEMDNAYIRFDNNGSSSGTADLYITEVDLYKGYKPRTWQPHPEDAV
FT                   ADANKKLEATQTKMTQLAGSWVVENINSAGDIISGINLGANGHNRFVGKLTHITGETLI
FT                   DRAVIKSAMVDKLKTANFEAGSVTTTILDAEAVTADKVRFDAAFIRKMIANDAFIDQLT
FT                   SKRIFSTKVESVISSSTFLEAYQGRIGGFTLGQFDQGGGRWISGVNQFSVGMGNGAGHG
FT                   VPDSLLGELGK"
FT   gene            55993..56415
FT                   /locus_tag="SPP_0076"
FT   CDS_pept        55993..56415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0076"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20474"
FT                   /protein_id="ACO20474.1"
FT                   /translation="MFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWMEQK
FT                   SDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRDPE
FT                   NPDGYLHIDYTALVPYLIKAIQELNQKIEKMEKTIA"
FT   gene            56412..56528
FT                   /locus_tag="SPP_0077"
FT   CDS_pept        56412..56528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0077"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21875"
FT                   /protein_id="ACO21875.1"
FT                   /translation="MNNNMLTNIALKAIQEFALENRKRTHRLENLENEHRTA"
FT   gene            56509..56712
FT                   /locus_tag="SPP_0078"
FT   CDS_pept        56509..56712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21703"
FT                   /protein_id="ACO21703.1"
FT                   /translation="MNTEQLNQALQMTIREMSTTSTDSMIASNFLSIQLNEQREENQRL
FT                   QARVDELEALLDEQTKPADKGE"
FT   gene            56715..56975
FT                   /locus_tag="SPP_0079"
FT   CDS_pept        56715..56975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0079"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20957"
FT                   /protein_id="ACO20957.1"
FT                   /translation="MAETIQNTDNLLDLTKITEPFDLASALRYMKENGEFIRCKNVSDD
FT                   FYMYRDVQKRPVIVNGRRQFKDVETVWAFNQWGGVQSQQST"
FT   gene            56927..57067
FT                   /locus_tag="SPP_0080"
FT   CDS_pept        56927..57067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21484"
FT                   /protein_id="ACO21484.1"
FT                   /translation="MGVQPVGGGTITTINVAVLLNHEFYIMKFDAEGNPDWTDPTVKPK
FT                   E"
FT   gene            57077..57493
FT                   /locus_tag="SPP_0081"
FT   CDS_pept        57077..57493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0081"
FT                   /product="putative holin 1"
FT                   /note="identified by match to protein family HMM PF05105;
FT                   match to protein family HMM TIGR01593"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21150"
FT                   /protein_id="ACO21150.1"
FT                   /translation="MQIEFFNFLRSVVQTEDGLVLYALALIVSMEIIDFVTGTIAAIIN
FT                   PDIEYKSKIGINGLLRKISGVLLLMILIPASVLLPEKTGFVFLHSIYLGYIAFTFQSLI
FT                   ENYRKLKGNVTLFQPIVKVFQRLLEKDDDTKKGE"
FT   gene            57497..57832
FT                   /locus_tag="SPP_0082"
FT   CDS_pept        57497..57832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0082"
FT                   /product="phage holin, LL-H family"
FT                   /note="identified by match to protein family HMM TIGR01673"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20561"
FT                   /protein_id="ACO20561.1"
FT                   /translation="MQQITEIITNGAISILVILAGVVVRVVKEYLVKKGGEKTIKIVEI
FT                   LAKNAVNAVEQVAAETGYKGDEKLAQARAKIRAELTKYNISMTDKDLDTFVESAVKQMN
FT                   DAWKGQE"
FT   gene            57832..58788
FT                   /locus_tag="SPP_0083"
FT   CDS_pept        57832..58788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0083"
FT                   /product="lytic amidase (N-acetylmuramoyl-L-alanine
FT                   amidase)"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01473;
FT                   match to protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20216"
FT                   /protein_id="ACO20216.1"
FT                   /translation="MDIDRNRLRTGLPQVGVQPYRQVHAHSTGNRNSTAQNEADYHYRK
FT                   DPELGFFSHVVGNGRIMQVGPVNNGSWDVGGGWNAESYAAVELIESHSTKEEFMADYRL
FT                   YIELLRNLADEAGLPKTLDTGSLAGIKTHEYCTNNQPNNHSDHVDPYPYLASWGISREQ
FT                   FKQDIENGLSAATGWQKNGTGYWYVHSDGSYPKDKFEKINGTWYYFDGSGYMLSDRWKK
FT                   HTDGNWYYFDQSGEMATGWKKIAEKWYYFDVEGAMKTGWVKYKDTWYYLDAKEGAMVSN
FT                   AFIQSADGTGWYYLKPDGTLADKPDFTVEPDGLITVK"
FT   gene            complement(59058..59237)
FT                   /locus_tag="SPP_0084"
FT   CDS_pept        complement(59058..59237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21954"
FT                   /protein_id="ACO21954.1"
FT                   /translation="MREVIQELLDSSMSTSAISQGAGVPWTTVSDLRKGKTSMDKMALL
FT                   TAEKLYEFATTDKQ"
FT   gene            59810..60277
FT                   /locus_tag="SPP_0085"
FT   CDS_pept        59810..60277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0085"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21257"
FT                   /protein_id="ACO21257.1"
FT                   /translation="MYYTLEEKEVFMREALREAEIALEHDEIPIGCVIVKDGEIIGRGH
FT                   NAREELQRAVMHAEIMAIEDANLSEESWRLLDCTLFVTIEPCVMCSGAIGLARIPNVVY
FT                   GAKNQKFGAAGSLYNILTDERLNHRVEVEIGILEDECAAIMQDFFRNRRKK"
FT   gene            60313..60403
FT                   /gene="srpB"
FT                   /locus_tag="SPP_2297"
FT   ncRNA           60313..60403
FT                   /gene="srpB"
FT                   /locus_tag="SPP_2297"
FT                   /product="bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            60464..60907
FT                   /locus_tag="SPP_0086"
FT   CDS_pept        60464..60907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0086"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   (dUTPase) (dUTP pyrophosphatase)"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by match to protein family HMM PF00692"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20839"
FT                   /protein_id="ACO20839.1"
FT                   /translation="MKIRGFELVSSFTDENLLPKRETAHAAGYDLKVAVRTVVAPGEIV
FT                   LVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKN
FT                   ITDQEVVLEVGERIVQAVFATFLIADGDAADGVRTGGFGSTGH"
FT   gene            60867..61424
FT                   /locus_tag="SPP_0087"
FT   CDS_pept        60867..61424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0087"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20387"
FT                   /protein_id="ACO20387.1"
FT                   /translation="MAFELVDLDRQGTRMKIIFVRHGEPDYRELEERSYIGFGIDLAPL
FT                   SEMGRQQVQKLSKNPLLSSAEIIVSSAVTRALETASYVVCATGLPLRVEPLLHEWQVYK
FT                   TGIENFETARRLFLENKGELLPNSPIQYETATEMKSRFLECMSKYREHQTVVVVAHRML
FT                   MRQFVPNEKIDFCQVIECELEI"
FT   gene            61537..62799
FT                   /gene="radA"
FT                   /locus_tag="SPP_0088"
FT   CDS_pept        61537..62799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SPP_0088"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21772"
FT                   /protein_id="ACO21772.1"
FT                   /translation="MEEVEVAEVKNARVSLTGEKTKPMKLAEVTSINVNRTKTEMEEFN
FT                   RVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQVGTVLYVSGEESAQQIKLRAERL
FT                   GDIDSEFYLYAETNMQSVRAEVERIQPDFFIIDSIQTIMSPEISGVQGSVSQVREVTAE
FT                   LMQLAKTNNIAIFIVGHVTKEGTLAGPRMLEHMVDTVLYFEGERHHTFRILRAVKNRFG
FT                   STNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPT
FT                   MFGNAKRTTTGLDFNRASLIMAVLEKRAGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVA
FT                   IASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGITL
FT                   PKEIQVIGVTTIQEVLKKVFA"
FT   gene            62872..63369
FT                   /locus_tag="SPP_0089"
FT   CDS_pept        62872..63369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0089"
FT                   /product="carbonate dehydratase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20778"
FT                   /protein_id="ACO20778.1"
FT                   /translation="MSYFEQFMQANQAYVALHGQLNLPLKPKTRVAIVTCMDSRLHVAQ
FT                   ALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGTREIVVLHHTDCGAQTFENEPFQE
FT                   YLKEELGVDVSDQDFLPFQDIEESVREDMQLLIESPLIPDDVIISGAIYNVDTGSMTVV
FT                   EL"
FT   gene            63394..63588
FT                   /locus_tag="SPP_0090"
FT   CDS_pept        63394..63588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20766"
FT                   /protein_id="ACO20766.1"
FT                   /translation="MKKSSILLLCIGLQYETIYYTDGSRSGAEYGLMGISIFLALFYMI
FT                   PALYFLFRIGKNGNCQRRF"
FT   gene            63570..64193
FT                   /locus_tag="SPP_0091"
FT   CDS_pept        63570..64193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0091"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20205"
FT                   /protein_id="ACO20205.1"
FT                   /translation="MPKKVLILSLLGGMFLSGWLSSFANTYIHDLLGVLFPDSTFLNAF
FT                   ESAIVAPLVEEPLKLLPLVFVLALIPVRKLKSLFLLGIASGLGFQMIEDIGYIRTDLPE
FT                   GFDFTISRILERIISGIASHWTFSGLAVVGVYLLYRAYKGQKVGKKQGLIFLGLALGTH
FT                   FLFNSPFVELETELPLAIPVVTAIALYGFYHAYCFVEKHNELMT"
FT   gene            64338..65306
FT                   /locus_tag="SPP_0092"
FT   CDS_pept        64338..65306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0092"
FT                   /product="ribose-Phosphate pyrophosphokinase (rppk)
FT                   (phosphoribosylpyrophosphate synthetase) (p-rib-pp
FT                   synthetase) (prpp synthetase)"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21969"
FT                   /protein_id="ACO21969.1"
FT                   /translation="MSFSDLKLFALSSNKELAERVAQEIGIELGKSSVRQFSDGEIQVN
FT                   IEESIRGKHVFILQSTSSPVNDNLLEILIMVDALKRASAESVNVVMPYYGYARQDRKAR
FT                   AREPITSKLVANMLEVAGVDRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERRGMV
FT                   GSDYVVVSPDHGGVTRARKLAEFLKTSIAIIDKRRSVDKMNTSEVMNIIGKVEGKTCIL
FT                   IDDMIDTAGTICHAADALAEAGAVEVYASCTHPVLSGPATDNIQKSAIKKLVVLDTIYL
FT                   PEERLIDKIEQISIAHLLGDAIVRIHEKRPLSPLFDIEKKI"
FT   gene            complement(65848..66081)
FT                   /locus_tag="SPP_0093"
FT   CDS_pept        complement(65848..66081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21026"
FT                   /protein_id="ACO21026.1"
FT                   /translation="MFSQLRMREEQALLAQDYALETARAGGIEQGLERGKVEGREERKL
FT                   FAFLDIVRQDLLTSEVASQQLGMSVSEFEALL"
FT   gene            complement(66405..66719)
FT                   /locus_tag="SPP_0094"
FT   CDS_pept        complement(66405..66719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22178"
FT                   /protein_id="ACO22178.1"
FT                   /translation="MIAKKIFSNPEITCQFIRDMLDLPAKNVTILEGSDIHVLLSMPYS
FT                   VQDFYTSIDVLAELDNGTQVIIEIQVHHQNFFINHLWAYLCSQVNQNLEKIRQREGDTH
FT                   "
FT   gene            67011..69644
FT                   /locus_tag="SPP_0095"
FT   CDS_pept        67011..69644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0095"
FT                   /product="DNA polymerase I (POL I)"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00476;
FT                   match to protein family HMM PF01367; match to protein
FT                   family HMM PF02739; match to protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21644"
FT                   /protein_id="ACO21644.1"
FT                   /translation="MDKKKLLLIDGSSVAFRAFFALYQQLDRFKNAAGLHTNAIYGFQL
FT                   MLSHLLERVEPSHILVAFDAGKTTFRTEMYADYKGGRAKTPDEFREQFPFIRELLDHMG
FT                   IRHYELAQYEADDIIGTLDKLAEQDGFDITIVSGDKDLIQLTDEHTVVEISKKGVAEFE
FT                   AFTPDYLMEEMGLTPAQFIDLKALMGDKSDNIPGVTKVGEKTGIKLLLEHGSLEGIYEN
FT                   IDGMKTSKMKENLINDKEQAFLSKTLATIDTKAPIAIGLEDLVYSGPDVENLGKFYDEM
FT                   GFKQLKQALNVSSADVSESLDFTIVDQISQDMLSEESIFHFELFGENYHTDNLVGFAWS
FT                   CGDKLYATDKLELLQDPIFKDFLEKTSLRVYDFKKVKVLLQRFGVDLQAPAFDIRLAKY
FT                   LLSTVEDNEIATIASLYGQTYLVDDETFYGKGVKKAIPEREKFLEHLACKLAVLVETEP
FT                   ILLEKLSENGQLELLYDMEQPLAFVLAKMEIAGIMVKKETLLEMQAENELVIEKLTQEI
FT                   YELAGEEFNVNSPKQLGVLLFEKLGLPLEYTKKTKTGYSTAVDVLERLAPIAPIVKKIL
FT                   DYRQIAKIQSTYVIGLQDWILADGKIHTRYMQDLTQTGRLSSVDPNLQNIPARLEQGRL
FT                   IRKAFVPEWEDSVLLSSDYSQIELRVLAHISKDEHLIKAFQEGADIHTSTAMRVFGIER
FT                   PDNVTANDRRNAKAVNFGVVYGISDFGLSNNLGISRKEAKAYIDTYFERFPGIKNYMDE
FT                   VVREARDKGYVETLFKRRRELPDINSRNFNIRGFAERTAINSPIQGSAADILKIAMIQL
FT                   DKALVAGGYQTKMLLQVHDEIVLEVPKSELVEMKKLVKQTMEEAIQLSVPLIADENEGA
FT                   TWYEAK"
FT   gene            69729..70166
FT                   /locus_tag="SPP_0096"
FT   CDS_pept        69729..70166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0096"
FT                   /product="CoA binding protein"
FT                   /note="identified by match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20997"
FT                   /protein_id="ACO20997.1"
FT                   /translation="MSQEFINPSDGVIRQYLATSKTLAVVGLSDREETTSNRVTKEMQA
FT                   RGYKIIPVNPKAAGGEILGEKAYASLAEIPFPVDIVNVYRRSEFLPDVARDFLKADAKI
FT                   FWAQLGLESLKAKEILRDGGCDDIVMNRCIKREHTRLIEEA"
FT   gene            70207..70500
FT                   /locus_tag="SPP_0097"
FT   CDS_pept        70207..70500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0097"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21339"
FT                   /protein_id="ACO21339.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVVDRTDEVSSKHRFEVVDRTDEVSS
FT                   KHRFEVVDRTDEVSSKHRFEVVDRTDEVSSKHRFEVVDRTDEVSNIYTARRR"
FT   gene            complement(70529..71539)
FT                   /locus_tag="SPP_0098"
FT   CDS_pept        complement(70529..71539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0098"
FT                   /product="membrane protein Spr0034"
FT                   /note="identified by match to protein family HMM PF03601"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21768"
FT                   /protein_id="ACO21768.1"
FT                   /translation="MSFLSKNGAGILVCLLISIVSWYLGGFFPVIGAPVFAIFMGMLLH
FT                   PFLSSYKQLDAGLTFSSKKLLQYAVILLGFGLNISQVFAVGQSSLPVILSTISIALIVA
FT                   YLFQRFFALDTKLATLIGVGSSICGGSAIAATAPVIHAKEKEVAQAISVIFFFNVLAAL
FT                   IFPTLGTWLHLSNDGFALFAGTAVNDTSSVTATASAWDSLYQTNALESATIVKLTRTLA
FT                   IIPITIFLSYWQSREQKNKQGLQLKKVFPLFILYFILASLLTTLLTSLGVSSSFFTPLK
FT                   QLSKFLIIMAMSAIGLKTNLVAMVKSSGKSIVLGAVCWIAIILTSLGMQTLIGIF"
FT   gene            71688..72857
FT                   /locus_tag="SPP_0099"
FT   CDS_pept        71688..72857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0099"
FT                   /product="putative aminotransferase A"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20375"
FT                   /protein_id="ACO20375.1"
FT                   /translation="MDLTKRFNKQLDKIQVSLIRQFDQAISEIPGVLRLTLGEPDFTTP
FT                   DHVKEAAKRAIDQNQSYYTGMSGLLTLRQAASDFVKEKYQLDYAPENEILVTIGATEAL
FT                   SATLTAILEEGDKVLLPAPAYPGYEPIVNLVGAEIVEIDTTENGFVLTPEMLEKAILEQ
FT                   GDKLKVVILNYPANPTGITYSREQLETLAAVLRKYEIFVVCDEVYSELTYTGEAHVSLG
FT                   TMLRDQTIIINGLSKSHAMTGWRLGLIFAPATFTAQLIKSHQYLVTAANTMAQHAAVEA
FT                   LTAGKNDAEPMKKEYIQRRDYIIEKMTALGFEIIKPDGAFYIFAKIPAGYNQDSFAFLK
FT                   DFAQKKAVAFIPGAAFGRYGEGYVRLSYAASMETIKEAMKRLEEYMREA"
FT   gene            72854..73624
FT                   /gene="recO"
FT                   /locus_tag="SPP_0100"
FT   CDS_pept        72854..73624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="SPP_0100"
FT                   /product="DNA repair protein RecO"
FT                   /note="identified by match to protein family HMM PF02565;
FT                   match to protein family HMM TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20279"
FT                   /protein_id="ACO20279.1"
FT                   /translation="MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKRMFFVKHAGQSK
FT                   LAPVIQPLVLARFLLRINDDGLSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQ
FT                   DNQQDAPLFAFLQKTLELMEAGLDYQVLTNIFEIQILTRFGISLNFNECVFCHRVGQAF
FT                   DFSFKYGACLCPEHYHEDKRRCHLNPNIPYLLNQFQAIDFETLETISLKPGIKQELRQF
FT                   MDQLYEEYVGIHLKSKKFIDSLADWGQLLKEEKK"
FT   gene            73621..74613
FT                   /gene="plsX"
FT                   /locus_tag="SPP_0101"
FT   CDS_pept        73621..74613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SPP_0101"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504;
FT                   match to protein family HMM TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20900"
FT                   /db_xref="GOA:C1CHU8"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CHU8"
FT                   /protein_id="ACO20900.1"
FT                   /translation="MKKIAVDAMGGDYAPQAIVEGVNQALSDFSDIEVQLYGDEAKIKQ
FT                   YLTATERVSIIHTDEKIDSDDEPTRAIRNKKNASMVLAAKAVKDGEADAVLSAGNTGAL
FT                   LAAGFFIVGRIKNIDRPGLMSTLPTVDGKGFDMLDLGANAENTAQHLHQYAVLGSFYAK
FT                   NVRGIAQPRVGLLNNGTESSKGDPLRKETYELLVADESLNFIGNVEARDLMNGVADVVV
FT                   ADGFTGNAVLKSIEGTAMGIMGLLKTAITGGGLRAKLGALLLKDSLRGLKKQLNYSDIG
FT                   GAVLFGVKAPVVKTHGSSDAKAVYSTIRQIRTMLETDVVAQTAREFSGE"
FT   gene            74619..74852
FT                   /locus_tag="SPP_0102"
FT   CDS_pept        74619..74852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0102"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22210"
FT                   /protein_id="ACO22210.1"
FT                   /translation="MTEKEIFDRIVTIIQERQGEDFVVTESLSLKDDLDADSVDLMEFI
FT                   LTLEDEFSIEISDEEIDQLQNVGDVVKIIQGK"
FT   gene            74895..75188
FT                   /locus_tag="SPP_0103"
FT   CDS_pept        74895..75188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0103"
FT                   /product="mobile genetic element"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20607"
FT                   /protein_id="ACO20607.1"
FT                   /translation="MRNIGQAGKILADSGYQGLMKIYPQAQTPRKSSKLKPLTVEDKAC
FT                   NHALSKERSKVENIFAKVKTFKMFSTTYRNHRKRFGLRMNLIAGIINHELGF"
FT   gene            75391..75621
FT                   /locus_tag="SPP_0104"
FT   CDS_pept        75391..75621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0104"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21452"
FT                   /protein_id="ACO21452.1"
FT                   /translation="MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAVRGLQL
FT                   GIKTRTWQGAATGAAGGAILGGVAYAATCWW"
FT   gene            75624..75749
FT                   /locus_tag="SPP_0105"
FT   CDS_pept        75624..75749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0105"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21857"
FT                   /protein_id="ACO21857.1"
FT                   /translation="MDFKSFIIGLVVGIFGPYMDDLIRKKFLKSSEKKTEKSVKK"
FT   gene            complement(76196..76309)
FT                   /locus_tag="SPP_0106"
FT   CDS_pept        complement(76196..76309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20576"
FT                   /protein_id="ACO20576.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVVDRTDEVSHIYTARRR"
FT   gene            76336..78489
FT                   /locus_tag="SPP_0107"
FT   CDS_pept        76336..78489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0107"
FT                   /product="transport/processing ATP-binding protein ComA"
FT                   /EC_number="3.4.22.-"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412; match to protein family HMM TIGR01193"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21962"
FT                   /protein_id="ACO21962.1"
FT                   /translation="MKFGKRHYRPQVDQMDCGVASLAMVFGYYGSYYFLAHLRELAKTT
FT                   MDGTTALGLVKVAEEIGFETRAIKADMTLFDLPDLTFPFVAHVLKEGKLLHYYVVTGQD
FT                   KDSIHIADPDPGVKLTKLPRERFEEEWTGVTLFMAPSPDYKPYKEQKNGLLSFIPILVK
FT                   QRGLIANIVLATLLVTGINIVGSYYLQSIIDTYVPDQMRSTLGIISIGLVIVYILQQIL
FT                   SYAQEYLLLVLGQRLSIDVILSYIKHVFHLPMSFFATRRTGEIVSRFTDANSIIDALAS
FT                   TILSIFLDVSTVVIISLVLFSQNTNLFFMTLLALPIYTVIIFAFMKPFEKMNRDTMEAN
FT                   AVLSSSIIEDINGIETIKSLTSESQRYQKIDKEFVDYLKKSFTYSRAESQQKALKKVAH
FT                   LLLNVGILWMGAVLVMDGKMSLGQLITYNTLLVYFTNPLENIINLQTKLQTAQVANNRL
FT                   NEVYLVASEFEEKKTVEDLSLMKGEMTFKQVHYKYGYGRDVLSDINLTVPQGSKVAFVG
FT                   ISGSGKTTLAKMMVNFYDPSQGEISLGGVNLNQIDKKALRQYINYLPQQPYVFNGTILE
FT                   NLLLGAKEGTTQEDILRAVELAEIREDIERMPLNYQTELTSDGAGISGGQRQRIALARA
FT                   LLTDAPVLILDEATSSLDILTEKRIVDNLMALDKTLIFIAHRLTIAERTEKVVVLDQGK
FT                   IVEEGKHADLLAQGGFYAHLVNS"
FT   gene            78502..79851
FT                   /locus_tag="SPP_0108"
FT   CDS_pept        78502..79851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0108"
FT                   /product="transport protein ComB"
FT                   /note="identified by match to protein family HMM TIGR01000"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21486"
FT                   /protein_id="ACO21486.1"
FT                   /translation="MKPEFLESAEFYNRRYHNFSSSVIVPMALLLVFLLGFATVAEKEM
FT                   SLSTRATVEPSRILANIQSTSNNRILVNHLEENKLVKKGDLLVQYQEGAEGVQAESYAS
FT                   QLDMLKDQKKQLEYLQKSLQEGENHFPEEDKFGYQATFRDYISQAGSLRASTSQQNETI
FT                   ASQNAAASQTQAEIGNLISQTEAKIRDYQTAKSAIETGASLAGQNLAYSFYQSYKSQGE
FT                   ENPQTKVQAVAQVEAQISQLESSLATYRVQYAGSGTQQAYASGLSSQLESLKSQHLAKV
FT                   GQELTLLAQKILEAESGKKVQGNLLDKGKITASEDGVLHLNPETSDSSMVAEGALLAQL
FT                   YPSLEREGKAKLTAYLSSKDVARIKVGDSVRYTTTHDAGNQLFLDSTITSIDATATKTE
FT                   KGNFFKIEAETNLTSEQAEKLRYGVEGRLQMITGKKSYLRYYLDQFLNKE"
FT   gene            80021..80728
FT                   /gene="purC"
FT                   /locus_tag="SPP_0109"
FT   CDS_pept        80021..80728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SPP_0109"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21168"
FT                   /db_xref="GOA:C1CHV6"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CHV6"
FT                   /protein_id="ACO21168.1"
FT                   /translation="MSKQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGK
FT                   GVLNNQISSFIFEKLNAAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRF
FT                   GVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIADDQQIAYLKEETRRINELLKV
FT                   WFAEIGLKLIDFKLEFGFDKDGKIILADEFSPDNCRLWDADGNHMDKDVFRRGLGELTD
FT                   VYEIVWEKLQELK"
FT   gene            80930..84655
FT                   /locus_tag="SPP_0110"
FT   CDS_pept        80930..84655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0110"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF02769;
FT                   match to protein family HMM TIGR01857"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20709"
FT                   /protein_id="ACO20709.1"
FT                   /translation="MDKRIFVEKKADFQVKSESLVRELQHNLGLSSLKSIRIVQVYDVF
FT                   DLAEDLFAPAEKHIFSEQVTDHVLDEVSVQADLANYAFFAIESLPGQFDQRAASSQEAL
FT                   LLLGSSSDVTVNTAQLYLVNKDIDVTELEAVKNYLLNPVDSRFKDITTGIAKQEFSESD
FT                   KTIPKLTFFESYTAEDFARYKAEQGMAMEVDDLLFIQDYFKSIGRVPTETELKVLDTYW
FT                   SDHCRHTTFETELKHIDFSASKFQKQLQSTYDKYIAMREELGRSEKPQTLMDMATIFGR
FT                   YERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNETHNHPTEIEPFGGAATC
FT                   IGGAIRDPLSGRSYVYQAMRISGAGDITAPISETRAGKLPQQVISKTAAHGYSSYGNQI
FT                   GLATTYVREYFHPGFVAKRMELGAVVGAAPKGNVVREKPEAGDVIILLGGKTGRDGVGG
FT                   ATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGNVTRLIKKSNDFGAGGVCVAI
FT                   GELADGLEIDLNKVPLKYQGLNGTEIAISESQERMAVVVRPEDVDAFVAECNKENIDAV
FT                   VVATVTEKPNLVMNWNGETIVDLERRFLDTNGVRVVVDAKVVDKDVKLPEERQTSAETL
FT                   ESDTLTVLSDLNHASQKGLQTVFDCSVGRSTVNHPLGGRYQLTPTEASVQKLPVQHGVT
FT                   HTASVIAQGFNSYVAEWSPYHGAAYAVIEATARLVAAGANWSKARFSYQEYFERMDKQA
FT                   ERFGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEELTVPPTLVAFGVTTADSRKVLS
FT                   PEFKAVGENIYYIPGQALSAEIDFDLIKKNFAQFEASQADHKVTSASAVKYGGVVESLA
FT                   LATFGNYIGAEVTLPELKTALTAQLGGFVFTSPEEIAGVEKIGQTKADFTLTVNGVKLD
FT                   GHKLDSAFQGTLEEVYPTEFTQAKELEEVPAVASDVVIKAKEKVEKPVVYIPVFPGTNS
FT                   EYDSAKAFEKEGAEVNLVPFVTLNEEAIVKSVETMVDNIDKTNILFFAGGFSAADEPDG
FT                   SAKFIVNILLNEKVRVAIDSFIARGGLIIGICNGFQALVKSGLLPYGNFEDANSTSPTL
FT                   FYNDANQHVAKMVETRIANTNSPWLAGVQVGDIHAIPVSHGEGKFVVTAEEFAELRDNG
FT                   QIFSQYVDFNGKPSMDSKYNPNGSVHAIEGITSKNGQIIGKMGHSERYEDGLFQNIPGN
FT                   KDQHLFASAVKHFTGK"
FT   gene            84748..86190
FT                   /gene="purF"
FT                   /locus_tag="SPP_0111"
FT   CDS_pept        84748..86190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SPP_0111"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22104"
FT                   /protein_id="ACO22104.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPDAAKLTYFGLHSLQHRGQEGAGIL
FT                   SNDQGQLKRHRDMGLLSEVFRNPSNLDKLTGAGAIGHVRYATAGEASVDNIQPFLFRFH
FT                   DMQFGLAHNGNLTNAASLKKELEQRGAIFSATSDSEILAHLIRRSHNPSLMGKIKEALS
FT                   LVKGGFAYILLFEDKLIAALDPNGFRPLSIGKMANGAVVVSSETCAFEVIGAEWICDLK
FT                   PGEIVIIDDEGIQYDSYTDDTQLAICSMEYIYFARPDSNIHGVNVHTARKRMGAQLARE
FT                   FKHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLIKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMVDDSIVRGTTSRRIVQLLKEAGATEVHVAIGSPALAYPCFYGID
FT                   IQTRQELIAANHTVEETRQIIGADSLTYLSIDGLIESIGIETDAPNGGLCVAYFDGDYP
FT                   TPLYDYEEDYRRSLEEKTSFYK"
FT   gene            86227..87249
FT                   /gene="purM"
FT                   /locus_tag="SPP_0112"
FT   CDS_pept        86227..87249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SPP_0112"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21666"
FT                   /db_xref="GOA:C1CHV9"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CHV9"
FT                   /protein_id="ACO21666.1"
FT                   /translation="MTNKNAYAQSGVDVEAGYEVVERIKKHVARTESAGVMGALGGFGG
FT                   MFDLSKTGVKEPVLISGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYVATGKNEPAKLEQVVAGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVVEGDVLLGLASSGIHSNGYSLVRRVFADYTGEEVLPELEGKKLKEVLL
FT                   EPTRIYVKAVLPLIKEELVNGIAHITGGGFIENVPRMFADDLAAEIDESKVPVLPIFKA
FT                   LEKYGQIKHEEMFEIFNMGVGLMLAVSPENVERVKELLDEAVYEIGRIVKKENESVIIK
FT                   "
FT   gene            87246..87791
FT                   /gene="purN"
FT                   /locus_tag="SPP_0113"
FT   CDS_pept        87246..87791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SPP_0113"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21388"
FT                   /protein_id="ACO21388.1"
FT                   /translation="MKKIAVFASGNGSNFQVIAEEFPVEFVFSDHRDAYVLERAKQLGV
FT                   LSYAFELKEFESKADYEAALVELLEEHQIDLVCLAGYIKIVGPTLLSAYEGRIVNIHPA
FT                   YLPEFPGAHGIEDAWNAGVGQSGVTIHWVDSGVDTGQVIKQVRVPRLADDTIDRFEARI
FT                   HEAEYRLYLEVVKALFTD"
FT   gene            87875..88384
FT                   /locus_tag="SPP_0114"
FT   CDS_pept        87875..88384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0114"
FT                   /product="teicoplanin resistance protein"
FT                   /note="identified by match to protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21043"
FT                   /protein_id="ACO21043.1"
FT                   /translation="MLESKKTTRYVFYVYLMLLTWGILFKFETNPEFIAFFLAPRYINW
FT                   IPFSEPLIVDGKIVFAEMLFNLISFIPLGVCFPLIKTNLSSLRIVGTGFLISLLFECLQ
FT                   YILAIGITDITDLTLNTLGVCVGLLIYQIFIRVFKSQTRKWINILGMLSLGFAYLVLLL
FT                   LHLIGV"
FT   gene            88409..89956
FT                   /gene="purH"
FT                   /locus_tag="SPP_0115"
FT   CDS_pept        88409..89956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SPP_0115"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20149"
FT                   /db_xref="GOA:C1CHW2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CHW2"
FT                   /protein_id="ACO20149.1"
FT                   /translation="MTKRVLISVSDKAGIVEFAQELKKLGWEIISTGGTKVALDNAGVD
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDLDSHLEAAKDNKIELIDLVVVNLYP
FT                   FKETILKPDVTYADAVENIDIGGPSMLRSAAKNHASVTVVVDPADYAVVLDELAANGET
FT                   SYETRQRLAAKVFRHTAAYDALIAKYFTAQVGESKPEKLTLTYDLKQPMRYGENPQQDA
FT                   DFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDSPTVVALKHMNPCGI
FT                   GQADDIETAWEYAYESDPVSIFGGIVVLNREVDAATAEKMHGVFLEIIIAPSYTDEALA
FT                   ILINKKKNLRILALPFNAQEASEVEAEYTGVVGGLLVQNQDVVKESPADWQVVTKRQPT
FT                   ETEATALEFAWKAIKYVKSNGIIVTNDHMTLGVGPGQTNRVASVRLAIDQAKDRLDGAV
FT                   LASDAFFPFADNVEEIAKAGIKAIIQPGGSVRDQESIEAADKYGLTMVFTGVRHFRH"
FT   gene            90078..91340
FT                   /gene="purD"
FT                   /locus_tag="SPP_0116"
FT   CDS_pept        90078..91340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SPP_0116"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02655; match to protein
FT                   family HMM PF02843; match to protein family HMM PF02844;
FT                   match to protein family HMM PF08442; match to protein
FT                   family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21061"
FT                   /protein_id="ACO21061.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLESKDVEKVFVAPGNDGMTLDGLELV
FT                   NISISEHSKLIDFAKTNDVAWTFIGPDDALAAGIVDDFNQAGLKAFGPTRAAAELEWSK
FT                   DFAKEIMVKYGVSTAAYGTFSDFEEAKAYIEKHGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAAHEMLLDNKFGDSGARVVIEEFLEGEEFSLFAFVNGDKFYIMPTAQDHKRAYDGDK
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVDTIVKPVLEGMIKEGRPYLGVLYAGLILTADGPK
FT                   VIEFNARFGDPETQIILPRLTSDFAQNITDILDSKEPNITWTDKGVTLGVVVASKGYPL
FT                   DYSKGVELPVKTDGDIITYYAGAKFAENSRALLSNGGRVYMLVTTADTVKEAQASIYQE
FT                   LSQQKIEGLFYRTDIGSKAIK"
FT   gene            91597..91713
FT                   /locus_tag="SPP_0117"
FT   CDS_pept        91597..91713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21289"
FT                   /protein_id="ACO21289.1"
FT                   /translation="MKERLDDNPIVQGNWKTLGFQFRHETPLVAAAVPHKLR"
FT   gene            91743..92231
FT                   /gene="purE"
FT                   /locus_tag="SPP_0118"
FT   CDS_pept        91743..92231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SPP_0118"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21753"
FT                   /protein_id="ACO21753.1"
FT                   /translation="MKPVISIIMGSKSDWATMQKTAEVLDRFGVAYEKKVVSAHRTPDL
FT                   MFKHAEEARSRGIKIIIAGAGGAAHLPGMVAAKTILPVIGVPVNSRALSGVDSLYSIVQ
FT                   MPGGVPVATMAIGEAGATNAALFALRLLSVEDQSIATALADFAEEQGKIAEESSNELI"
FT   gene            92218..93309
FT                   /gene="purK"
FT                   /locus_tag="SPP_0119"
FT   CDS_pept        92218..93309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SPP_0119"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF02222;
FT                   match to protein family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20801"
FT                   /protein_id="ACO20801.1"
FT                   /translation="MSSSKTIGIIGGGQLGQMMAISAIYMGHKVIALDPAADCPASRVA
FT                   EIIVAPYNDVDALRQLADRCDVLTYEFENVDADGLDVVIKDGQLPQGTDLLRISQNRIF
FT                   EKDFLSNKAQVTVAPYKVVTSSLDLADIDLSKNYVLKIATGGYDGHGQNVIRSADDLEE
FT                   AYALADSAACVLEEFVNFDLEISVIVSGNGKEVTFFPVQENIHRNNILSKTIVPARISE
FT                   SLADKAKAMAVRIAEQLNLSGTLCVEMFATADDIIVNEIAPRPHNSGHYSIEACDFSQF
FT                   DTHILGVLGAPLPAIKLHAPAVMLNVLGQHVEAAEKYVTENPSTHLHMYGKIEAKHNRK
FT                   MGHVTLFSDVPDSVEEFGEGIDF"
FT   gene            93319..93546
FT                   /locus_tag="SPP_0120"
FT   CDS_pept        93319..93546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20462"
FT                   /protein_id="ACO20462.1"
FT                   /translation="MIQIIVNAFIEKDKTGAVVEVLYASADQDKVQAKYEELAAQYPEN
FT                   YLAIYDVPLDTDLNTLDHYPSVFIGKEEFE"
FT   gene            93609..94907
FT                   /gene="purB"
FT                   /locus_tag="SPP_0121"
FT   CDS_pept        93609..94907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SPP_0121"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00928"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21743"
FT                   /protein_id="ACO21743.1"
FT                   /translation="MINRYSRPEMANIWSEENKYRAWLEVEILSDEAWAELGEIPKEDV
FT                   ALIRKKADFDIDRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIIADKAKEHKFTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCDKLGIRAQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMITAYENVALWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MIRNMNSTFGLIFSQRAMLTLIEKGMTREQAYDLVQPKTAYSWDNQVDFKPLLEADSEV
FT                   TSRLTQEEIDEIFNPVYYTKRVDDIFERLGLGD"
FT   gene            complement(94962..98897)
FT                   /locus_tag="SPP_0122"
FT   CDS_pept        complement(94962..98897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0122"
FT                   /product="beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="identified by match to protein family HMM PF00728;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF04650; match to protein family HMM PF07501;
FT                   match to protein family HMM TIGR01167; match to protein
FT                   family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21413"
FT                   /protein_id="ACO21413.1"
FT                   /translation="MKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTTTTENQP
FT                   TIHTVSDSPQSSENRTEETPKAELQPEAPKTVETETPATDKVASLPKTEEKPQEEVSST
FT                   PSDKAEVVTQTSAEKETANKKAEEASPKKEEAKEVDSKESNTDKTDKDKPAKKDEAKAE
FT                   ADKPETEAGKERAATVNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLV
FT                   GNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAK
FT                   DKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALI
FT                   DKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYAND
FT                   LARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGH
FT                   QILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWA
FT                   DTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEA
FT                   EKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTPEALKEEEAKREVEKLAKNKVIS
FT                   IDAGRKYFTLNQLKRIVDKASELGYSDVHLLLGNDGLRFLLDDMTITANGKTYASDDVK
FT                   KAIIEGTKAYYDDPNGTALTQAEVTELIEYAKSKDIGLIPAINSPGHMDAMLVAMEKLG
FT                   IKNPQAHFDKVSKTTMDLKNEEAMNFVKALIGKYMDFFAGKTKIFNFGTDEYANDATSA
FT                   QGWYYLKWYQLYGKFAEYANTLAAMAKERGLQPMAFNDGFYYEDKDDVQFDKDVLISYW
FT                   SKGWWGYNLASPQYLASKGYKFLNTNGDWYYILGQKPEDGGGFLKKAIENTGKTPFNQL
FT                   ASTKYPEVDLPTVGSMLSIWADRPSAEYKEEEIFELMTAFADHNKDYFRANYNALREEL
FT                   AKIPTNLEGYSKESLEALDAAKTALNYNLNRNKQAELDTLVANLKAALQGLKPAATHSG
FT                   SLDENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISVL
FT                   TENGKTTETVLDSQVTKEVINQVVEVGAPVTHKGDESGLAPTTEVKPRLDIQKEEIPFT
FT                   TVTRENPLLLKGKTQVITKGVNGHRSNFYSVSTSADGKEVKTLVNSVVAQEAVTQIVEV
FT                   GTMVTHVGDENGQAAIAEEKPKLEIPSQPAPSTAPAEESKALPQDPAPVVTEKKLPETG
FT                   THDSAGLVVAGLMSTLAAYGLTKRKED"
FT   gene            complement(99213..99956)
FT                   /locus_tag="SPP_0123"
FT   CDS_pept        complement(99213..99956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0123"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20560"
FT                   /protein_id="ACO20560.1"
FT                   /translation="MEKENRGKNMAIPKYQYIKDELKNKIISGQFSSGDKFYTEAELIS
FT                   MYDVSSITVVRALNDLAKDGYIVRQQGKGTFVSRARKHKLVEFSDIELFNAKDDKVTVL
FT                   SIERGNKLVYLEKLGLRGDQFYYKIERIRESNGVVYIYHTSYIPEQYINANYPNLEYYS
FT                   SIYNRFKLDYHIHMNDEHFEEINEIVFPTPEHAASVLGVDEQFPTVLQTKITKLESTGQ
FT                   VLEYSETYKRSDYYKIKFISCDRDH"
FT   gene            100277..102064
FT                   /locus_tag="SPP_0124"
FT   CDS_pept        100277..102064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0124"
FT                   /product="beta-galactosidase (Lactase)"
FT                   /EC_number="3.2.1.23"
FT                   /note="identified by match to protein family HMM PF01301;
FT                   match to protein family HMM PF02449"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20238"
FT                   /protein_id="ACO20238.1"
FT                   /translation="MTRFEIRDDFYLDGKSFKILSGAIHYFRVPPEDWYHSLYNLKALG
FT                   FNTVETYVAWNLHEPREGEFHFEGDLDLEKFLQIAQDLGLYAIVRPSPFICAEWEFGGL
FT                   PAWLLTKNMRIRSSDPAYIEAVGRYYDQLLPRLVPRLLDNGGNILMMQVENEYGSYGED
FT                   KAYLRAIRQLMEECGVTCPLFTSDGPWRATLKAGTLIEEDLFVTGNFGSKAPYNFSQMQ
FT                   EFFDEHGKKWPLMCMEFWDGWFNRWKEPIITRDPKELADAVREVLEQGSINLYMFHGGT
FT                   NFGFMNGCSARGTLDLPQVTSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYPQLEPLY
FT                   KESMELDAIPLVEKVSLFETLDSLSSPVESLYPQKMEELGQSYGYLLYRTETNWDAEEE
FT                   RLRIIDGRDRAQLYVDGQWVKTQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHK
FT                   FLADTQRKGIRTGVCKDLHFLLNWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEE
FT                   PKDTYLDLSEFGKGVAFVNGQNLGRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYK
FT                   EEIHLTRKPTLKHIKGENL"
FT   gene            102061..102537
FT                   /locus_tag="SPP_0125"
FT   CDS_pept        102061..102537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0125"
FT                   /product="phosphotransferase system sugar-specific eiib
FT                   component"
FT                   /note="identified by match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21516"
FT                   /protein_id="ACO21516.1"
FT                   /translation="MTIVGCRIDGRLIHGQVANLWAGKLNVSRIMVVDDEVVNNDIEKS
FT                   GLKLATPPGVKLSILPVEKAAANILAGKYDSQRLFIVARKPDRFLGLVEAGVPLETLNV
FT                   GNMSQTPETRSITRSINVVDKDVEDFHKLAEKGVKLTAQMVPNDPISDFLSLLK"
FT   gene            102565..103470
FT                   /locus_tag="SPP_0126"
FT   CDS_pept        102565..103470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0126"
FT                   /product="PTS system, IIC component"
FT                   /note="identified by match to protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21872"
FT                   /protein_id="ACO21872.1"
FT                   /translation="MIQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGDV
FT                   TTGLLIGGNLQLFVLGVGTFGGASRIDATSGAVLATAFSVSQGIDAPLAITTIAVPVAA
FT                   LLTYFDVLGRMTTTFFAHRVDAAIERFDYKGIERNYLLGAIPWALSRALPVFFALAFGG
FT                   AFVQSVVDFVEAYKWVADGLTLAGRMLPGLGFAILLRYLPVKRNLHYLAMGFGLTAMLT
FT                   VLYSYVTGLGGAVAGIVGTLPAEVAEKIGFVNNFKGLSMIGISIVGIFLAVLHFKNSQK
FT                   VAVAAPSTPSESGEIEDDEF"
FT   gene            103457..104272
FT                   /locus_tag="SPP_0127"
FT   CDS_pept        103457..104272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0127"
FT                   /product="PTS system, IID component"
FT                   /note="identified by match to protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20222"
FT                   /protein_id="ACO20222.1"
FT                   /translation="MTNSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLYMILPQ
FT                   LRKMYGDGTPELKEMMKVHTQFFNTSPFFHTIIAGFDLAMEEKDGVGSKDAVNGIKTGL
FT                   MGPFAPLGDTIFGSLVPAIMGSVAATMAIAGQPWGIFLWIAVAVAYDIFRWKQLEFAYK
FT                   EGVNLINNMQSTLTALIDAASVLGVFMMGALVATVINFEISYKLPIGEKMIDFQDILNQ
FT                   IFPRLLPAIFTAFIFWLLGKKGMNSTKAIGIIIVLALALSALGHFALGM"
FT   gene            104279..104683
FT                   /locus_tag="SPP_0128"
FT   CDS_pept        104279..104683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0128"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20604"
FT                   /protein_id="ACO20604.1"
FT                   /translation="MTKSLILVSHGRFCEELRGSTEMIMGPQDNIYTVALLPEDGPEEF
FT                   TAKFEAVIEGLDDFLVFADLLGGTPCNVVSRLIMEGRDIDLYAGMNLPMVIEFINASLT
FT                   GADADYKSRAAESIVKVNDLLAGFDDDEDE"
FT   gene            104982..106148
FT                   /locus_tag="SPP_0129"
FT   CDS_pept        104982..106148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0129"
FT                   /product="putative tagatose-6-phosphate ketose/aldose
FT                   isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21660"
FT                   /protein_id="ACO21660.1"
FT                   /translation="MLHYTKEDLLELGAEITTREIYQQPDVWREAFEFYQAKREEIAAF
FT                   LQEIADKHDYIKVILTGAGTSAYVGDTLLPYFKEVYDERKWNFNAIATTDIVANPATYL
FT                   KKDVATVLVSFARSGNSPESVATVDLAKSLVDELYQVTITCAADGKLALQAHGDDRNLL
FT                   LLQPAVSNDAGFAMTSSFTSMMLTALLVFDPTEFAVKSERFEVVSSLARKVLDKAEDVK
FT                   ELVDLDFNRVIYLGAGPFFGLAHEAQLKILELTAGQVATMYESPVGFRHGPKSLINDNT
FT                   VVLVFGTTTDYTRKYDLDLVREVAGDQIARRVVLLSDQAFGLENVKEVALGCGGVLNDI
FT                   YRVFPYIVYAQLFALLTSLKVENKPDTPSPTGTVNRVVQGVIIHEYQK"
FT   gene            106264..107301
FT                   /locus_tag="SPP_0130"
FT   CDS_pept        106264..107301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0130"
FT                   /product="aldose 1-epimerase"
FT                   /note="identified by match to protein family HMM PF01263"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22102"
FT                   /protein_id="ACO22102.1"
FT                   /translation="MKAYTERVFGNVEGEDVLAYRFETDGGYQLEVMTYGATILRYVAP
FT                   DKAGNFANVILGFDDFDSYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNASNC
FT                   NHSGSTGWDSSLFEVEEVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYEISYK
FT                   VTTDQDTLVNPTNHSYFNLSGDFTQTIDRHVFQLNTEGIYSIAPDGVPAKTPEANRDVV
FT                   KHVYNGTLLKDIFAEEDEQIQLASGLDHPFALPAGHDNAGFLYDQNSGRFLLFKTEAPC
FT                   FVVYTANFVDESVIIGGQPMLQHNGIALEAQALPDAIHSDLKGQVILKAGQTFTSKTRY
FT                   ELVVK"
FT   gene            107508..108362
FT                   /locus_tag="SPP_0131"
FT   CDS_pept        107508..108362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0131"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20452"
FT                   /protein_id="ACO20452.1"
FT                   /translation="MTYEYKSHIYLAETVLNVKDLASQTAFYQQVIGLEILSQTETESI
FT                   LGLGGKVLVQLIQAQESGEVREHYGLYHLAILLPTRKALADVLKHLTDLQIPLVGGADH
FT                   GYSEAIYLEDLEGNGIELYRDKPVSTWDIREDGRIIGVTEALAAQDIYELGERVEPFIL
FT                   AEGTRMGHIHLSVKDSRKSSQFYQKVLGLEDKFSVPSASWIAAGDYHHHLAVNEWGGKG
FT                   LASRKQGLPGLAYYVIEVAHKKELLTIAQRAQEVDAPIKWMTSSQLEITDSDGIVTCIR
FT                   LAR"
FT   gene            108594..108752
FT                   /locus_tag="SPP_0132"
FT   CDS_pept        108594..108752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0132"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20937"
FT                   /protein_id="ACO20937.1"
FT                   /translation="MTQLTAVRSSVERVIEMIITENLTECINQPLDDSEAQKERLEKAI
FT                   RYLIKRK"
FT   gene            complement(108794..109201)
FT                   /locus_tag="SPP_0133"
FT   CDS_pept        complement(108794..109201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0133"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20755"
FT                   /protein_id="ACO20755.1"
FT                   /translation="MKIKVQTRKLAAGCSKHCFKVVDGTDEVSSKHCFEVVDRTDEVSS
FT                   KHCFEVVDRTDEVSNHIYGKVKLTWFEEIFEEYKSLHNKTHITKVLMNCTPKVRQKKSN
FT                   FLGSVHSTPDTMRFFNFKDFLQLLLTHIKLF"
FT   gene            complement(109255..109551)
FT                   /locus_tag="SPP_0134"
FT   CDS_pept        complement(109255..109551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0134"
FT                   /product="rhodanese family protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21197"
FT                   /protein_id="ACO21197.1"
FT                   /translation="METSISMADFYGKYQNENLELIDVREAHEFQAGHAPDAKNLPLST
FT                   LEQGYKELKPDHEYYVICQGGVRSASTCQFLSSQGLTVTNVEGGMNAWPGQVE"
FT   gene            complement(109541..109660)
FT                   /locus_tag="SPP_0135"
FT   CDS_pept        complement(109541..109660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0135"
FT                   /product="coenzyme A disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21658"
FT                   /protein_id="ACO21658.1"
FT                   /translation="MRSYIAEPILKQAGFTVQNLDGAYSLYKMTNPEGVEYGN"
FT   gene            109773..110537
FT                   /locus_tag="SPP_0136"
FT   CDS_pept        109773..110537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0136"
FT                   /product="phosphorylase, Pnp/Udp family"
FT                   /note="identified by match to protein family HMM PF01048"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20283"
FT                   /protein_id="ACO20283.1"
FT                   /translation="MIQKHAIPILEFDDNPQAVIMPNHEGLDLQLPKKCVYAFLGEEID
FT                   RYAREVGANCVGEFVSATKTYPVYVVNYKDEEICLVQAPVGSAPAAQFMDWLIGYGVEQ
FT                   IISTGTCGVLADIEENAFLVPVRALRDEGASYHYVAPSRYMEMQPEAIAAIERVLDDRG
FT                   IPYEEVMTWSTDGFYRETAEKVAYRKEEDCAVVEMECSALAAVAQLRGVLWGELLFTAD
FT                   SLADLNQYDSRDWGSEAFNKALELSLASVHHL"
FT   gene            110793..110933
FT                   /locus_tag="SPP_0137"
FT   CDS_pept        110793..110933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0137"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20845"
FT                   /protein_id="ACO20845.1"
FT                   /translation="MLLTSSVLSATSKQCFEQPVTSFLSDALVLIAYNQKEKFSPEKHI
FT                   E"
FT   gene            111102..112481
FT                   /locus_tag="SPP_0138"
FT   CDS_pept        111102..112481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0138"
FT                   /product="Trk transporter membrane-spanning protein-K+
FT                   transport"
FT                   /note="identified by match to protein family HMM PF02386"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21997"
FT                   /protein_id="ACO21997.1"
FT                   /translation="MLFKLSKEKIELGLSRLSPARRIFLSFALVILLGSLLLSLPFVQV
FT                   ESSRATYFDHLFTAVSAVCVTGLSTLPVAHTYNIWGQIICLLLIQIGGLGLMTFIGVFY
FT                   IQSKQKLSLRSRATIQDSFSYGETRSLRKFVYSIFLTTFLVESLGAILLSFRFIPQLGW
FT                   GRGLFSSIFLAISAFCNAGFDNLGSTSLFAFQTDLLVNLVIAGLIITGGLGFMVWFDLA
FT                   GHVGRKKKGRLHFHTKLVLLLTIGLLLFGTATTLFLEWNNAGTIGNLPVADKVLVSFFQ
FT                   TVTMRTAGFSTIDYTQAHPVTLLIYILQMFLGGAPGGTAGGLKITTFFVLLVFARSELL
FT                   GLPHANVARRTIAPRTVQKSFSVFIIFLMSFLIGLILLGITAKGNPPFIHLIFETISAL
FT                   STVGVTANLTPDLGKLALSVIMPLMFMGRIGPLTLFVSLADYHPEKKDMIHYMKADISI
FT                   G"
FT   gene            112495..113160
FT                   /locus_tag="SPP_0139"
FT   CDS_pept        112495..113160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0139"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21989"
FT                   /protein_id="ACO21989.1"
FT                   /translation="MSDRTIGILGLGIFGSSVLAALAKQDMNIIAIDDHAERINQFEPV
FT                   LARGVIGDITDEELLRSAGIDTCDTVVVATGENLESSVLAVMHCKSLGVPTVIAKVKSQ
FT                   TAKKVLEKIGADSVISPEYEMGQSLAQTILFHNSVDVFQLDKNVSIVEMKIPQSWAGQS
FT                   LSKLDLRGKYNLNILGFREQENSPLDVEFGPDDLLKADTYILAVINNQYLDTLVALNS"
FT   gene            113295..113498
FT                   /locus_tag="SPP_0140"
FT   CDS_pept        113295..113498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0140"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20608"
FT                   /protein_id="ACO20608.1"
FT                   /translation="MKIKDQTRKLAAGCSKHCFEVVDRTDEVSSKHCFEVADRTDEVSS
FT                   KHCFEVADRTDEVSNIYTARRR"
FT   gene            113560..114575
FT                   /pseudo
FT                   /locus_tag="SPP_0141"
FT                   /note="glycosyltransferases involved in cell wall
FT                   biogenesis, degenerate; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            114691..117720
FT                   /locus_tag="SPP_0144"
FT   CDS_pept        114691..117720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0144"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF04650; match to protein
FT                   family HMM TIGR01167; match to protein family HMM
FT                   TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21750"
FT                   /protein_id="ACO21750.1"
FT                   /translation="MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADVV
FT                   NPTPGQVLPEETSGTKEGDLSEKPGDTVLTQAKPEGVTGNTNSLPTPTERTEVSEETNS
FT                   SSLDTLFEKDEEAQKNPELTDVLKETVDTADVDGTQASPAETTPEQVKGGVKENTKDSI
FT                   DVPAAYLEKAEGKGPFTAGVNQVIPYELFAGDGMLTRLLLKASDNAPWSDNGTAKNPAL
FT                   PPLEGLTKGKYFYEVDLNGNTVGKQGQALIDQLRANGTQTYKATVKVYGNKDGKADLTN
FT                   LVATKNVDININGLVAKETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYE
FT                   LFAGDGMLTRLLLKASDKALWSDNGDAKNPALSPLGENVKTKGQYFYQLALDGNVAGKE
FT                   KQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTININGLISKETVQKAVA
FT                   DNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNG
FT                   DAKNPALSPLGENVKTKGQYFYQLALDGNVAGKEKQALIDQFRANGTQTYSATVNVYGN
FT                   KDGKPDLDNIVATKKVTININGLISKETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTA
FT                   GVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNGDAKNPALSPLGENVKTKGQYFYQLA
FT                   LDGNVAGKEKQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTININGLIS
FT                   KETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYELFAGDGMLTRLLLKAS
FT                   DKAPWSDNGDAKNPALSPLGENVKTKGQYFYQVALDGNVAGKEKQALIDQFRANGTQTY
FT                   SATVNVYGNKDGKPDLDNIVATKKVTIKINVKETSDTANGSLSPSNSGSGVTPMNHNHA
FT                   TGTTDSMPADTMTSSTNTMAGENMAASANKMSDTMMSEDKAMLPNTGETQTSMASIGLL
FT                   GLALAGLLGGLGLKNKKEEN"
FT   gene            117887..118585
FT                   /locus_tag="SPP_0145"
FT   CDS_pept        117887..118585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0145"
FT                   /product="response regulator SaeR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21009"
FT                   /protein_id="ACO21009.1"
FT                   /translation="MGKTILLVDDEVEITDIHQRYLIQAGYQVLVAHDGLEALELFKKK
FT                   PIDLIITDVMMPRMDGYDLISEVQYLSPEQPFLFITAKTSEQDKIYGLSLGADDFIAKP
FT                   FSPRELVLRVHNILRRLHRGGETELISLGNLKMNHSSHEVQIGEEMLDLTVKSFELLWI
FT                   LASNPERVFSKTDLYEKIWKEDYVDDTNTLNVHIHALRQELAKYSSDQTPTIKTVWGLG
FT                   YKIEKPRGQT"
FT   gene            118582..119634
FT                   /locus_tag="SPP_0146"
FT   CDS_pept        118582..119634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0146"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21943"
FT                   /protein_id="ACO21943.1"
FT                   /translation="MKLKSYILVGYIISTLLTILVVFWAVQKMLIAKGEIYFLLGMTIV
FT                   ASLVGAGISLFLLLPVFTSLGKLKEHAKRVAAKDFPSNLEVQGPVEFQQLGQTFNEMSH
FT                   DLQVSFDSLEESEREKGLMIAQLSHDIKTPITSIQATVEGILDGIIKESEQAHYLATIG
FT                   RQTERLNKLVEELNFLTLNTARNQVETTSKDSIFLDKLLIECMSEFQFLIEQERRDVHL
FT                   QVIPESARIEGDYAKLSRILVNLVDNAFKYSAPGTKLEVVAKLEKDQLSISVTDEGQGI
FT                   APEDLENIFKRLYRVETSRNMKTGGHGLGLAIARELAHQLGGEITVSSQYGLGSTFTLV
FT                   LNLSGSENKA"
FT   gene            119829..120440
FT                   /gene="rpsD"
FT                   /locus_tag="SPP_0147"
FT   CDS_pept        119829..120440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="SPP_0147"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by match to protein family HMM PF00163;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20207"
FT                   /db_xref="GOA:C1CHZ1"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CHZ1"
FT                   /protein_id="ACO20207.1"
FT                   /translation="MSRYTGPSWKQARRLGLSLTGTGKELARRNYVPGQHGPNNRSKLS
FT                   EYGLQLAEKQKLRFTYGVGEKQFRNLFVQATKIKGGILGFNFMLLLERRLDNVVYRLGL
FT                   ATTRRQARQFVNHGHILVDGKRVDIPSYRVTPGQVISVREKSLKVPAILEAVEATLGRP
FT                   AFVSFDAEKLEGSLTRLPERDEINPEINEALVVEFYNKML"
FT   gene            120625..120783
FT                   /locus_tag="SPP_0148"
FT   CDS_pept        120625..120783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0148"
FT                   /product="transposase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20769"
FT                   /protein_id="ACO20769.1"
FT                   /translation="MAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWLKLKEKT
FT                   GELNHQV"
FT   gene            121252..121467
FT                   /locus_tag="SPP_0149"
FT   CDS_pept        121252..121467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21212"
FT                   /protein_id="ACO21212.1"
FT                   /translation="MAEAKKAFADDSLTEQGLRDILQTVKDAIASLESIKESQSATKDG
FT                   GQTAGKETAGEDESANQTQEISQGIK"
FT   gene            121421..121594
FT                   /locus_tag="SPP_0150"
FT   CDS_pept        121421..121594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21905"
FT                   /protein_id="ACO21905.1"
FT                   /translation="MSLQIKLKKLAKELSKLLKDSNLETVDKDVLENSQKELQKAVLFL
FT                   ADEKALSILKQR"
FT   gene            121930..122889
FT                   /locus_tag="SPP_0151"
FT   CDS_pept        121930..122889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0151"
FT                   /product="ABC transporter membrane-spanning permease-sugar
FT                   transport"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20556"
FT                   /protein_id="ACO20556.1"
FT                   /translation="MDIKIKREEIMKKFSKTLRDNWIFLLMVLPGTLWLILFFYIPVFG
FT                   NVVAFKDYHMTSNGFIDSIINSKWVGLDNFRFLFSSRDAFIITRNTVLYNLGFIFLGLV
FT                   VSVGIAIILSELRSKRMVKIFQTSMLFPYFLSWVIISFFTDAFLNIDKGVFNHLLESLG
FT                   LKEVNFYADLGIWPYLLLFLGIWKGFGYSSVMYYATIMGIDPTYYEAATVDGASKWQRI
FT                   RNVTIPQLTPLVTVLTILAVGNIFRADFGLFYQIPHNAGQLYNVTNVLDVYVFNGLTQT
FT                   ADIGMAAAAGLYQSVVGLILVILSNLLARRVDPNSALF"
FT   gene            122903..123826
FT                   /locus_tag="SPP_0152"
FT   CDS_pept        122903..123826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0152"
FT                   /product="protein LplC"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20700"
FT                   /protein_id="ACO20700.1"
FT                   /translation="MAKKKIKKEKIDNVGIHSFSKKADIFFSIISGLIALSCILPFVFV
FT                   IIISVTDEKSLLQYGYSFFPSQFGLDGFEFLAQFKDKILQALFISVFVTVVGTLTNVFI
FT                   TTTYAYAISRTTFKYRRFFTIFVLLSMLFNAGLVPGYIMVTRVLQLGDTVWALIVPMLL
FT                   SPFNIILMRSFFKKTIPEAILESARIDGASEARIFFQICLPLSLPGIATITLLTALGFW
FT                   NDWFNALLYIKSDNLYPLQYLLMQIQQNMDYIAKAVGLTGQLGVALPKETGRMAMVVVA
FT                   TLPIAILYPFFQRYFVKGLTIGGVKE"
FT   gene            123910..125385
FT                   /locus_tag="SPP_0153"
FT   CDS_pept        123910..125385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0153"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21471"
FT                   /protein_id="ACO21471.1"
FT                   /translation="MKNWKKYAFASASVVALAAGLAACGNLTGNSKKAADSGDKPVIKM
FT                   YQIGDKPDNLDELLANANKIIEEKVGAKLDIQYLGWGDYGKKMSVITSSGENYDIAFAD
FT                   NYIVNAQKGAYADLTELYKKEGKDLYKALDPAYIKGNTVNGKIYAVPVAANVASSQNFA
FT                   FNGTLLAKYGIDISGVTSYETLEPVLKQIKEKAPDVVPFAIGKVFIPSDNFDYPVANGL
FT                   PFVIDLEGDTTKVVNRYEVPRFKEHLKTLHKFYEAGYIPKDVATSDTSFDLQQDTWFVR
FT                   EETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQVANFVISNNSKNKEKSMEILN
FT                   LLNTNPELLNGLVYGPEGKNWEKIEGKENRVRVLDGYKGNTHMGGWNTGNNWILYINEN
FT                   VTDQQIENSKKELAEAKESPALGFIFNTDNVKSEISAIANTMQQFDTAINTGTVDPDKA
FT                   IPELMEKLKSEGAYEKVLNEMQKQYDEFLKNKK"
FT   gene            125657..126643
FT                   /locus_tag="SPP_0154"
FT   CDS_pept        125657..126643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0154"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22141"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CHZ8"
FT                   /protein_id="ACO22141.1"
FT                   /translation="MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEG
FT                   INGTVSGDYETTQKYMDYVHSLPGMEELWFKIDEESEQAFKKMFVRYKKEIVHLGLEDN
FT                   DFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRE
FT                   LPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQ
FT                   GELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENE
FT                   DKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV"
FT   gene            126765..127625
FT                   /locus_tag="SPP_0155"
FT   CDS_pept        126765..127625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21877"
FT                   /protein_id="ACO21877.1"
FT                   /translation="MAKTFFIPNKQSILGEQEILNAKSILALLDGLESHSYDVVYLRQP
FT                   LNRLEYIECAIVGQSQFLFKVSYADGQKAYRVDLPDLLTKTDWQIIKSFLDALLAYTGT
FT                   DIEGLDGFDFEAYFQASIQAYLADPVARFTICQGIFNPIFFSRENLKSFLEADGLAQFE
FT                   ARVRAVQETDAYFARVSFYQDGEGKVHGVYHLAQGVKTVLPREPFVPAAYIEQLVDKEV
FT                   QWEIDLVQITGDGSKPEDYEAIARLDYAKFLEVLPLSFYHQLDANQIEVQPILDKDFKA
FT                   LAQEE"
FT   gene            complement(127802..128866)
FT                   /locus_tag="SPP_0156"
FT   CDS_pept        complement(127802..128866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21122"
FT                   /protein_id="ACO21122.1"
FT                   /translation="MKQEWFESNDFVKTTSKNKPEEQAQEVADKAEETIADLDTPIEKN
FT                   TQLEEEVPQAEVELESQQEEKIEAPEDSEARTEIEEKKASNSTEEEPDLSKETEKVTIA
FT                   EESQEALPQQKATTKEPLLISKSLESPYIPDQAPKSRDKWKEQVLDFWSWLVEAIKSPT
FT                   SKLETSITHSYTAFLLLILFSASSFFFSIYHIKHAYYGHIASINSRFPEQLAPLTLFSI
FT                   ISILVATTLFFFSFLLGSFVVRRFIHQEKDWTLDKVLQQYSQLLAIPIFLTAIASFFAF
FT                   FDSLRFTALLCVISIGIILLASLHIITRPSQASETDSFYQLFLSVLVNGVIILLFFVAE
FT                   VALIGDYLRILAFL"
FT   gene            complement(128929..129840)
FT                   /locus_tag="SPP_0157"
FT   CDS_pept        complement(128929..129840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21817"
FT                   /protein_id="ACO21817.1"
FT                   /translation="MRKWTKGFLIFGVVTTVIGFILLFVGIQSDGIKSLLSMSKEPIYD
FT                   SRTEKLTFGKEVENLEITLHQHALTITDSFDDQIHISYHPSLSAHHDLITNQNDRTLSL
FT                   TDKKLSETPFLSSGIGGILHIASSYSSRFEEVILQLPKGRTLKGINISANRGQTTIINA
FT                   SLENATLNTNSYILRIEGSRIKNSKLTTPNIVNIFDTVLTDSQLESTENHFHAENIQVH
FT                   GKVELTAKDYLRIILNQKESQRINWDISSNYGSIFQFTREKPESRGTELSNPYKTEKTD
FT                   VKDQLIARSDDNIDLISTPSRR"
FT   gene            complement(129833..130426)
FT                   /locus_tag="SPP_0158"
FT   CDS_pept        complement(129833..130426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20190"
FT                   /protein_id="ACO20190.1"
FT                   /translation="MTRTEYLTQLELYLKKLPEADRIEAMDYFRELFDDAGVEGEEELI
FT                   ASLGTPKEAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILVTL
FT                   FAILVAALTVILAFFAVSILGIIGGFLFLVESFTVLAQAKSAFILIFGSGLLAIGASSL
FT                   VLLGISYVARFFGLLIVRLVQFVLKKRKRGNQHA"
FT   gene            complement(130413..130739)
FT                   /locus_tag="SPP_0159"
FT   CDS_pept        complement(130413..130739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0159"
FT                   /product="transcription regulator"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21473"
FT                   /protein_id="ACO21473.1"
FT                   /translation="MYFPTSSALIEFLILAVLEQGDSYGYEISQTIKLIANIKESTLYP
FT                   ILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLLTLKDEWALYTDTINGIIEGSIR
FT                   HDKN"
FT   gene            complement(130878..132044)
FT                   /locus_tag="SPP_0160"
FT   CDS_pept        complement(130878..132044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0160"
FT                   /product="cyanate permease"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21130"
FT                   /protein_id="ACO21130.1"
FT                   /translation="MKKQSLFFVPGIILIGVSLRTPFTVLPIILGNISQGLEVEVSSLG
FT                   VLTSLPLLMFTLFSPFSTRLAQKIGLEHLFTYSLFFLTIGSLIRLINLPLLYLGTLMVG
FT                   ASVAVINVLLPSLIQANQPKKIGFLTTLYVTSMGIATALASYLAVPITQASSWKGLILL
FT                   LTLLCLATFLVWLPNHRYNHRLAPQTKQKSQIKVMRNKQVWAIIIFSGFQSLIFYTAMT
FT                   WLPTMSIHAGLSSHEAGLLTSILSLISIPFSMTIPSLTTSLSTRNRQLMLTLVSLAGVV
FT                   GISMLFFPINNFIYWLAIHLLIGTATSALFPYLMVNFSLKTSAPEKTAQLSGLSQTGGY
FT                   ILAAFGPTLFGYSFDLFHSWVPAVAALLLIDILMTVALFTVDRADKIL"
FT   gene            132195..133241
FT                   /locus_tag="SPP_0161"
FT   CDS_pept        132195..133241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0161"
FT                   /product="glycosyl transferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20920"
FT                   /protein_id="ACO20920.1"
FT                   /translation="MTQNVESLLVSIVISAYNEEKYLPGLIEDLKNQTYPKENIEILFI
FT                   NAMSTDGTTAIIQQFIKEDAEFNSIRLYNNPKKNQASGFNLGVKHSVGGLILKIDAHSK
FT                   VTESFVMNNVAVIQQGEFVCGGPRPTIVKGKGKWAETLHLVEENMFGSSIANYRNSSED
FT                   RYVSSIFHGMYKREVFQKVGLVNEQLGRTEDNDIHYRIREHGYKIRYSPSILSYQYIRP
FT                   TFKKMLHQKYSNGLWIGLTSHVQFKCLSLFHYVPCLFVLSLVFSLALLPITFVFITLLL
FT                   GAYFLLLSLLSLLTLLTLLKHKNGFLIVMPFLLFSIHFAYGLGTIVGLIRGFKWKKEYK
FT                   GTVIYLEK"
FT   gene            133309..135159
FT                   /locus_tag="SPP_0162"
FT   CDS_pept        133309..135159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0162"
FT                   /product="CapD protein, required for the biosynthesis of
FT                   type 1 capsular polysaccharide"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20337"
FT                   /protein_id="ACO20337.1"
FT                   /translation="MNKKLTDYVIDLVEILNKQQKQVFWGIFDIFSMVVSIIVSYILFY
FT                   GLINPAPVDYIIYTSLAFLFYQLMVDFWGLSASISRYSKITDFMKIFFGVTASSVLSYS
FT                   ICYAFLPLFSIRFIILFILLSAFLILLPRITWQLIYSRRKKGSGDGEHRRTFLIGAGDG
FT                   GALFMDSYQHPTSELELVGILDKDSKKKGQKLGGIPVLGSYDNLPELAKRHQIERVIVA
FT                   IPSLDPSEYERILQMCNKLGVKCYKMPKVETVVQGLHQAGTGFQKIDITDLLGRQEIRL
FT                   DESRLGAELTGKTILVTGAGGSIGSEICRQVSRFNPERIVLLGHGENSIYLVYHELIRK
FT                   FQGIDYVPVIADIQDYDRLLQVFEQYKPAIVYHAAAHKHVPMMERNPKEAFKNNIRGTY
FT                   NVARAVDEAKVPKMVMISTDKAVNPPNVMGATKRVAELIVTGFNQRSQSTYCAVRFGNV
FT                   LGSRGSVIPVFERQIAEGGPVTVTDFRMTRYFMTIPEASRLVIHAGAYAKDGEVFILDM
FT                   GKPVKIYDLAKKMVLLSGHTESEIPIVEVGIRPGEKLYEELLVSTELVDNQVMDKIFVG
FT                   KVNVMPLESINQKIGEFRTLSGDELKQAIIAFANQTTHIE"
FT   gene            complement(135245..135412)
FT                   /pseudo
FT                   /locus_tag="SPP_0163"
FT                   /note="hypothetical protein; this region contains one or
FT                   more premature stops and/or frameshifts;identified by
FT                   glimmer; putative"
FT   gene            complement(135462..136094)
FT                   /locus_tag="SPP_0164"
FT   CDS_pept        complement(135462..136094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0164"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20883"
FT                   /protein_id="ACO20883.1"
FT                   /translation="MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRG
FT                   FMGPPLESSFATCLSKDQISEAMQIYRSYYKAKGIYEAQLFPQIIDLLEELSSSYPLYI
FT                   TTTKNTSTAQDMAKNLEIHHFFDGIYGSSPEAPHKADVIHQALQTHQLAPEQAIIIGDT
FT                   KFDMLGARETGIQKLAVTWGFGEQADLLNYQPDYIAHKPLEVLAYFQ"
FT   gene            complement(136116..136988)
FT                   /gene="sdaAA"
FT                   /locus_tag="SPP_0165"
FT   CDS_pept        complement(136116..136988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaAA"
FT                   /locus_tag="SPP_0165"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="identified by match to protein family HMM PF03313;
FT                   match to protein family HMM TIGR00718"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20650"
FT                   /protein_id="ACO20650.1"
FT                   /translation="MFYSIKELVEQADLDFQGNVAELMITTEFELTGREREEVFLLMER
FT                   NLEVMKASVQLGLNENKSRSGLTGGDAAKLDHYIKNEKTLSDYTILSAARNAIAVNEHN
FT                   AKMGLVCATPTAGSAGCLPSVLTAAIEKLDLSHEQQLDFLFAAGAFGLVIANNASISGA
FT                   EGGCQAEVGSASAMSAAALTLAAGGTPYQASQAIAFVIKNMLGLICDPVAGLVEVPCVK
FT                   RNAMGASFAFIAADMALAGIESKIPVDEVIDAMYQVGASMPTAFRETAEGGLATTPTGR
FT                   RLQKEIFGE"
FT   gene            complement(136997..137668)
FT                   /gene="sdaAB"
FT                   /locus_tag="SPP_0166"
FT   CDS_pept        complement(136997..137668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaAB"
FT                   /locus_tag="SPP_0166"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF03315; match to protein
FT                   family HMM TIGR00719"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20549"
FT                   /protein_id="ACO20549.1"
FT                   /translation="MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTE
FT                   VEFQLFNSFAKTYRGHGTDLALVAGILGMDTDDPEIPNSLEIAHKRGIKIVWTIQKDSN
FT                   APHPNTTKITVKNAHKTISVTGISIGGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGM
FT                   IALVTEALSRYGINIAQMNVTREKAGEKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFF
FT                   K"
FT   gene            137910..138482
FT                   /locus_tag="SPP_0167"
FT   CDS_pept        137910..138482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0167"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22051"
FT                   /protein_id="ACO22051.1"
FT                   /translation="MKSITKKIKATLAGVAALFAVFSPSFVSAQESSTYTVKEGDTLSE
FT                   IAETHNTTVEKLAENNHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSA
FT                   PVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYQLTDSYLNGDYSAENQE
FT                   RVADAYVAGRYGSWTAAKNFWLNNGWY"
FT   gene            139279..139563
FT                   /locus_tag="SPP_0168"
FT   CDS_pept        139279..139563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0168"
FT                   /product="bacteriocin, lactococcin 972 family"
FT                   /note="identified by match to protein family HMM TIGR01653"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21491"
FT                   /protein_id="ACO21491.1"
FT                   /translation="MRKLVKIGVASLMVCSILASTSVLAVWVDGGQWNYGVGWSGNFGY
FT                   SDYLHSTRSHTATVKDGNKFSKDRAEAEAWARASIFKFPPTGMEYFYGF"
FT   gene            139618..141726
FT                   /locus_tag="SPP_0169"
FT   CDS_pept        139618..141726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0169"
FT                   /product="ABC transporter membrane-spanning permease-amino
FT                   acid transport"
FT                   /note="identified by match to protein family HMM TIGR01654"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20910"
FT                   /protein_id="ACO20910.1"
FT                   /translation="MKKISHLCMLLLLLCTTFFVFNVNYTREVVRIQEMGKTVDSLDLY
FT                   LKDINEPAASVLRFFEDVSKEYKVSIIKTDSGDEVVKSGVFDKDTFPYQEFGISSLDFT
FT                   TDGEGVYSNKEISNKLGTIPTFLKAKPIQLMTFQTYIKDTSRSLNGRYTITSTQEMDKD
FT                   RIVQKWSDFFKIDQATLLEPTYKSAVEVINRDLLLSAIVFVLAILLLVLVTVYQPMMEM
FT                   KRVGVQKLLGFQDRAVLADVVKGNLYLLLGGALVINLGVFFLLDYKPKDLFPMLWLSHF
FT                   LLLQLYLFISWLTYLLIQKMTISSLLKGFSSFKFGLLFNYLMKIGTTILLTVLLVGVGK
FT                   SLEQENKELDYQKQWISQGNYLTLETFQLNDNLWQEQLAGSGKALDYFYRFYQDLVEKT
FT                   QAGYVQSSSLPVKNFVQSEQIQQYQLTDTVDVYYANRNFLKSKGFKLPDTGIKKVILMP
FT                   ASTKGEEDKNQLLGKLIAFHSMKYEEQQKRTIEEMDVEIAYYEGDWSFFPYSDKRKENL
FT                   SNPIISLVNDSDMMWDEKASLSTTGLNNPIKIENTVQHQKEITELVEKLSDGNYLKFSS
FT                   IQAIQQEKVDSYRDAVRNFNLLFALFGLLSMMISYFLLVITFLLKRRDIITKKFMGWKL
FT                   VDRYRPLLVLLLLGYSFPLLVLIFFAHAFLPLLLFAGFTCLDILFVLVLASRMEKRSLV
FT                   ELLKGGIL"
FT   gene            141723..142364
FT                   /locus_tag="SPP_0170"
FT   CDS_pept        141723..142364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0170"
FT                   /product="macrolide export ATP-binding/permease protein
FT                   MacB"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20290"
FT                   /protein_id="ACO20290.1"
FT                   /translation="MIELENITKTIGGKVILDHLSLRIDQGDLVAIVGKSGSGKSTLLN
FT                   LLGLIDGDYSGRYEIFGQTNLAVNSAKSQTIIREHISYLFQNFALIDDETVEYNLMLAL
FT                   KYVKLSKKDKLKKVEEILERVGLSSTLHQKVSELSGGEQQRIAVARAILKPSQLILADE
FT                   PTGSLDPENRDLVLKFLLEMNREGKTVIIVTHDAYVAQQCHRIIELGEGK"
FT   gene            142571..143377
FT                   /locus_tag="SPP_0171"
FT   CDS_pept        142571..143377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0171"
FT                   /product="ABC transporter solute-binding protein-amino acid
FT                   transport"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21792"
FT                   /protein_id="ACO21792.1"
FT                   /translation="MNKMKKVLMTMFGLVMLPLLFACSNNQSAGIEAIKSKGKLVVALN
FT                   PDFAPFEYQKVVDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLA
FT                   ISGVSKTDERSKVFDFSIPYYTAKNKLIVKKSDLTTYQSVNDLAQKKVGAQKGSIQETM
FT                   AKDLLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVSKGFVENNPDLAIADLNFEKEQ
FT                   DDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASIEK"
FT   gene            143394..143813
FT                   /gene="argG"
FT                   /locus_tag="SPP_0172"
FT   CDS_pept        143394..143813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="SPP_0172"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="identified by match to protein family HMM PF00764"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21144"
FT                   /protein_id="ACO21144.1"
FT                   /translation="MSKEKVILAYSGGLDTSVAITWLKKDYDVVSVCMDVGEGKDLDFI
FT                   HDKALKVGAVESYVIDVKDEFATDYVLVALQSHAYYEQKYPLVSALSRPLISKKLVEIA
FT                   HQTGATTIAHGCTGKGNDQVEYQIAVAKKANEAKK"
FT   gene            complement(144103..144423)
FT                   /locus_tag="SPP_0173"
FT   CDS_pept        complement(144103..144423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20567"
FT                   /protein_id="ACO20567.1"
FT                   /translation="MQRLEVYKNYQHLYDLRIAILLNLSTLYLYNQDKNMCKQICYTLL
FT                   EDAKNKKSYDRLAICYVRIGICTDDSKLIQKGFSLLELTEETSMLSHLKKEVETHYQPK
FT                   KL"
FT   gene            145187..145567
FT                   /locus_tag="SPP_0174"
FT   CDS_pept        145187..145567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22000"
FT                   /protein_id="ACO22000.1"
FT                   /translation="MELVLPNNYVALEQEEMMYLDGGGVGRNWWNSRGSFATVLDVGLA
FT                   IYSGGATIYSAYAIKKAISANRGAITRTLRSLIIKHVGSAAGHLVNTALNVALTVTGFS
FT                   LGGAIAYGADWADGSLDGYIFA"
FT   gene            145941..146999
FT                   /locus_tag="SPP_0175"
FT   CDS_pept        145941..146999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0175"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21442"
FT                   /protein_id="ACO21442.1"
FT                   /translation="MKDDQKYLLAGLYSLLVAIFYFPLIESKGIFVSILMAVLLLYLIY
FT                   FIGTVIHIVIIKFIRKKSFKYLVLYPFTYDGSWRFQPINLLYFPEMVRDVIPINLVQEY
FT                   CQGQPYGLLKKMLKRIRLSREIALLLATIIVYFFTHRILPLSVFTFMFSYILIFAQSYL
FT                   GGNTAWIGNRRLIIDDEFEKILLSKSYIKEISSARYSEYLTCEYKNLTPIILLAIFENL
FT                   LDSYLLQNQSEVDLDIFYKVLPLLYKEKYTMGFNYFVSLNYLLYKVGFLGIIYDNEALG
FT                   DLSKQYLNRNISELQDGSFEGGIQDAVASKQIVVINEFIACLNSRCMPSQYDRFFYKDR
FT                   PYIFSRKSPIKR"
FT   gene            147314..148129
FT                   /locus_tag="SPP_0176"
FT   CDS_pept        147314..148129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21291"
FT                   /protein_id="ACO21291.1"
FT                   /translation="MKNKRYFFDTILMILLLISTIFCVSPVFIKLDILGTPSHAILTFV
FT                   LAIPLFYILSQCLHTLLLLVSSIFCKLRPIYFYFIFVIIIGARKYYRILFHQLMGFSPG
FT                   IAVFYKESQTTKNLFKFYYFLYFTTLISYYFFFTFVYDKPLLLPLIPFSIIIALVQKLY
FT                   RIENQQLFLLKSKVLTILESKKNCEFNLQDYHEIWKLQSKSELPCVALSYISLIKPYLS
FT                   ESVREQIDLLEVKRFKKINHPISLYGMLDVIKLNLYLRHYNEKINMNQC"
FT   gene            148123..148290
FT                   /locus_tag="SPP_0177"
FT   CDS_pept        148123..148290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0177"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20767"
FT                   /protein_id="ACO20767.1"
FT                   /translation="MLKKILEVRPDFVLIEQNIDDSLNSSQPLSLSLAISEIQLLLEVY
FT                   IGIKHVSIRR"
FT   gene            148667..149041
FT                   /locus_tag="SPP_0178"
FT   CDS_pept        148667..149041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0178"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20360"
FT                   /protein_id="ACO20360.1"
FT                   /translation="MELVLPNNYVALEQEEMMYFDGGFSIPRWPVATAINIAFNDVLGG
FT                   GAISLVRNYIRNYGLRRVTSAIAGAAARYVGVRVANRVAGFALSAINGFAAWMSIGNAI
FT                   TTIWANNDVNRRDPNLNALW"
FT   gene            149048..149230
FT                   /locus_tag="SPP_0179"
FT   CDS_pept        149048..149230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21853"
FT                   /protein_id="ACO21853.1"
FT                   /translation="MGIKMEKIFVIIFFVCLFISSITFLAYDFVSEEIKKLIIWMNVVF
FT                   LILIIAMIIYPKLRK"
FT   gene            149249..150151
FT                   /locus_tag="SPP_0180"
FT   CDS_pept        149249..150151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22070"
FT                   /protein_id="ACO22070.1"
FT                   /translation="MIRKLIIFLLMLPLFVLWLELHVLVNNLLLNLESPLDFVISMSLA
FT                   FCSLILSKIVLDILYALKDLYKKEALITIFPFIFIGRKKVNVRFSPYFSFHRKSLSPDD
FT                   LRSRIIWSFILEIAIILVFILKIPFAIIMLTTIFFWTIMDINHLVFNKTEFLFNQNKWQ
FT                   KEDSFESDLTKTLKDKIQKSELSYSDLMSLQLYDAMNQSTFLTDSELFEDILKKIEDSH
FT                   NTLLCTGLVELLLYEISISNNNNWQEKVDKIRIQLIRINQLDFFYYTSWLRQNFDFCMN
FT                   REYHKMKSRKLLLSNKKIV"
FT   gene            150207..150560
FT                   /locus_tag="SPP_0181"
FT   CDS_pept        150207..150560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21464"
FT                   /protein_id="ACO21464.1"
FT                   /translation="MELVLPNNYVVIDEEEMMYLDGEAYLSKRACQGICAALAMSSGTF
FT                   IALAGAAVLTKKLINYIKVGGLGGWLIGAAAGVLATAAGKIAYYIGYGVLNRGCDINGN
FT                   PYPWDGFISATVK"
FT   gene            150527..151285
FT                   /locus_tag="SPP_0182"
FT   CDS_pept        150527..151285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0182"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21136"
FT                   /protein_id="ACO21136.1"
FT                   /translation="MGWIHICDSKMSNVDKIRKIHIIVCWMYIFLSFRAIINDTEYFLL
FT                   IFLAFIYSIVSLPLYSVKNKIVSICLAINSILLMSFPILINKFFPESFLTYTVLISVFI
FT                   TELIIFHLIGKDFDIKLTNEYKKISQFRSKVSQSPWIKYLEISSFILTIFPSILYGTVD
FT                   NHVLTLIFLIKICADTTIKFLFIRLFDTSTLMKRRIFFLFALDVIAYLFLGYLLVIQKA
FT                   GYLFSVLLLFSNFSVPFIKEKEFELFKNSK"
FT   gene            152513..152656
FT                   /locus_tag="SPP_0183"
FT   CDS_pept        152513..152656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0183"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20584"
FT                   /protein_id="ACO20584.1"
FT                   /translation="MNFCLTDLHHLFDLHKITRDYASQTKPAIQAGVFILEDFRNILCT
FT                   MM"
FT   gene            152753..152920
FT                   /locus_tag="SPP_0184"
FT   CDS_pept        152753..152920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21808"
FT                   /protein_id="ACO21808.1"
FT                   /translation="MKLDVIFFEDKNKRSAVLGLRRDKSGVFKPVTLHFTSAKKYAKVR
FT                   KTDVKEMKWL"
FT   gene            153206..155041
FT                   /locus_tag="SPP_0185"
FT   CDS_pept        153206..155041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0185"
FT                   /product="surface protein PspA"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21249"
FT                   /protein_id="ACO21249.1"
FT                   /translation="MNKKKMILTSLASVAILGAGFVASQPTVVRAEEAPVASQSKAEKD
FT                   YDAAKRDAENAKKALEEAKRAQKKYEDDQKKTEEKAKKEKEASKEEQAANLKYQQELVK
FT                   YASEKDSVKKAKILKEVEEAEKEHKKKRAEFEKVRSEVIPSAEELKKTRQKAEEAKAKE
FT                   AELIKKVEEAEKKVTEAKQKLDAERAKEVALQAKIAELENEVYRLETELKGIDESDSED
FT                   YVKEGLRAPLQSELDAKRTKLSTLEELSDKIDELDAEIAKLEKNVEYFKKTDAEQTEQY
FT                   LAAAEKDLADKKAELEKTEADLKKAVNEPEKPAEETPAPAPKPEQPAEQPKPAPAPQPA
FT                   PAPKPEKTDDQQAEEDYARRSEEEYNRLPQQQPPKAEKPAPAPKPEQPVPAPKTGWKQE
FT                   NGMWYFYNTDGSMATGWLQNNGSWYYLNSNGAMATGWLQYNDSWYYLNASGAMATGWAK
FT                   VNGSWYYLNANGAMATGWLQYNDSWYYLNASGAMATGWAKVNGSWYYLNANGAMATGWL
FT                   QYNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQ
FT                   WFKVSDKWYYVNGLGALAVNTTVDGYEVNANGEWV"
FT   gene            155442..156563
FT                   /gene="trmU"
FT                   /locus_tag="SPP_0186"
FT   CDS_pept        155442..156563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="SPP_0186"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="identified by match to protein family HMM PF03054;
FT                   match to protein family HMM TIGR00420"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21766"
FT                   /db_xref="GOA:C1CI29"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI29"
FT                   /protein_id="ACO21766.1"
FT                   /translation="MSDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTD
FT                   ENGVCTATEDYKDVVAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCN
FT                   KEIKFKAFLDYAMTLGADYVATGHYARVARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQ
FT                   LQKTMFPLGHLEKPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLPAQPGRM
FT                   MTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHD
FT                   SLMSTSLEASQVHFTREMPEEFTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAI
FT                   TPGQAVVFYDGEECLGGGLIDNAYRDGQVCQYI"
FT   gene            156704..157159
FT                   /locus_tag="SPP_0187"
FT   CDS_pept        156704..157159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0187"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21466"
FT                   /protein_id="ACO21466.1"
FT                   /translation="MTQQDFRTKVDNTVFGVRATALILQNHKLLVTKDKGKYYTIGGAI
FT                   QVNESTEDAVVREVKEELGVKAQAGQLAFVVENRFEQDGVSYHNIEFHYLVDLLEDAPL
FT                   TMQEDEKRQPCEWIDLDKLEDIQLVPAFLKTALPDWEGQLRHIHLEE"
FT   gene            157169..159082
FT                   /gene="gidA"
FT                   /locus_tag="SPP_0188"
FT   CDS_pept        157169..159082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="SPP_0188"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20899"
FT                   /protein_id="ACO20899.1"
FT                   /translation="MTYHFTEEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLA
FT                   FMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKE
FT                   LYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRG
FT                   EIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPG
FT                   DEVPNHFSYTSRDEDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCP
FT                   SIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMM
FT                   RTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQ
FT                   GKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREI
FT                   GLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLR
FT                   RPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPAN
FT                   IDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNRSISKTLQK
FT                   SK"
FT   gene            159286..159444
FT                   /locus_tag="SPP_0189"
FT   CDS_pept        159286..159444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20784"
FT                   /protein_id="ACO20784.1"
FT                   /translation="MKIKEQTRKLAVGCSKHCFEVVDRTDEVSSKHSFEVVDRTDEVSN
FT                   IYTARRS"
FT   gene            complement(159461..161140)
FT                   /locus_tag="SPP_0190"
FT   CDS_pept        complement(159461..161140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0190"
FT                   /product="metallo-beta-lactamase superfamily protein domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521; match to protein
FT                   family HMM TIGR00649"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20256"
FT                   /protein_id="ACO20256.1"
FT                   /translation="MAYTLKPEEVGVFAIGGLGEIGKNTYGIEYQDEIIIVDAGIKFPE
FT                   DDLLGIDYVIPDYSYIVDNIDRVKAVLITHGHEDHIGGIPFLLKQANVPIYAGPLALAL
FT                   IRGKLEEHGLLRNAKLYEINHNTELTFKNLKATFFRTTHSIPEPLGIVIHTPQGKIICT
FT                   GDFKFDFTPVGEPADLHRMAALGEDGVLCLLSDSTNAEVPTFTNSEKVVGQSIMKIIQG
FT                   IEGRIIFASFASNIFRLQQATEAAVKTGRKIAVFGRSMEKAIVNGIDLGYIKAPKGTFI
FT                   EPNEIKDYPAGEILILCTGSQGEPMAALSRIANGTHRQVQLQPGDTVIFSSSPIPGNTT
FT                   SVNKLINIISEAGVEVIHGKVNNIHTSGHGGQQEQKLMLRLIKPKYFMPVHGEYRMQKV
FT                   HAGLAVDTGVEKDNIFIMSNGDVLALTADSARIAGHFNAQDIYVDGNRIGEIGAAVLKD
FT                   RRDLSEDGVVLAVATVDFKSQMILSGPDILSRGFVYMRESGDLIRQSQRILFNAIRIAL
FT                   KNKDASVQSVNGAIVNAIRPFLYENTEREPIIIPMILTPDEE"
FT   gene            complement(161142..161375)
FT                   /locus_tag="SPP_0191"
FT   CDS_pept        complement(161142..161375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0191"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF07288"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21935"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI34"
FT                   /protein_id="ACO21935.1"
FT                   /translation="MIYKVFYQETKERSPRRETTRALYLDIDASSELEGRIAARQLVEE
FT                   NRPEYNIEYIELLSDKLLDYEKETGAFKITEF"
FT   gene            161759..161968
FT                   /locus_tag="SPP_0192"
FT   CDS_pept        161759..161968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0192"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21352"
FT                   /protein_id="ACO21352.1"
FT                   /translation="MTNQVLEENYLCDSLLAFSPPRDLCRLVCILLWIALLMLGFFVWG
FT                   CRDSRFTTRKFHPIYQDEVVFAFF"
FT   gene            complement(162181..162333)
FT                   /locus_tag="SPP_0193"
FT   CDS_pept        complement(162181..162333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0193"
FT                   /product="bacteriocin-type signal sequence domain protein"
FT                   /note="identified by match to protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21002"
FT                   /protein_id="ACO21002.1"
FT                   /translation="MMKNLNNYREISNKELQEIKGGFGVGVGIALFMAGYTIGKDLRKK
FT                   FGKSC"
FT   gene            complement(162335..162520)
FT                   /locus_tag="SPP_0194"
FT   CDS_pept        complement(162335..162520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20444"
FT                   /protein_id="ACO20444.1"
FT                   /translation="MTNFDILDNQFLSLSENELSDIDGGLAPLVIFGVAVSWKAIAGGT
FT                   ALIGSGLAAGYFLGGD"
FT   gene            162698..163381
FT                   /locus_tag="SPP_0195"
FT   CDS_pept        162698..163381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0195"
FT                   /product="glycoprotein endopeptidase"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22220"
FT                   /protein_id="ACO22220.1"
FT                   /translation="MKVLAFDTSSKALSLAILEDKQILAEMTINIKKNHSITLMPAIDF
FT                   LMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTLNIELVGMSSLLALVPYQQ
FT                   EGLFVSLMDARRNNVYAGFYENAKPVMPEAHLPFERVIELIKGASQVTFVGEVGPFVEQ
FT                   IQEYLPRTNFKETLPNAANLALWAWDKEADSLHDFVPNYLKRVEAEENWLKNHTESGES
FT                   YIKRL"
FT   gene            163378..163815
FT                   /gene="rimI"
FT                   /locus_tag="SPP_0196"
FT   CDS_pept        163378..163815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="SPP_0196"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21816"
FT                   /protein_id="ACO21816.1"
FT                   /translation="MIEIKRIQKHPDLAQAIYAVMIAVYPVSPWTLEQIQADLSQDQTW
FT                   YALAYDGAEVIGFLAVQENLFEAEVLQIAVKGAYQSQGIASALFAQLPTDKEIFLEVRQ
FT                   SNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMKREIDEG"
FT   gene            163805..164815
FT                   /locus_tag="SPP_0197"
FT   CDS_pept        163805..164815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0197"
FT                   /product="O-sialoglycoprotein endopeptidase
FT                   (Glycoprotease)"
FT                   /EC_number="3.4.24.57"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21064"
FT                   /db_xref="GOA:C1CI40"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI40"
FT                   /protein_id="ACO21064.1"
FT                   /translation="MKDRYILAFETSCDETSVAVLKNDDELLSNVIASQIESHKRFGGV
FT                   VPEVASRHHVEVITACIEEALAEAGITEEDVTAVAVTYGPGLVGALLVGLSAAKAFAWA
FT                   HGLPLIPVNHMAGHLMAAQSVEPLEFPLLALLVSGGHTELVYVSEAGDYKIVGETRDDA
FT                   VGEAYDKVGRVMGLTYPAGREIDDLAHQGQDIYDFPRAMIKEDNLEFSFSGLKSAFINL
FT                   HHNAEQKGESLSTEDLCASFQAAVMDILMAKTKKALEKYPVKTLVVAGGVAANKGLRER
FT                   LAAEITDVKVIIPPLRLCGDNAGMIAYASVSEWNKENFAGWDLNAKPSLAFDTME"
FT   gene            complement(164855..165241)
FT                   /pseudo
FT                   /locus_tag="SPP_0198"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            complement(165232..166209)
FT                   /pseudo
FT                   /locus_tag="SPP_0199"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts; identified by match to
FT                   protein family HMM PF01610"
FT   gene            complement(166869..167072)
FT                   /locus_tag="SPP_0200"
FT   CDS_pept        complement(166869..167072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0200"
FT                   /product="degenerative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21225"
FT                   /protein_id="ACO21225.1"
FT                   /translation="MGYSLKKSRTYCEQDPEKVNRFLKELNHLSYLTPIYIYETGVETY
FT                   FYLEYDRALSRQLVSLEEDIII"
FT   gene            167432..168636
FT                   /pseudo
FT                   /locus_tag="SPP_0201"
FT                   /note="glycosyl transferase, group 1 family protein,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts"
FT   gene            168629..169489
FT                   /pseudo
FT                   /locus_tag="SPP_0204"
FT                   /note="glycosyl transferase, family 2, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts; identified by match to protein family HMM
FT                   PF00535"
FT   gene            169592..171208
FT                   /locus_tag="SPP_0205"
FT   CDS_pept        169592..171208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0205"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20199"
FT                   /protein_id="ACO20199.1"
FT                   /translation="MYTIIKSNIKKFSLLTIFIVAGQLLLIYAATINALVLNELIAMNL
FT                   ERFLKLSIYQMIVWCGIIFLDWVVKNYQVEVIQEFNLEIRNRVATDISNSTYQEFHSKS
FT                   SGTYLSWLNNDVQTLNDQAFKQLFLVIKGISGTIFAVVTLNHYHWSLTVATLFSLMIML
FT                   LVPKIFASKMREVSLNLTNQNEAFLKSSETILNGFDVLASLNLLYVLPKKIKEAGILLK
FT                   MVIQRKTTVETLAGAISFFLNIFFQISLVFLTGYLAIKGIVKIGTIEAIGALTGVIFTA
FT                   LGELGGQLSSIIGTKPIFLKLYSINPIESNKMNDIEPNEVNRDFPLYEAKNICYKYGDK
FT                   EILKNLNFCFQRNEKYLILGESGSGKSTLLKLLNGFLRDYSGELRFCGDDIKKTSYLNM
FT                   VSNVLYVDQKAYLFEGTIRDNILLEENYTDEEILQSLEQVGLSVKDFPNNILDYYVGDD
FT                   GRLLSGGQKQKITLARGLIRNKKIVLIDEGTSAIDRRTSLAIERKILDREDLTVIIVTH
FT                   APHPELKQYFTKIYQFPKDFI"
FT   gene            172139..172426
FT                   /locus_tag="SPP_0206"
FT   CDS_pept        172139..172426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20316"
FT                   /protein_id="ACO20316.1"
FT                   /translation="METRNLISYSLTDIFETDKIRIELLGEIYYKNIKLELHEFAGLYK
FT                   IYGISLIKNITGMFLIIIFDTKTKELKIFQDITTSYFNLYYTVYGGVFYI"
FT   gene            172404..172949
FT                   /locus_tag="SPP_0207"
FT   CDS_pept        172404..172949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0207"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22080"
FT                   /protein_id="ACO22080.1"
FT                   /translation="MEVCSIYSTSLKKVMKLSHVPVTLNNKKIQEFMRNGFILDSNTLV
FT                   TEINKLEYFSYISVNNTLRICGIDYNDSNNFTKEQVLKNWDSMLRESILRVYSEAGEAN
FT                   ITLSSGFDSNYILYTLANYTNSSINAFCIGGEKGINEIPEVTKIAKFYGINLLVDTVMS
FT                   PRFRIFSRYSMEIGRKSL"
FT   gene            172987..173640
FT                   /locus_tag="SPP_0208"
FT   CDS_pept        172987..173640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21488"
FT                   /protein_id="ACO21488.1"
FT                   /translation="MFQKGNTSILCGESADEIMTFKYHSVNYNQFCNDKQKSVYFSYSD
FT                   YPFYVTNSIVLKKNSLLLHSFGIHPRYPYKMSEIVEMSKKISDLNDKKEFHKKNCELRF
FT                   QDSVLDNINSVPGTTHLFSCLNIQTLVKIILYIFRYNSCMKIFNFRDKELIFFNKIVNG
FT                   LIQNIEENLEDDIERILKYLYICLFNEIFIIKNKVNFFDDVEFNQTLSEFLDKL"
FT   gene            173652..174401
FT                   /locus_tag="SPP_0209"
FT   CDS_pept        173652..174401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0209"
FT                   /product="GlcNAc-PI de-N-acetylase family"
FT                   /note="identified by match to protein family HMM PF02585"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21085"
FT                   /protein_id="ACO21085.1"
FT                   /translation="MSDNTKYIFLSPHLDDAIFSCGDYISKLTSEGEIVLVITIFSGYP
FT                   LSQQLQPSAKQFHKLCNLGKYPIEERKKEDRLACERLQCDFRHLSYYECLYRKDRNGNF
FT                   LYRHIYSKLKNEDTLKNDIIKELLMHLDDKCVVYCPLSLGDHVDHVFVNSIGRALEFMR
FT                   YKVIYYEDFPYVSDSSMVSYMGKTKELKMYQEELDEKHYIDRISSILCYKSQILIIWKS
FT                   VEKLLNNIKELYLRNGAAYSIRFWIKK"
FT   gene            174414..175586
FT                   /locus_tag="SPP_0210"
FT   CDS_pept        174414..175586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0210"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03721; match to protein
FT                   family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20540"
FT                   /protein_id="ACO20540.1"
FT                   /translation="MNIAVIGLGHVGLAYALLFASKYKVVAYDIDSVKINNLKKGTLPS
FT                   KNEELMKFFCENNLNITFFDTFSEIKNNIDYYIIALPTDYDEKIGSFNTYEIEQTVSKI
FT                   LRVKPNGKIILKSTVPIGFSNKLKRLFDTKNIIFVPEFLREGCSIYDNLYPSRIVVGDE
FT                   TVEGRKIAELFLSISTHSTANIKNVMLVSPTEAEAIKLFSNTFLALRVAFFNELDSFAE
FT                   RRSLNAEVVIKGVCLDPRIGNFYNNPSFGFGGYCLPKDTKQLKKEFIEINAPVIEAIDI
FT                   SNTNRKQFIVKQILERKPKIVGIYKLGMKYNSDNYKESAILSIINELLIVGIKILVYEP
FT                   NLNVSIDNVIFEKNFELFIKQSDLIVANRWDRDLEAYKDKVYTRGIWIRD"
FT   gene            175981..176844
FT                   /locus_tag="SPP_0211"
FT   CDS_pept        175981..176844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0211"
FT                   /product="MutR"
FT                   /note="identified by match to protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21265"
FT                   /protein_id="ACO21265.1"
FT                   /translation="MIEKMELGEFYKELRLARKLKQSDVACAGLTASQLSKFELGQSML
FT                   SADKLILAIQGINMNFDEFGHKLNNYQESPHMRIGRRVVDCFSHQDIAALEQLLEEVDQ
FT                   EQMAQTYRRLNAIVIKNALHSLDKSYPLTEEDSEFLTTYLYAIESWTWFELYLFCNTMP
FT                   FLSNQDLIFLSTSLLEKSKEFKELVHNRWYMKSGYLNIISELMERKLFSYIPIFEAELE
FT                   RMLRPYDVFEKVLWQFLKKMQIFLQTKGSNQKEIEHFIQSLQVLENPQLTALFELRLQQ
FT                   YKELID"
FT   gene            177130..177363
FT                   /locus_tag="SPP_0212"
FT   CDS_pept        177130..177363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20681"
FT                   /protein_id="ACO20681.1"
FT                   /translation="MLNLQFAETMELTEAELQDVRGGNLVNSMGGGGRSGISGWGVPGI
FT                   YPGWGNQGMSPNRGAFDWTIDLADGLFGRRRR"
FT   gene            177385..178062
FT                   /locus_tag="SPP_0213"
FT   CDS_pept        177385..178062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0213"
FT                   /product="caax amino protease family"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20363"
FT                   /protein_id="ACO20363.1"
FT                   /translation="MKKMKEVKFHLATGLLILTYYLIFNVTSDLDFMVALSDNMYYVFQ
FT                   VLLVLILGTIATIAFVKSEHWKECGRFQFRWSYLGVFLLSFFLLFVWANLTTYIFPRTQ
FT                   NGSTVVEVATSLTGISYFVTRILYTSIIAPVSEEVVCRGLLMTSLSKVNRYYLDVLVSA
FT                   AIFGAMHVLQYGWITTDFIKYFGMGLIFCMMFRYTRSIYWAIALHASWNSFLLIVTLLV
FT                   FGY"
FT   gene            178074..178739
FT                   /locus_tag="SPP_0214"
FT   CDS_pept        178074..178739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0214"
FT                   /product="caax amino protease family"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22081"
FT                   /protein_id="ACO22081.1"
FT                   /translation="MKKIISHRYFIIVFLLVIADQKFSVLVLRSDLVAGLSDFAYYLSD
FT                   MMLNFLVVLFALIAMIWSGKWQKINSRKFKGSYLFYSFLALLAFVAWNFVTFFLFPPTR
FT                   NEISYQHAAPTFTGATAFLMYFFYPVIAGPIFEDMIYRGLVMTALEKGKKWGLDVLGSA
FT                   VLFGVSHISNHGWVLTDFVFYMGGGLIFAVLFRMTKSIYWPIGLHIVYNGIGQLLMLL"
FT   gene            178811..180037
FT                   /locus_tag="SPP_0215"
FT   CDS_pept        178811..180037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0215"
FT                   /product="transporter, major facilitator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21497"
FT                   /protein_id="ACO21497.1"
FT                   /translation="MKVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLAI
FT                   LLITISETLPQVLQIFLGVLADFQHHRVLKYTVISFTKFLLYSIVSLSLSGQSFSLLLV
FT                   TFICLINLLSDTLSYFSGAMLTPIFIRIIGQDHLAEAIGFKQSTVSLVKTISNILGGVL
FT                   LGILSIQFISLLNALTFLIAFLGILFIKTDLLKVEKTISYQEGLSVKSFCQHLLQSSKL
FT                   IWNMNKVLLVLFIISTSQAVINVTVPVSTLFLRNQPFLNLQTGQSLALLSTFELSAPIV
FT                   GSLVSGYLQHTISIKTALYASLVIQLLLLVGFATVRFDWILIFSTLDAFFAGVLSPRLQ
FT                   ELVFKQIPEESMGAVQSSISAITVVLPSLFTISLVTIATSFGTLAVSFVLLLFLLVAFV
FT                   MLLNIRESI"
FT   gene            180491..181105
FT                   /locus_tag="SPP_0216"
FT   CDS_pept        180491..181105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0216"
FT                   /product="AzlC family protein"
FT                   /note="identified by match to protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21298"
FT                   /protein_id="ACO21298.1"
FT                   /translation="MPTALGYVSIGLACGTIGAPYVTPVEMGLMSLFVYAGSAQFAMLA
FT                   LIVVQAPVAAIAMTVFLINLRLFLLSLHASTYFRHTSLWYNIGMSSILTDETYGVLMGE
FT                   LAHTDKVNPMWMHGNNLNSYVAWFVGTVVGTALGGLLPNPEIFALILSSVVTGKVGSLP
FT                   QIKWLDFLAVFPTAWVAFRYRNLVGTVLFGVVLIAILRLVF"
FT   gene            181209..182039
FT                   /locus_tag="SPP_0217"
FT   CDS_pept        181209..182039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0217"
FT                   /product="ABC transporter substrate-binding protein-amino
FT                   acid transport"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20927"
FT                   /protein_id="ACO20927.1"
FT                   /translation="MKKIVKYSSLAALGLVAAGVLAACSGGAKKEGEAASKKEIIVATN
FT                   GSPRPFIYEENGELTGYEIEVVRAIFKDSDKYDVKFEKTEWSGVFAGLDADRYNMAVNN
FT                   LSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQLEAY
FT                   NAEHTDNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDNLKVIELPS
FT                   DQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAEADIK"
FT   gene            182193..183047
FT                   /locus_tag="SPP_0218"
FT   CDS_pept        182193..183047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0218"
FT                   /product="lipoprotein"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21239"
FT                   /protein_id="ACO21239.1"
FT                   /translation="MKIKKWLGLAALATVAGLALAACGNSEKKADNATTIKIATVNRSG
FT                   SEEKRWDKIQELVKKDGITLEFTEFTDYSQPNKATADGEVDLNAFQHYNFLNNWNKENG
FT                   KDLVAIGDTYISPIRLYSGLNGSANKYTKVEDIPANGEIAVPNDATNESRALYLLQSAG
FT                   LIKLDVSGTALATVANIKENPKNLKITELDASQTARSLSSVDAAVVNNTFVTEAKLDYK
FT                   KALFKEQADENSKQWYNIIVAKKDWETSPKADAIKKVIAAYHTDDVKKVIEESSDGLDQ
FT                   PVW"
FT   gene            183147..184520
FT                   /locus_tag="SPP_0219"
FT   CDS_pept        183147..184520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0219"
FT                   /product="acetylornithine
FT                   deacetylase/succinyl-diaminopimelate desuccinylase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22067"
FT                   /protein_id="ACO22067.1"
FT                   /translation="MFFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEV
FT                   ANYLGEIFKRVGAEVEIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTE
FT                   DPFTLSVRNGFMYGRGVDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTD
FT                   LDKYLEKHADKLCGADLLVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYG
FT                   GVVESAPWYLLQALQSLRAADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIY
FT                   GLELPLLQEERMAFLKRFFFEPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLE
FT                   PHDVLEKIRKQLDKNGFDKVELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLP
FT                   TTAGTGPMHTVFDALEVPMVAFGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE"
FT   gene            184513..185574
FT                   /locus_tag="SPP_0220"
FT   CDS_pept        184513..185574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0220"
FT                   /product="methionine import ATP-binding protein MetN"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20453"
FT                   /protein_id="ACO20453.1"
FT                   /translation="MSRDIIKLDQIDVTFHQKKRTITAVKDVTIHIQEGDIYGIVGYSG
FT                   AGKSTLVRVINLLQKPSAGKITIDDDVIFDGKVTLTAEQLRRKRQDIGMIFQHFNLMSQ
FT                   KTAEENVAFALKHSGLSKEEKKAKVAKLLDLVGLADRAENYPSQLSGGQKQRVAIARAL
FT                   DNDPKILISDESTSALDPKTTKQILALLQDLNQKLGLTVVLITHEMQIVKDIANRVAVM
FT                   QDGHLIEEGSVLEIFSNPKQPLTQDFISTATGIDEAMVKIEKQEIVEHLSENSLLVQLK
FT                   YAGASTDEPLLNELYKHYQVMANILYGNIEILDGTPVGELVVVLSGEKAALAGAQEAIR
FT                   QAGVQLKVLKGVQ"
FT   gene            185576..186268
FT                   /locus_tag="SPP_0221"
FT   CDS_pept        185576..186268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0221"
FT                   /product="ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21132"
FT                   /protein_id="ACO21132.1"
FT                   /translation="MESLIQTYLPNVYKMGWAGQAGWGTAIYLTLYMTVLSFIIGGFLG
FT                   LVAGLFLVLTAPGGVLENKVVFWILDKITSIFRAVPFIILLAILSPLSHLIVKTSIGPN
FT                   AALVPLSFAVFAFFARQVQVVLAELDGGVIEAAQASGATFWDIVGVYLSEGLPDLIRVT
FT                   TVTLISLVGETAMAGAVGAGGIGNVAIAYGFNRYNHDVTILATIIIILIIFAIQFLGDF
FT                   LTKKLSHK"
FT   gene            complement(186298..186867)
FT                   /locus_tag="SPP_0222"
FT   CDS_pept        complement(186298..186867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0222"
FT                   /product="membrane-bound protein"
FT                   /note="identified by match to protein family HMM TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21600"
FT                   /protein_id="ACO21600.1"
FT                   /translation="MKKSILTTLLFAVLYFLCMGIGVLLGNLFDQTGNMFYAPAFTALV
FT                   GGSVYMILVAKVPRFGAITTIGLVIAFFFLGTKHGAGSFLPGIICGLLADEVAHLGKYK
FT                   DKTKNFLSFIIFAFSTTGPILLMWIAPKAYMATLLARGKSQEYIDRIMVAPNPGTVLLF
FT                   IASIVIGALVGALIGQALSKKFAQKI"
FT   gene            187002..187616
FT                   /locus_tag="SPP_0223"
FT   CDS_pept        187002..187616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0223"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF04854"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20220"
FT                   /protein_id="ACO20220.1"
FT                   /translation="MGRFLDFVFNRFFLGMIATAFFWLLTLAGGIILGLAPASATLMSL
FT                   YAEHGYSFREYSLKEAWSLYKQNFVSSNLIFYSFLGVGLVLTYGLYLLVQLPHQTIVHL
FT                   IATLLNVLVVALIFLAYTVSLKLQVYFALSYRNSLKLSLIGIFMSLAAVAKVLLGTVLL
FT                   VAIGYYMPALLFFVGIGMWHFFISDMLEPVYEIIHEKLATK"
FT   gene            187666..189264
FT                   /locus_tag="SPP_0224"
FT   CDS_pept        187666..189264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0224"
FT                   /product="sensor histidine kinase, putative"
FT                   /note="identified by match to protein family HMM PF00672;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20674"
FT                   /protein_id="ACO20674.1"
FT                   /translation="MIIIIASFAILLSYADWDSREKEAQRVAQRVTARTVSEIEYYHRE
FT                   STQIAQALVENQARIEGIYKYFSLSMPDYFYWQLERKASPYISVSLYENVDDLYVRNDF
FT                   VTGVAIAFQDYKEVYVSTKDKRSGEKIRAEDFKPAGNSFAIPVSDPVSDQDLGVIYISL
FT                   DPAVLYHAIDNTRGNTPMAVTVTSPFDTEIFHIGETVDKESENWLVGLTSHGYQVQVAV
FT                   PKNFVLQGTVTSSALIVGLSLLFIVILYLTLRQTFANYQKQVVDLVESIQVIAQGEEGR
FT                   RIDISEKDQELLLIAETTNDMLDRLEKNIHDIYQLELSQKDANMRALQAQINPHFMYNT
FT                   LEFLRMYAVMQSQDELADIIYEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYPK
FT                   SIAYGFKIDPELENMKIPKFTLQPLVENYFAHGVDHRRTDNVISIKALKQDGFVEILVV
FT                   DNGRGMSAEKLANIREKLSQRNFEHQASYSDQRQSIGIVNVHERFVLYFGDRYAITIES
FT                   AEQAGVQYRITIQDE"
FT   gene            189276..190562
FT                   /locus_tag="SPP_0225"
FT   CDS_pept        189276..190562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0225"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20224"
FT                   /protein_id="ACO20224.1"
FT                   /translation="MYKVLLVDDEYMVTEGLKRLIPFDKWDMEVVATASHADEALEYVQ
FT                   ENPVDVIISDVNMPDKTGLDMIREMKEILPDAAYILLSGYQEFDYVKRAMNLSVVDYLV
FT                   KPVDKVELGNLLEKIAGQLGERGKKSQTLSQELDEAGFVSYLGDKENWWIGLSKEKQGS
FT                   FTIPYYVLGQAWQIFISDQPLDGLVVTPFEAPYQEHFERWKLNAEKTLFYGSVNLQQSE
FT                   SLFAYYEPIYRVIIQGNLNQIVEELNLLEKVVLENTPRIPITKQLFIQFVMDVFHLFEH
FT                   LKADDMTDIVKTIHAIQSFDELVSYIKETLISFFGQYRMNENVVSVLEVIGRDYQKELS
FT                   LKDISKALFINPVYLGQLIKRETDSTFAELLNKQRIKAAQQLLLSTSDSIEDICYAVGY
FT                   SNLGYFYKVFRKLCGKSPKAYRKQVETIL"
FT   gene            190614..191147
FT                   /locus_tag="SPP_0226"
FT   CDS_pept        190614..191147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20875"
FT                   /protein_id="ACO20875.1"
FT                   /translation="MKKKPIYLWVLLILSALISVPSLFGIVSPLPSKEALRVAQKQVAG
FT                   VNAQQLEDQLNYTYRVAEASHSIFNVALIVLSTILVVVAIVFLVRKNLQYANYTYVGYV
FT                   LLAIIGSIYGYVGLQDAVQLVQDESMRLTVSIGSKAVSIFYIVINVLFLALVFYKMWRQ
FT                   QKALAEEEETEELA"
FT   gene            191225..191695
FT                   /locus_tag="SPP_0227"
FT   CDS_pept        191225..191695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0227"
FT                   /product="ribonucleotide reductase"
FT                   /note="identified by match to protein family HMM PF07972"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21346"
FT                   /protein_id="ACO21346.1"
FT                   /translation="MKTISLVYISLSGNTESFVTRLKDYLLSQYKGIEVQKIHIKDLVK
FT                   EGKNFYEMDHLYVAFLPTYLEGGNGVDNGDVEILTTPVGDFIAYGNNASKCFGVVGSGN
FT                   RNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYELEKEN"
FT   gene            complement(191988..193250)
FT                   /locus_tag="SPP_0228"
FT   CDS_pept        complement(191988..193250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0228"
FT                   /product="mn2+ and fe2+ transporter of the nramp family"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21841"
FT                   /protein_id="ACO21841.1"
FT                   /translation="MSQAISLNQSTWASKLKAMGPGILMATAAVGGSHIVSSTQAGGSY
FT                   GWSLLLLVILANVFKYPFFRFGAEYTADTGKTLVEGYAEKGKLYLWIFFILNVFSAMVN
FT                   TAGVAILCSAIIASAFPMIGLSITQWSLILVAIIWAMLLFGGYKLLDGMVKWIMSALTI
FT                   ATVLAVIIAAVKHPEYSSDFVEKTPWQMAALPFIVSLLGWMPAPIEISAINSLWSAEKR
FT                   KTVNFNTEDALFDFNTGYIGTAILAVFFVALGALIQYPTGQAVEAASAKYISQFVGMYA
FT                   SVLGEWSRYLITFIAFLCIFGTVITVIDGYSRVNQESLRLLISQKEDNRKSLNIWMTIT
FT                   AIIGIVIIKFFAGQVSTMLRFAMIGSFLTTPFFALLNYALVTRENKNLPSWLKHLAIAG
FT                   LIFLFGFAIFFIYALAIGKAG"
FT   gene            complement(193560..194018)
FT                   /locus_tag="SPP_0229"
FT   CDS_pept        complement(193560..194018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20779"
FT                   /protein_id="ACO20779.1"
FT                   /translation="MKKQVFHDAAAGVLIGLILSILFSLIYAPNTYAPLNPYSLIGQVM
FT                   DQHQVHGALVLLYCTLIWAAIGMLFNFGNRLFSRDWSMLRATLTHFFLMLAGFVPLATL
FT                   AGWFPFHWIFYLQLIIEFAIVYLIIWAILYKREAKKVDHINQLLEHRK"
FT   gene            complement(194015..194455)
FT                   /locus_tag="SPP_0230"
FT   CDS_pept        complement(194015..194455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0230"
FT                   /product="response regulator of the LytR/AlgR family"
FT                   /note="identified by match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21371"
FT                   /protein_id="ACO21371.1"
FT                   /translation="MKVELQISETYEEEKLIVQAPQPTDKVQKVIEFAENLDQREKIKG
FT                   KIDDQVYLVEIGKIQRFYIENRKVLAETASQTYSIDLRLYQVLKLLPTNFIQISQSEII
FT                   NIDSISHLKLTPNGLVEIFLKNESFTYSSRRYLKTIKEKLEL"
FT   gene            194661..196610
FT                   /locus_tag="SPP_0231"
FT   CDS_pept        194661..196610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0231"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="identified by match to protein family HMM PF01119;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF08676; match to protein family HMM TIGR00585"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21959"
FT                   /db_xref="GOA:C1CI68"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI68"
FT                   /protein_id="ACO21959.1"
FT                   /translation="MSHIIELPEMLANQIAAGEVIERPASVVKELVENAIDAGSSQIII
FT                   EIEEAGLKKVQITDNGHGIAHDEVELALRRHATSKIKNQADLFRIRTLGFRGEALPSIA
FT                   SVSVLTLLTAVDGASHGTKLVARGGEVEEVIPATSPVGTKVCVEDLFFNTPARLKYMKS
FT                   QQAELSHIIDIVNRLGLAHPEISFSLISDGKEMTRTAGTGQLRQAIAGIYGLVSAKKMI
FT                   EIENSDLDFEISGFVSLPELTRANRNYISLFINGRYIKNFLLNRAILDGFGSKLMVGRF
FT                   PLAVIHIHIDPYLADVNVHPTKQEVRISKEKELMTLVSEAIANSLKEQTLIPDALENLA
FT                   KSTVRNREKVDQTILPLKENTLYYEKTEPSRPSQTEVADYQVELTDEGQDLTLFAKETL
FT                   DRLTKPAKLHFAERKPANYDQLDHPELDLASIDKAYDKLEREEASSFPELEFFGQMHGT
FT                   YLFAQGRDGLYIIDQHAAQERVKYEEYRESIGNVDQSQQQLLVPYIFEFPADDALRLKE
FT                   RMPLLEEVGVFLAEYGENQFILREHPIWMAEEEIESGIYEMCDMLLLTKEVSIKKYRAE
FT                   LAIMMSCKRSIKANHRIDDHSARQLLYQLSQCDNPYNCPHGRPVLVHFTKSDMEKMFRR
FT                   IQENHTSLRELGKY"
FT   gene            complement(196935..197402)
FT                   /gene="ribH"
FT                   /locus_tag="SPP_0232"
FT   CDS_pept        complement(196935..197402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="SPP_0232"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by match to protein family HMM PF00885;
FT                   match to protein family HMM TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20967"
FT                   /db_xref="GOA:C1CI69"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI69"
FT                   /protein_id="ACO20967.1"
FT                   /translation="MNTYEGNLVANNIKIGIVVARFNEFITSKLLSGALDNLKRENVNE
FT                   KDIEVAWVPGAFEIPLIASKMAKSKKYDAIICLGAVIRGNTSHYDYVCSEVSKGIAQIS
FT                   LNSEIPVMFGVLTTDTIEQAIERAGTKAGNKGSECAQGAIEMVNLIRTLDA"
FT   gene            complement(197403..198608)
FT                   /locus_tag="SPP_0233"
FT   CDS_pept        complement(197403..198608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0233"
FT                   /product="riboflavin biosynthesis protein ribAB"
FT                   /EC_number="3.5.4.25"
FT                   /note="identified by match to protein family HMM PF00925;
FT                   match to protein family HMM PF00926; match to protein
FT                   family HMM TIGR00505; match to protein family HMM
FT                   TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20428"
FT                   /protein_id="ACO20428.1"
FT                   /translation="MEYRKIQEALEALQKGRLVLVIDDKDRENEGDLICSAQAATTENV
FT                   NFMATYAKGLICMPMSESLANQLMLSPMVENNTDNHKTAFTVSIDYKETTTGISAEERG
FT                   LTARMCVAEDITPSDFRRPGHMFPLIAKKGGVLERNGHTEATVDLLKLAGLKECGLCCE
FT                   IMNHDGKMMRTDDLIQFSKKHNIPLITIKELQEYRKVYDQLVERVSTVNMPTRYGNFKA
FT                   ISYIDKLNGEHHLALIMGNIEDEANVLCRVHSECLTGDVLGSLRCDCGQQFDKAMKMIV
FT                   ENGSGVLLYLRQEGRGIGLINKLKAYHLQDQGMDTLDANLALGFEGDLREYHIGAQMLK
FT                   DLGLQSLHLLTNNPDKVEQLEKYGITISSRISIEIEANPYDSFYLETKKNRMGHILNME
FT                   EK"
FT   gene            complement(198628..199263)
FT                   /gene="ribE"
FT                   /locus_tag="SPP_0234"
FT   CDS_pept        complement(198628..199263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="SPP_0234"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="identified by match to protein family HMM PF00677;
FT                   match to protein family HMM TIGR00187"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21053"
FT                   /protein_id="ACO21053.1"
FT                   /translation="MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNG
FT                   ICLTVTHFNHQSFTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDG
FT                   TGKISSIKKDDNAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHT
FT                   LEQTILKSKQVGSTVNLENDILGKYVQKLMDNSPKSEISKELLYQNGF"
FT   gene            complement(199248..200348)
FT                   /gene="ribD"
FT                   /locus_tag="SPP_0235"
FT   CDS_pept        complement(199248..200348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SPP_0235"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM PF01872; match to protein
FT                   family HMM TIGR00227; match to protein family HMM
FT                   TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21650"
FT                   /protein_id="ACO21650.1"
FT                   /translation="MSDSKYMKLAIKLAQKGAGYVNPNPMVGAIIVKDNHIIGQGYHEF
FT                   FGGPHAERNALKNCRKSPVGATLYVTLEPCCHFGKTPPCIDAIIDSGITRVVIGSLDCN
FT                   PIVSGKGVKILEENNLQVTVGILENECLNLIKSFRKYITQHVPYVFMKYAMSMDGKIAT
FT                   KTNQSKWITEEEARKHVHQLRHHVSAIMVGVNTVIQDDPLLTCRLEEGKNPIRIICDTH
FT                   LRTPLTSKIVKTANDIKTYIATSSEDKNKMKLYQNHGCEILSIKKKGNHIDLSSLMQHL
FT                   GNMQIDSLVLEGGSLMNWSALEQQIVDELKIYIAPKIFGGSAKFPVGGEGISLPNDAIR
FT                   LKPYAFSQIGNDYLIESEVIYPCSQE"
FT   misc_binding    complement(200482..200596)
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element); riboswitch00003"
FT   gene            200753..201346
FT                   /gene="ruvA"
FT                   /locus_tag="SPP_0236"
FT   CDS_pept        200753..201346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="SPP_0236"
FT                   /product="holliday junction DNA helicase RuvA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF01330;
FT                   match to protein family HMM PF07499; match to protein
FT                   family HMM TIGR00084"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22204"
FT                   /db_xref="GOA:C1CI73"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI73"
FT                   /protein_id="ACO22204.1"
FT                   /translation="MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEDQ
FT                   IYVHQVVREDAHLLYGFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETK
FT                   NITYLTKFPKIGKKTAQQMVLDLEGKVVVAGDDLPAKVAVQASAENQELEEAMEAMLAL
FT                   GYKATELKKIKKFFEGTTDTAENYIKSALKMLVK"
FT   gene            201356..201919
FT                   /locus_tag="SPP_0237"
FT   CDS_pept        201356..201919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0237"
FT                   /product="DNA-3-methyladenine glycosylase 1"
FT                   /EC_number="3.2.2.20"
FT                   /note="identified by match to protein family HMM PF03352"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20673"
FT                   /protein_id="ACO20673.1"
FT                   /translation="MTKRCSWVKMTNPLYIAYHDEEWGQPLHDDQALFELLCMETYQAG
FT                   LSWETVLNKRQAFREAFHSYQIHSVAEMTDTELEAMLENPAIIRNRAKIFATRANAQAF
FT                   LQLQAEYGSFDAYLWSFVEGKTVVNDVPDYRQAPAKTPLSEKLAKDLKKRGFKFTGPVA
FT                   VLSFLQAAGLVDDHENDCEWKGLK"
FT   gene            201916..202593
FT                   /locus_tag="SPP_0238"
FT   CDS_pept        201916..202593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0238"
FT                   /product="caax amino protease family"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21183"
FT                   /protein_id="ACO21183.1"
FT                   /translation="MMSNKNKGILIFAILYTILFVFDGVKLLASLMPSVIANYLVYVVL
FT                   ALYGSFLFKDRLIQQWKEIRKTKRKFFFGVLTGWLFLILMTVVFEFVSEMLKQFVGLDG
FT                   QGLNQSNIQSTFQEQPLLIAVFACVIGPLVEELFFRQVLLHYLQERLPGLLSIILVGLV
FT                   FALTHMHSLALSEWIGAVGYLGGGLAFSIIYVKEKENIYYPLLVHMLSNSLSLIILAIS
FT                   IVK"
FT   gene            complement(202730..203761)
FT                   /locus_tag="SPP_0239"
FT   CDS_pept        complement(202730..203761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0239"
FT                   /product="MccC family protein"
FT                   /note="identified by match to protein family HMM PF02016"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21940"
FT                   /protein_id="ACO21940.1"
FT                   /translation="MVSTIGIVSLSSGIIGEDFVKHEVDLGIQRLKDLGLNPIFLSHSL
FT                   KGLDFIKDHPEARAEDLIHAFSDDSIDMILCAIGGDDTYRLLPYLFENDQLQKVIKQKI
FT                   FLGFSDTTMNHLMLHKLGIKTFYGQSFLADICELDKEMLAYSLHYFKELIKTGRISEIR
FT                   PSDVWYEERTDFSPTALGTPRVSHTNTGFDLLQGSAQFEGKILGGCLESLYDIFDNSRY
FT                   ADSTELCQKYKLFPDLSDWEGKILLLETSEEKPKPEDFKKMLLTLKDTGIFAVINGLLV
FT                   GKPMDETFHDDYKEALLDIIDSNIPIVYNLNVGHATPRAIVPFGVHAHVDAQEQVILFD
FT                   YNK"
FT   gene            complement(204016..204699)
FT                   /locus_tag="SPP_0240"
FT   CDS_pept        complement(204016..204699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06570"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21280"
FT                   /protein_id="ACO21280.1"
FT                   /translation="MSQIDLQKLTKKNQEFVHIATQQFIKDGKTDAEIQTIFEEVIPQI
FT                   LEEQSKGTTARSLYGAPTHWAHSFTVKEQYEKEHPKENDDPKLMIMDSALFITSLFALV
FT                   SALTTFFAADQAFGYGLITLLLVGLVGGFAFYLMYYFVYQYYGSDMDRSQRPPFWKSVL
FT                   VILASMFLWLLVFFATSFLPASLNPVLDPLPLAIIGAALLALRFYLKKRLNIRSASAGP
FT                   TRYQE"
FT   gene            complement(204711..205655)
FT                   /locus_tag="SPP_0241"
FT   CDS_pept        complement(204711..205655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0241"
FT                   /product="magnesium and cobalt transporter"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21942"
FT                   /protein_id="ACO21942.1"
FT                   /translation="MKQVFLSTTTEFKEIDTLEPGTWINLVNPTQNESLEIANTFDIDI
FT                   ADLRAPLDAEEMSRITIEDEYTLIIVDVPVTEERNNRTYYVTIPLGIIITEETIITTCL
FT                   EPLPVLDVFINRRLRNFYTFMRSRFIFQILYRNAELYLTALRSIDRKSEQIESQLHQST
FT                   RNEELIELMELEKTIVYFKASLKTNERVIKKLTSSTSNIKKYLEDEDLLEDTLIETQQA
FT                   IEMADIYGNVLHSMTETFASIISNNQNNIMKTLALVTIVMSIPTMVFSAYGMNFKDNEI
FT                   PLNGEPNAFWLIVFIAFAMSVSLTLYLIHKKWF"
FT   gene            205787..208618
FT                   /gene="uvrA"
FT                   /locus_tag="SPP_0242"
FT   CDS_pept        205787..208618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="SPP_0242"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21345"
FT                   /protein_id="ACO21345.1"
FT                   /translation="MQDKIVIHGARAHNLKNIDVEIPRDKLVVVTGLSGSGKSSLAFDT
FT                   LYAEGQRRYVESLSAYARQFLGNMEKPDVDAIDGLSPAISIDQKTTSKNPRSTVGTTTE
FT                   INDYLRLLYARVGTPYCINGHGAINASSVEQIVDKVLELPERQRLQILAPVIRKKKGQH
FT                   KSVIEKVQKDGYVRVRVDGEVYDVTEVPELSKSKQHNIDVVVDRIVIKEGIRSRLFDSI
FT                   EAALRIAEGYVIIDTMDDSELLFSEHYACPVCGFTVPELEPRLFSFNAPFGSCSECDGL
FT                   GIKLEVDTDLVVPDASKTLHEGALAPWNPISSNYYPNMLEQAMKVFGVAMDKPFEDLSE
FT                   EDKNLILYGSDGKEFHFHYENEFGGVRDIDIPFEGVINNIKRRYHETNSDYTRTQMRLY
FT                   MNELTCGTCQGYRLNDQALSVRVGGQQGPHIGEISDLSIADHLDLVSQLTLSENEAIIA
FT                   RPILKEIKDRLTFLNNVGLNYLTLSRSAGTLSGGESQRIRLATQIGSNLSGVLYILDEP
FT                   SIGLHQRDNDRLIASLKKMRDLGNTLIVVEHDEDTMREADYLIDVGPGAGVFGGEIVAA
FT                   GTPKQVARNSKSITGQYLSGKRVIPVPEERRVGNGRFIEVTGARENNLQNVTARFPLGK
FT                   FIAVTGVSGSGKSTLINSILKKAIAQKLNRNSDKPGKFKTITGIEHVDRLIDINQSPIG
FT                   RTPRSNPATYTGVFDDIRDLFAQTNEAKIRGYKKGRFSFNVKGGRCEACSGDGIIKIEM
FT                   HFLPDVYVACEVCHGTRYNSETLEVHYKEKNISQVLDMTVNDAVEFFQHIPKIQRKLQT
FT                   IKDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSFYILDEPTTGLHTEDIARL
FT                   LKVLARFVDAGNTVLVIEHNLDVIKTADHIIDLGPEGGVGGGTIIVTGTPEEVAANEAS
FT                   YTGHYLKGKLHHE"
FT   gene            208611..209672
FT                   /locus_tag="SPP_0243"
FT   CDS_pept        208611..209672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0243"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM PF01321"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21037"
FT                   /protein_id="ACO21037.1"
FT                   /translation="MNKRVQAFLAKMQEKELDGIIINNLKNVYYLTGFWGSNGTVFISR
FT                   DRQVLVTDSRYIIAAKQETSGFEIVADRDELAVIAGIVKDMNLTRIGFEDEISVSYYHR
FT                   MQAAFAGLNLLPQTQFVEGLRMIKDEAEIAAIRKACSISDQAFRDALDFIKPGKTEIEI
FT                   ANFLDFRMRELGASGLSFDTILASGINSSKPHAHPMHKPVELGEAITMDFGCLYDHYVS
FT                   DMTRTIYLGHVSDEQAEIYNTVLKANQALIDQAKAGLGFRDFDKIPRDIIIEAGYGDYF
FT                   THGIGHGIGLDIHEEPYFSQTSTETIKTGMALTDEPGIYIEGKYGVRIEDDILITETGC
FT                   ELLTLAPKELIVI"
FT   gene            209804..210202
FT                   /locus_tag="SPP_0244"
FT   CDS_pept        209804..210202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0244"
FT                   /product="regulatory protein spx"
FT                   /note="identified by match to protein family HMM PF03960;
FT                   match to protein family HMM TIGR01617"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20464"
FT                   /protein_id="ACO20464.1"
FT                   /translation="MIKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLGKEGITREELLDI
FT                   LTKTDNGIASIVSSKNRYAKALGVDIEDLSVNEVLNLIMETPRILKSPILVDEKRLQVG
FT                   YKEDDIRAFLPRSVRNVENAEARLRAAL"
FT   gene            210268..210837
FT                   /locus_tag="SPP_0245"
FT   CDS_pept        210268..210837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0245"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22211"
FT                   /protein_id="ACO22211.1"
FT                   /translation="MKKIVLVSLAFLFVLVGCGQKKETGPATKTEKDTLQSALPVIENA
FT                   EKNTVVTKTLVLPKSDDGSQQTQTITYKDKTFLSLAIQQKRPVSDELKTYIDQHGVEET
FT                   QKALLEAEEKDKSIIEARKLAGFKLETKLLSATELQTTTSFDFQVLDVKKASQLEHLKN
FT                   IGLENLLKNEPSKYISDRLANGATEQ"
FT   gene            210924..211190
FT                   /locus_tag="SPP_0246"
FT   CDS_pept        210924..211190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06135"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21509"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI83"
FT                   /protein_id="ACO21509.1"
FT                   /translation="MGFTEETVRFKLDDSNKKEISETLTDVYASLNDKGYNPINQIVGY
FT                   VLSGDPAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL"
FT   gene            211194..211613
FT                   /locus_tag="SPP_0247"
FT   CDS_pept        211194..211613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03652;
FT                   match to protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21158"
FT                   /db_xref="GOA:C1CI84"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI84"
FT                   /protein_id="ACO21158.1"
FT                   /translation="MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRV
FT                   KELVDTYKVERFVVGLPKNMNNTSGPRVEASQAYGAKLEEFFGLPVDYQDERLTTVAAE
FT                   RMLIEQADISRNKRKKVIDKLAAQLILQNYLDRKF"
FT   gene            211629..211934
FT                   /locus_tag="SPP_0248"
FT   CDS_pept        211629..211934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06949"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20419"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI85"
FT                   /protein_id="ACO20419.1"
FT                   /translation="MSHDHNHDHEERELITLVDEQGNETLFEILLTIDGKEEFGKNYVL
FT                   LVPVNAEEDEDGQVEIQAYSFIENEDGTEGELQPIPEDSEDEWNMIEEVFNSFMEE"
FT   gene            212240..213490
FT                   /locus_tag="SPP_0249"
FT   CDS_pept        212240..213490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0249"
FT                   /product="dihydrofolate:folylpolyglutamate synthetase"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20718"
FT                   /protein_id="ACO20718.1"
FT                   /translation="MFEVEEWLHSRIGLNFRSGLGRMQQAVDLLGNPEQSYPIIHVTGT
FT                   NGKGSTIAFMRELFMGHGKKVATFTSPHIVSINDRICINGQPIADADFIRLADQVKEME
FT                   KTLLQTPDQLSFFELLTLVAFLYFREQEVDLVLLEVGIGGLLDTTNVVTGELAVITSIG
FT                   LDHQETLGDSLEAIAEQKAGIFKAGKKAVIAKLPPEARLVCQKKAESLAVDLYQAGQDF
FT                   SVLNGDFSSSLLNLSQLNIGLEGAYQQENAALALQTFLLFMGERKEAIDEQAVRKALEQ
FT                   THWAGRLERIRPQIYLDGAHNLPALTRLVEFIKEKEQEGYRPQILFGSLKRKDYQGMLG
FT                   YLTENLPQVELKMTGFDYQGSLDETDVTGYHVIPSYREFISSFEERADAQDLLFVTGSL
FT                   YFISEVRGYLLDREQIN"
FT   gene            213487..214029
FT                   /locus_tag="SPP_0250"
FT   CDS_pept        213487..214029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20270"
FT                   /protein_id="ACO20270.1"
FT                   /translation="MTPFFELVILGELLVRENFSKLVAERKFIMKLKRFTLSLASLASF
FT                   SLLVACSQRAQQVQQPVAQQVQQPAQQNTNTANAGGNQNQAAPVQNQPVAQPTDIDGTY
FT                   TGQDDGDRITLVVTGTTGTWTELESDGDQKVKQVTFDSANQRMIIGDDVKIYTVNGNQI
FT                   VVDDMDRDPSDQIVLTK"
FT   gene            214175..215707
FT                   /locus_tag="SPP_0251"
FT   CDS_pept        214175..215707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0251"
FT                   /product="cardiolipin synthase"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21910"
FT                   /protein_id="ACO21910.1"
FT                   /translation="MKYRKFQLLMSKYGFSLSIMLLELCLVFGLFLYLGRMAPILWITV
FT                   LILLSIITIISIVNRNTTPENKVTWLLVAFVPVFGPLLYLMFGERRLSKKEIKQLKKLG
FT                   SMHFQEANSQLLKEKLKESDKAAYGVIKSLLSMDTNADIYDQTASTFFPNGEAMWKKMV
FT                   EDLKKAEKFIFLEYYIIEEGLMWNRILDILEQKVAQGVEVKMLYDDIGCMATLTGDYAH
FT                   RLRQLGIEAHKFNKVIPRLTVAYNNRDHRKILIVDGQIAYTGGVNLADEYINHVERFGY
FT                   WKDSGIRLDGLAVKALTRLFLTTWYINRGEISDFDQYHLENHSIPSDGLTIPYGSGPKP
FT                   IFRAQVGKKVYQSLINQATESVYITTPYLIIDYDLTETIKNAAMRGVDVRIITPYIPDK
FT                   KFIQLVTRGAYPDLLSAGVRIYEYSPGFIHSKQMLVDEDFAVVGTINLDYRSLVHHYEN
FT                   AVLLYKTPSIREIARDFRNIFADSQEVYPHSIKTSWYQKLVKEIAQLFAPIL"
FT   gene            215785..215928
FT                   /locus_tag="SPP_0252"
FT   CDS_pept        215785..215928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21403"
FT                   /protein_id="ACO21403.1"
FT                   /translation="MLTKEEVNDMIEFKQTHLHRFREIETFVKLCKKSLKQPSQADNPR
FT                   TF"
FT   gene            215965..217503
FT                   /locus_tag="SPP_0253"
FT   CDS_pept        215965..217503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0253"
FT                   /product="competence-induced protein Ccs4"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20493"
FT                   /protein_id="ACO20493.1"
FT                   /translation="MSVYGRVEEVHKENREPLEYQIEQESHHRESSRLPLVKILLWSTL
FT                   VTGITLGVPLLLDLMSAQEVQDFYAGWALHQTGKIYSDYYGSQGLLYYLLTYVSQGGFF
FT                   FAIFEWLALVAGGFFLFRSADTLTEQGDQAGHLVTIFYMLVTGLAFGGGYATLLALPFL
FT                   FAAFSLVAAYLSNPSHDKGFVRIGLALAGGFFFAPLSSLLFIAVVGLGLLVFNLGHRRF
FT                   AHGFYQFLAVALGFSLVFYPTAYYSAATGSFGEAISGIRYPIDSIRFDFTSKILENMFF
FT                   YGLLSLGLGFVVCIFLGLFQSKPFKLYVISVPASLVVILGLILLFFSQEPLHASYLMVV
FT                   FPVFLLLLVTNIKSQQRGRSARRSRRETPVSLWSRFFKGNLYLLVFGFVYLLSVPFLMK
FT                   FVLYPVPYQERNRLADLVKEETNTEDAIYAWDDTATLYRKSERLSPSAILSPLHYTATE
FT                   ENRNKLLNDLKEKQPKVIVVNDKVVVWSEVETLLKENYQQVKTDYSEFKVYKIK"
FT   gene            217617..219830
FT                   /gene="nrdD"
FT                   /locus_tag="SPP_0254"
FT   CDS_pept        217617..219830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="SPP_0254"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF03477; match to protein
FT                   family HMM TIGR02487"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21869"
FT                   /protein_id="ACO21869.1"
FT                   /translation="MRMIALEEKITILPTLFVEKRDGRRVVFDVDKIDKALHKAADKVM
FT                   DVTPLVEKRLNDLTERIITEIHSRFPQGIKIYEIQNIVEHELLEAKEYALAEEYITYRT
FT                   QRDFERSKATDINFSIHKLLNKDQTVVNENANKDSDVFNTQRDLTAGIVGKSIGLQMLP
FT                   KHVANAHQKGDIHYHDLDYSPYTPMTNCCLIDFKGMLENGFKIGNAEVESPKSIQTATA
FT                   QISQIIANVASSQYGGCSADRIDEILAPYAEKNYQKHLKDAEEWVLPEKREDYAWKKTQ
FT                   KDIYDAMQSLEYEINTLFTSNGQTPFTSLGFGLGTSRFEREIQKAILNIRIKGLGSEHR
FT                   TAIFPKLIFTLKRGLNLEEGTPNYDIKQLALECATKRMYPDVLSYDKIVDLTGSFKVPM
FT                   GCRSFLQGWKDENGVEVNSGRMNLGVVTVNLPRIALESEGDMNKFWEIFNERMNIAEDA
FT                   LVYRVERTKEATPANAPILYQYGAFGHHLGKEESVDQLFKNRRATVSLGYIGLYEVATV
FT                   FFGNSWESNPDAKEFTLDIIHDMKRRVEEWSDQYGYHFSIYSTPSESLTDRFCRLDIDK
FT                   FGSIPDITDKEYYTNSFHYDVRKNPTPFEKLDFEKVYPEAGASGGFIHYCEYPVLQQNP
FT                   KALEAVWDYAYDRVGYLGTNTPIDRCYKCDFEGDFEPTERGFACPNCGNSDPKTVDVVK
FT                   RTCGYLGNPQARPMVNGRHKEIAARVKHMNGSTIKIAGHQVTN"
FT   gene            219842..219982
FT                   /locus_tag="SPP_0255"
FT   CDS_pept        219842..219982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21679"
FT                   /protein_id="ACO21679.1"
FT                   /translation="MGKYQLDDKGRAQVTRYHEKHSKGGAGKKERLLSFREQFLNKNKK
FT                   K"
FT   gene            220026..220532
FT                   /locus_tag="SPP_0256"
FT   CDS_pept        220026..220532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0256"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21278"
FT                   /protein_id="ACO21278.1"
FT                   /translation="MELRRPRLADKKAVLDMMTEFEKFQSPHDGGFWDTENFVYEDWLE
FT                   SNQEQEMGINLPEGWVPAIQLVAFSEKGQAVGFLNLRLRLSNFLLEEGGHIGYSIRPSE
FT                   RGKGYAKETLRQGLQVAKEKNIKKALVTCSVNNPASRAVILANGGIFEDARNGVERYWI
FT                   EVANE"
FT   gene            220525..221115
FT                   /gene="nrdG"
FT                   /locus_tag="SPP_0257"
FT   CDS_pept        220525..221115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="SPP_0257"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /note="identified by match to protein family HMM TIGR02491"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21247"
FT                   /protein_id="ACO21247.1"
FT                   /translation="MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVAGCMFH
FT                   CEGCYNVATWSFNAGIPYTAELEEQIMADLGQPYVQGLTLLGGEPFLNTGILLPLVKRI
FT                   RKELSDKDIWSWTGYTWEEMMLETPDKLELLSLIDILVDGRYDRTKRNLMLQFRGSSNQ
FT                   RIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE"
FT   gene            221112..221729
FT                   /locus_tag="SPP_0258"
FT   CDS_pept        221112..221729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0258"
FT                   /product="phosphoribulokinase / Uridine kinase family"
FT                   /note="identified by match to protein family HMM PF00485"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21738"
FT                   /protein_id="ACO21738.1"
FT                   /translation="MKKKGLVDQLVSEIETGKVRTLGIYGHGASGKSTFAQELSQALDS
FT                   TTVNLLETDPYITSGRYLVVPKDAPNQKVTASLPVAYELESLQRDIFALQAGMDVLTIE
FT                   EPWKASEVLSGAKPILIVEGMSVGFLPKELFEKTICFYTDEETELKRRLARDTTVRNRD
FT                   ASFILASHQMRREQYLRYYKETESKADILVDQSEDKFDVKRT"
FT   gene            221984..222292
FT                   /gene="rpsJ"
FT                   /locus_tag="SPP_0259"
FT   CDS_pept        221984..222292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SPP_0259"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22069"
FT                   /db_xref="GOA:C1CI96"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI96"
FT                   /protein_id="ACO22069.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            222509..223135
FT                   /gene="rplC"
FT                   /locus_tag="SPP_0260"
FT   CDS_pept        222509..223135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SPP_0260"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20933"
FT                   /db_xref="GOA:C1CI97"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI97"
FT                   /protein_id="ACO20933.1"
FT                   /translation="MTKGILGKKVGMTQIFTEAGELIPVTVIEATPNVVLQVKTVETDG
FT                   YNAIQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNVEGLEVGAEITVETFAAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLAGRMG
FT                   GDRVTIQNLEVVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
FT   gene            223160..223783
FT                   /gene="rplD"
FT                   /locus_tag="SPP_0261"
FT   CDS_pept        223160..223783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SPP_0261"
FT                   /product="ribosomal protein L4/L1 family"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21483"
FT                   /db_xref="GOA:C1CI98"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI98"
FT                   /protein_id="ACO21483.1"
FT                   /translation="MANVTLFDQTGKEAGQVVLSDAVFGIEPNESVVFDVIISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSEKVAENKFVAVDALSFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFA
FT                   ALSARNLPNVKVATATTASVLDIANSDKLLVTQAAISKIEEVLA"
FT   gene            223783..224079
FT                   /gene="rplW"
FT                   /locus_tag="SPP_0262"
FT   CDS_pept        223783..224079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SPP_0262"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22048"
FT                   /db_xref="GOA:C1CI99"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CI99"
FT                   /protein_id="ACO22048.1"
FT                   /translation="MNLYDVIKKPVITESSMAQLEAGKYVFEVDTRAHKLLIKQAVEAA
FT                   FEGVKVANVNTINVKPKAKRVGRYTGFTNKTKKAIITLTADSKAIELFAAEAE"
FT   gene            224097..224930
FT                   /gene="rplB"
FT                   /locus_tag="SPP_0263"
FT   CDS_pept        224097..224930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SPP_0263"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20572"
FT                   /db_xref="GOA:C1CIA0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIA0"
FT                   /protein_id="ACO20572.1"
FT                   /translation="MGIRVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNN
FT                   NGRITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLIHNIELKPGRGGELVRAAGASAQ
FT                   VLGSEGKYVLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            225034..225315
FT                   /gene="rpsS"
FT                   /locus_tag="SPP_0264"
FT   CDS_pept        225034..225315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SPP_0264"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20759"
FT                   /db_xref="GOA:C1CIA1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIA1"
FT                   /protein_id="ACO20759.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
FT   gene            225327..225671
FT                   /gene="rplV"
FT                   /locus_tag="SPP_0265"
FT   CDS_pept        225327..225671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SPP_0265"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20878"
FT                   /db_xref="GOA:C1CIA2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIA2"
FT                   /protein_id="ACO20878.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPN
FT                   KAAEIILKVLNSAVANAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRT
FT                   AHITVAVAEK"
FT   gene            225684..226337
FT                   /gene="rpsC"
FT                   /locus_tag="SPP_0266"
FT   CDS_pept        225684..226337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SPP_0266"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21763"
FT                   /db_xref="GOA:C1CIA3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIA3"
FT                   /protein_id="ACO21763.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFVQKE
FT                   LADAAVSTIEIERAVNKVNVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGEGIARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            226341..226754
FT                   /gene="rplP"
FT                   /locus_tag="SPP_0267"
FT   CDS_pept        226341..226754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SPP_0267"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21601"
FT                   /db_xref="GOA:C1CIA4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIA4"
FT                   /protein_id="ACO21601.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            226764..226970
FT                   /gene="rpmC"
FT                   /locus_tag="SPP_0268"
FT   CDS_pept        226764..226970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SPP_0268"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21016"
FT                   /db_xref="GOA:C1CIA5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIA5"
FT                   /protein_id="ACO21016.1"
FT                   /translation="MKLNEVKEFVKELRGLSQEELAKRENELKKELFELRFQAATGQLE
FT                   QTARLKEVKKQIARIKTVQSEAK"
FT   gene            226995..227255
FT                   /gene="rpsQ"
FT                   /locus_tag="SPP_0269"
FT   CDS_pept        226995..227255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SPP_0269"
FT                   /product="ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21045"
FT                   /db_xref="GOA:C1CIA6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIA6"
FT                   /protein_id="ACO21045.1"
FT                   /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            227281..227649
FT                   /gene="rplN"
FT                   /locus_tag="SPP_0270"
FT   CDS_pept        227281..227649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SPP_0270"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20446"
FT                   /db_xref="GOA:C1CIA7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIA7"
FT                   /protein_id="ACO20446.1"
FT                   /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKSGARRADGSYIKFDENAAVIIREDKTPRGTRIFGPVAR
FT                   ELREGGFMKIVSLAPEVL"
FT   gene            227727..228032
FT                   /gene="rplX"
FT                   /locus_tag="SPP_0271"
FT   CDS_pept        227727..228032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SPP_0271"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21454"
FT                   /db_xref="GOA:C1CIA8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIA8"
FT                   /protein_id="ACO21454.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLTALPKVNKVIVEGVNIVKKHQ
FT                   RPTNELPQGGIIEKEAAIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
FT   gene            228056..228598
FT                   /locus_tag="SPP_0272"
FT   CDS_pept        228056..228598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0272"
FT                   /product="50S ribosomal protein L5 (BL6)"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20800"
FT                   /db_xref="GOA:C1CIA9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIA9"
FT                   /protein_id="ACO20800.1"
FT                   /translation="MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAV
FT                   SNAKSLEKAAEELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGLDIVIVTTANT
FT                   DEESRALLTGLGMPFAK"
FT   gene            228616..228885
FT                   /locus_tag="SPP_0273"
FT   CDS_pept        228616..228885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0273"
FT                   /product="30S ribosomal protein S14"
FT                   /note="identified by match to protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21796"
FT                   /protein_id="ACO21796.1"
FT                   /translation="MAKKSMVAREAKRQKIVDRYAEKRAALKAAGDYEGLSKLPRNASP
FT                   TRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW"
FT   gene            229170..229568
FT                   /gene="rpsH"
FT                   /locus_tag="SPP_0274"
FT   CDS_pept        229170..229568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SPP_0274"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21294"
FT                   /db_xref="GOA:C1CIB1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIB1"
FT                   /protein_id="ACO21294.1"
FT                   /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEIIEDDKQGVIRVFLKYGPNGEKVITNLKRVSKPGLRVYKKREDLPKVLNGLGIA
FT                   ILSTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            229760..230296
FT                   /locus_tag="SPP_0275"
FT   CDS_pept        229760..230296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0275"
FT                   /product="50S ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20837"
FT                   /db_xref="GOA:C1CIB2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIB2"
FT                   /protein_id="ACO20837.1"
FT                   /translation="MSRIGNKVIVLPAGVELANNDNVVTVKGPKGELTREFSKDIEIRV
FT                   EGTEVTLHRPNDSKEMKTIHGTTRALLNNMVVGVSEGFKKELEMRGVGYRAQLQGSKLV
FT                   LAVGKSHPDEVEAPEGITFELPNPTTIVVSGISKEVVGQTAAYVRSLRSPEPYKGKGIR
FT                   YVGEFVRRKEGKTGK"
FT   gene            230380..230736
FT                   /gene="rplR"
FT                   /locus_tag="SPP_0276"
FT   CDS_pept        230380..230736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SPP_0276"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20879"
FT                   /db_xref="GOA:C1CIB3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIB3"
FT                   /protein_id="ACO20879.1"
FT                   /translation="MISKPDKNKLRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKEVSKGTKTEQAVAVGKLVAERANAKGISEVVFDRGGYLYHGRV
FT                   KALADAARENGLKF"
FT   gene            230754..231248
FT                   /gene="rpsE"
FT                   /locus_tag="SPP_0277"
FT   CDS_pept        230754..231248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SPP_0277"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21971"
FT                   /protein_id="ACO21971.1"
FT                   /translation="MAFKDNAVELEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGRV
FT                   GFGTGKAQEVPEAIRKAVDDAKKNLIEVPMVGTTIPHEVLSEFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVVELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEIAALRGISVSDL
FT                   A"
FT   gene            231262..231444
FT                   /gene="rpmD"
FT                   /locus_tag="SPP_0278"
FT   CDS_pept        231262..231444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SPP_0278"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by match to protein family HMM PF00327;
FT                   match to protein family HMM TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20485"
FT                   /db_xref="GOA:C1CIB5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIB5"
FT                   /protein_id="ACO20485.1"
FT                   /translation="MAQIKITLTKSPIGRIPSQRKTVVALGLGKLNSSVIKEDNAAIRG
FT                   MITAVSHLVTVEEVN"
FT   gene            231589..232029
FT                   /gene="rplO"
FT                   /locus_tag="SPP_0279"
FT   CDS_pept        231589..232029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SPP_0279"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21109"
FT                   /db_xref="GOA:C1CIB6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIB6"
FT                   /protein_id="ACO21109.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINAKEYAIVNLDQLNVFEDGAEVTPVVLIEAGIVKA
FT                   EKSGIKILGNGELTKKLTVKAAKFSKSAEEAITAKGGSVEVI"
FT   gene            232042..233352
FT                   /locus_tag="SPP_0280"
FT   CDS_pept        232042..233352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0280"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21676"
FT                   /protein_id="ACO21676.1"
FT                   /translation="MFFKLLREALKVKQVRSKILFTIFIVLVFRIGTSITVPGVNANSL
FT                   NALSGLSFLNMLSLVSGNALKNFSIFALGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYIALVLAFVQSIGITAGFNTLAGAQLIKTALTPQVFLTIGIILTAGSM
FT                   IVTWLGEQITDKGYGNGVSMIIFAGIVSSIPEMIQGIYVDYFVNVPSSRITSSIIFVII
FT                   LIITVLLIIYFTTYVQQAEYKIPIQYTKVAQGAPSSSYLPLKVNPAGVIPVIFASSITA
FT                   APAAILQFLSATGHDWAWVRVAQEMLATTSPTGIAMYALLIILFTFFYTFVQINPEKAA
FT                   ESLQKSGAYIHGVRPGKGTEEYMSKLLRRLATVGSLFLGVISILPIAAKDVFGLSDVVA
FT                   FGGTSLLIIISTGIEGIKQLEGYLLKRKYVGFMDRTE"
FT   gene            233503..234141
FT                   /locus_tag="SPP_0281"
FT   CDS_pept        233503..234141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0281"
FT                   /product="adenylate kinase (ATP-AMP transphosphorylase)
FT                   (AK)(Superoxide-inducible protein 16) (SOI16)"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20606"
FT                   /db_xref="GOA:C1CIB8"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIB8"
FT                   /protein_id="ACO20606.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTEM
FT                   GVLAKSYIDKGELVPDEVTNGIVKERLSQDDIKETGFLLDGYPRTIEQAHALDKTLAEL
FT                   GIELEGIINIEVNPDSLLERLSGRIIHRVTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNIAQGEPIIAHYRAKGLVHDIEGNQDINDVFSDIEKVLTNLK"
FT   gene            234258..234476
FT                   /gene="infA"
FT                   /locus_tag="SPP_0282"
FT   CDS_pept        234258..234476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SPP_0282"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF01176; match to protein
FT                   family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21127"
FT                   /protein_id="ACO21127.1"
FT                   /translation="MAKDDVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYI
FT                   RILAGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            234501..234617
FT                   /gene="rpmJ"
FT                   /locus_tag="SPP_0283"
FT   CDS_pept        234501..234617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SPP_0283"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20827"
FT                   /db_xref="GOA:C1CIC0"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIC0"
FT                   /protein_id="ACO20827.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG"
FT   gene            234635..235000
FT                   /gene="rpsM"
FT                   /locus_tag="SPP_0284"
FT   CDS_pept        234635..235000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SPP_0284"
FT                   /product="ribosomal protein S13p/S18e"
FT                   /note="identified by match to protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21226"
FT                   /db_xref="GOA:C1CIC1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIC1"
FT                   /protein_id="ACO21226.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVRV
FT                   RDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            235018..235401
FT                   /gene="rpsK"
FT                   /locus_tag="SPP_0285"
FT   CDS_pept        235018..235401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SPP_0285"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20344"
FT                   /db_xref="GOA:C1CIC2"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIC2"
FT                   /protein_id="ACO20344.1"
FT                   /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSA
FT                   GALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKSVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   gene            235444..236379
FT                   /gene="rpoA"
FT                   /locus_tag="SPP_0286"
FT   CDS_pept        235444..236379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SPP_0286"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21111"
FT                   /protein_id="ACO21111.1"
FT                   /translation="MIEFEKPNITKIDENKDYGKFVIEPLERGYGTTLGNSLRRVLLAS
FT                   LPGAAVTSINIDGVLHEFDTVPGVREDVMQIILNIKGIAVKSYVEDEKIIELDVEGPAE
FT                   VTAGDILTDSDIEIVNPDHYLFTIGEGSSLKATMTVNSGRGYVPADENKKDNAPVGTLA
FT                   VDSIYTPVTKVNYQVEPARVGSNDGFDKLTLEILTNGTIIPEDALGLSARILTEHLDLF
FT                   TNLTEIAKSTEVMKEADTESDDRILDRTIEELDLSVRSYNCLKRAGINTVHDLTEKSEA
FT                   EMMKVRNLGRKSLEEVKLKLIDLGLGLKDK"
FT   gene            236391..236777
FT                   /gene="rplQ"
FT                   /locus_tag="SPP_0287"
FT   CDS_pept        236391..236777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SPP_0287"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20804"
FT                   /db_xref="GOA:C1CIC4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIC4"
FT                   /protein_id="ACO20804.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   gene            237042..237308
FT                   /locus_tag="SPP_0288"
FT   CDS_pept        237042..237308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0288"
FT                   /product="ACT domain protein"
FT                   /note="identified by match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20377"
FT                   /protein_id="ACO20377.1"
FT                   /translation="MKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMM
FT                   AVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFEAMYNI"
FT   gene            237318..238655
FT                   /locus_tag="SPP_0289"
FT   CDS_pept        237318..238655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05167"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21303"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIC6"
FT                   /protein_id="ACO21303.1"
FT                   /translation="MDIRQVTETIAMIEEQNFDIRTITMGISLLDCIDPDINRAAEKIY
FT                   QKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAK
FT                   EIGVDFIGGFSALVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVAD
FT                   MGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVKRA
FT                   LEKVRGQSFDVVAETVKKTAFKITRIGQLVGQMASERLGVEFGIVDLSLAPTPAVGDSV
FT                   ARVLEEMGLETVGTHGTTAALALLNDQVKKGGVMACNQVGGLSGAFIPVSEDEGMIAAV
FT                   QNGSLNLEKLEAMTAICSVGLDMIAIPEDTPAETIAAMIADEAAIGVINMKTTAVRIIP
FT                   KGREGDMIEFGGLLGTAPVMKVNGASSVDFISRGGQIPAPIHSFKN"
FT   gene            238899..239591
FT                   /locus_tag="SPP_0290"
FT   CDS_pept        238899..239591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0290"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20816"
FT                   /protein_id="ACO20816.1"
FT                   /translation="MVKVRLYLVRHGKTMFNTIGRAQGWSDTPLTAEGERGIQELGIGL
FT                   RESDLQFERAYSSDSGRTIQTMGIILEELGLQGKIPYRMDKRIREWCFGSFDGAYDGDL
FT                   FMGIIPRIFNVDHVHQLSYAELAEGLVEVDTAGWAEGWEKLSGRIKEGFEIIAKEMEDQ
FT                   GGGNALVVSHGMTIGTIVYLINGMHPHGLDNGSVTILEYEDGQFRVEVVGDRSYRELGR
FT                   EKMEEGSI"
FT   gene            complement(239694..241339)
FT                   /pseudo
FT                   /locus_tag="SPP_0291"
FT                   /note="ABC transporter membrane-spanning permease - iron
FT                   transport, authentic frameshift; this gene contains a frame
FT                   shift which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF00528"
FT   gene            complement(241329..242407)
FT                   /pseudo
FT                   /locus_tag="SPP_0293"
FT                   /note="Fe(3+) ions import ATP-binding protein FbpC,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts; identified by match to protein
FT                   family HMM PF00005; match to protein family HMM PF08402"
FT   gene            complement(242420..243541)
FT                   /pseudo
FT                   /locus_tag="SPP_0295"
FT                   /note="iron ABC transporter, iron-binding protein, internal
FT                   insertion; this region contains one or more premature stops
FT                   and/or frameshifts"
FT   gene            complement(244127..244903)
FT                   /locus_tag="SPP_0297"
FT   CDS_pept        complement(244127..244903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0297"
FT                   /product="pyruvate formate-lyase 3"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR02494"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20760"
FT                   /protein_id="ACO20760.1"
FT                   /translation="MEISKGIIFNIQHFSIHDGPGIRTTVFLKGCPLRCPWCSNPESQR
FT                   MKPEKMKDAQREKFTLVGEEKTVEEIITEVLKDKEFYEESGGGLTLSGGEIFAQFEFAK
FT                   AILKSAKEHHIHTAIETTAFVDHEKFIDLIQYVDFIYTDLKHYNSIKHKKVTGVFNQMI
FT                   IKNIHYAFSQNKTIVLRIPVIPNFNNSLEDAEKFATLFNSLNIDQVQLLPFHQFGENKY
FT                   RLLNRKYEMDGVNALHPEDLIDYQKVFLNHHINCYF"
FT   gene            245025..245771
FT                   /locus_tag="SPP_0298"
FT   CDS_pept        245025..245771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0298"
FT                   /product="putative HTH-type transcriptional regulator YciT"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220; match to protein
FT                   family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20177"
FT                   /protein_id="ACO20177.1"
FT                   /translation="MKRLEQIIKLVSEYEKIDVNTLSEKLNVSKVTIRKDLDKLESKGL
FT                   LHREHGYAVLNSGDDLNVRLSINYEIKRKIVQEAVKLVSDNETIMIESGSTCALLAEEI
FT                   CKQKRNVTIVTNSFFIANFVRAYDSCRIIVLGGEFQKDSQVTVGPLLKEMIQTFHVRQA
FT                   FVGTDGYDKEMGFTGKDLMRSEVVQYISAASDKVIVLTDSSKFDKRGTVRRFALSQVYE
FT                   VITDEKLSKQNIATLENAGIMVKVVS"
FT   gene            245784..246764
FT                   /locus_tag="SPP_0299"
FT   CDS_pept        245784..246764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0299"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF04198"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22023"
FT                   /protein_id="ACO22023.1"
FT                   /translation="MNQDRNKLLSKIAYLYYIENLNQSQIAAKLGIYRTSISRMLTEAR
FT                   NAGIVKIEIENFDTNMFKLENYVKEKYGLESLEIIPNEFDDNPTILSERISQVAAGILR
FT                   NLIDDNMKIGFSWGKSLSNLVDLIHSKSVRNVHFYPLAGGPSHIHAKYHVNTLIYEMSR
FT                   KFHGECTFMNATIVQENKLLADGILQSRYFENLKNSWKDLDIAVVGIGDFSNKGKHQWL
FT                   DMLTEDDFKELTKVKTVGEICCRFFDSKGKEVYENLQERTIAISLEDLKNIPQSLAVAY
FT                   GDTKVSSILSVLRANLVNHLITDKNTILKVLEEDGDLTFREILGE"
FT   gene            246959..247279
FT                   /locus_tag="SPP_0300"
FT   CDS_pept        246959..247279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0300"
FT                   /product="phosphotransferase system sugar-specific eiia
FT                   component"
FT                   /note="identified by match to protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21331"
FT                   /protein_id="ACO21331.1"
FT                   /translation="MEIIVPDQIIMGLILYAGDAKQHIYKALDYIKNGTCERCEEEIQL
FT                   ADAALLEAHNLQTKFLAQEASGTKTEITALFVHSQDHLMTSMTEINLIKEIISLRKELH
FT                   KK"
FT   gene            247325..247633
FT                   /locus_tag="SPP_0301"
FT   CDS_pept        247325..247633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0301"
FT                   /product="phosphotransferase system sugar-specific eiib
FT                   component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21117"
FT                   /protein_id="ACO21117.1"
FT                   /translation="MVKIGLFCAAGFSTGMLVNNMKIAAQASGVEAEIEAFSQSKLADY
FT                   APNIDVALLGPQVAYTLDKSKEICDKCDVPIAVIPMMDYGMLDGKKVLDLALSLISG"
FT   gene            247650..248948
FT                   /locus_tag="SPP_0302"
FT   CDS_pept        247650..248948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0302"
FT                   /product="lichenan permease iic component (pts system
FT                   lichenan-specific eiiccomponent) (eiic-lic)"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20430"
FT                   /protein_id="ACO20430.1"
FT                   /translation="MSKMDVQKIIAPMMKFVNMRGIIALKDGMLAILPLTVVGSLFLIM
FT                   GQLPFEGLNKSIASVFGANWTEPFMQVYSGTFAIMGLISCFSIAYSYAKNSGVEALPAG
FT                   VLSVSAFFILLRSSYIPKQGEAIGDAISKVWFGGQGIIGAIIIGLVVGSIYTFFIKRKI
FT                   VIKMPEQVPQAIAKQFEAMIPAFVIFLSSMIVYILAKSLTNGGTFIEMIYSAIQVPLQG
FT                   LTGSLYGAIGIAFFISFLWWFGVHGQSVVNGVVTALLLSNLDANKAMLASANLSLENGA
FT                   HIVTQQFLDSFLILSGSGITFGLVVAMLFAAKSKQYQALGKVAAFPAIFNVNEPVVFGF
FT                   PIVMNPVMFVPFILVPVLAAVIVYGAIATGFMQPFSGVTLPWSTPAILSGFLVGGWQGV
FT                   VTQLLVLVISTVVYFPFFKIQDRLAYQNEIKQS"
FT   gene            249099..251537
FT                   /locus_tag="SPP_0303"
FT   CDS_pept        249099..251537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0303"
FT                   /product="pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF02901; match to protein
FT                   family HMM TIGR01774"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21250"
FT                   /protein_id="ACO21250.1"
FT                   /translation="MVNTEVARTTIKTEYFGSLTERMNKYREDVLNKKPYIDAERAVLA
FT                   TRAYERYKEQPNVLKRAYMLKEILENMSIYIEEESMIAGNQASSNKDAPIFPEYTLEFV
FT                   LNELDLFEKRDGDVFYITEETKEQLRSIAPFWENNNLRARAGALLPEEVSVYMETGFFG
FT                   MEGKMNSGDAHLAVNYQKLLQFGLRGFEERARKAKVALDLTDPASIDKYHFYDSIFIVI
FT                   DAIKVYAKRFVALAKSLAENANPKRKKELLEIADICSRVPYEPATTFAEAIQSVWFIQC
FT                   ILQIESNGHSLSYGRFDQYMYPYMKADLESGKETEDSIVERLTNLWIKTITINKVRSQS
FT                   HTFSSAGSPLYQNVTIGGQTRDKKDAVNPLSYLVLKSVAQTHLPQPNLTVRYHAGLDAR
FT                   FMNECIEVMKLGFGMPAFNNDEIIIPSFIAKGVLEDDAYDYSAIGCVETAVPGKWGYRC
FT                   TGMSYMNFPKVLLITMNDGIDPASGKRFAPSFGHFKDMKNFSELENAWDKTLRYLTRMS
FT                   VIVENSIDLSLEREVPDILCSALTDDCIGRGKHLKEGGAVYDYISGLQVGIANLSDSLA
FT                   AIKKLVFEEERISPSQLWHALETDYAGEEGKVIQEMLIHDAPKYGNDDDYADKLVTAAY
FT                   DIYVDEIAKYPNTRYGRGPIGGIRYSGTSSISANVGQGRGTLATPDGRNAGTPLAEGCS
FT                   PSHNMDQHGPTSVLKSVSKLPTDEIVGGVLLNQKVNPQTLAKEEDKLKLIALLRTFFNR
FT                   LHGYHIQYNVVSRETLIDAQKHPEKHRDLIVRVAGYSAFFNVLSKATQDDIIGRTEHTL
FT                   "
FT   gene            251556..252224
FT                   /locus_tag="SPP_0304"
FT   CDS_pept        251556..252224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0304"
FT                   /product="fructose-6-phosphate aldolase"
FT                   /note="identified by match to protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21625"
FT                   /protein_id="ACO21625.1"
FT                   /translation="MEFMLDTLNLDEIKKWSEILPLAGVTSNPTIAKREGSINFFERIK
FT                   DVRELIGSTPSIHVQVISQDFEGILKDAHEIRRQAGDDIFIKVPVTPAGLRAIKVLKKE
FT                   GYHITATAIYTVIQGLLAIEVGADYLAPYYNRMENLNIDSNSVIRQLALAIDRQNSPSK
FT                   ILAASFKNVAQVNNALAAGAHAVTAGADVFESAFAMPSIQKAVDDFSDDWFVTQNSRSI
FT                   "
FT   gene            252242..253330
FT                   /locus_tag="SPP_0305"
FT   CDS_pept        252242..253330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0305"
FT                   /product="glycerol dehydrogenase (gldh)"
FT                   /EC_number="1.1.1.6"
FT                   /note="identified by match to protein family HMM PF00465;
FT                   match to protein family HMM PF01761"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20317"
FT                   /protein_id="ACO20317.1"
FT                   /translation="MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGK
FT                   RFEDYLHRYGFHIVLALFNGEASDNEINRVVALAEKENCDSIIGLGGGKTIDSAKAIAD
FT                   LIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYLFYSKNPDLVLVDTKVISQAPKRL
FT                   LASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLFADGLQAMAACEA
FT                   KVVTPALENIVEANTLLSGLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLV
FT                   QLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMP
FT                   FKISPSDVAQAIIAVDAYVNSK"
FT   gene            253785..256286
FT                   /gene="leuS"
FT                   /locus_tag="SPP_0306"
FT   CDS_pept        253785..256286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="SPP_0306"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22017"
FT                   /db_xref="GOA:C1CID7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CID7"
FT                   /protein_id="ACO22017.1"
FT                   /translation="MSFYNHKEIEPKWQGYWAEHHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLNDLDELDWSESIKDMQRN
FT                   WIGKSTGANVTFKVKGTDKEFTVFTTRPDTLFGATFTVLAPEHELVDAITSTEQAEAVA
FT                   DYKHQASLKSDLARTDLAKEKTGVWTGAYAINPVNGKEIPIWIADYVLASYGTGAVMAV
FT                   PAHDQRDWEFAKQFDLPIVEVLEGGNVEEAAYTEDGLHVNSDFLDGLNKEDAIAKIVAC
FT                   LEEKGCGQEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPESELPLVLPVTKDIR
FT                   PSGTGESPLANLTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADED
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DHRGALVATDKVEKRDGSFFHVETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITSKEIIAENNGALDKVYNETVKAVTE
FT                   QIESLKFNTAIAQLMVFVNAANKEDKLYVDYAKGFIQLIAPFAPHLAEELWQTVAATGE
FT                   SISYVAWPTWDESKLVEDEIEIVVQIKGKVRAKLMVAKDLSREELQEIALADEKVKVEI
FT                   DGKEIVKVISVPNKLVNIVVK"
FT   gene            256480..257175
FT                   /locus_tag="SPP_0307"
FT   CDS_pept        256480..257175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0307"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20979"
FT                   /protein_id="ACO20979.1"
FT                   /translation="MPVNEYGRMIGESMEGYTPGELPSIDFLEGRYARIEALSVEKHAE
FT                   DLLAVYGPDTPQEMWTYLFQEPVADMGELVSLLHQMLARKDRFYYAIIDKATGKALGSF
FT                   SLMRIDQNNRVIEVGAVTFSPELRGTRIGTEAQYLLARYVFEELNYRRYEWKCDALNLP
FT                   SRRAAERLSFIYEGTFRQAVVYKGRTRDTDWLSMIDKDWPQVKDRLETWLRPENFDKNG
FT                   QQYKSLREL"
FT   gene            257187..257603
FT                   /locus_tag="SPP_0308"
FT   CDS_pept        257187..257603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0308"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21396"
FT                   /protein_id="ACO21396.1"
FT                   /translation="MITIKKQEIVKLEDVLHLYQAVGWTNYTHQPEMLEQALSHSLVIY
FT                   LALDGDAVVGLIRLVGDGFSSVLVQDLIVLPIYQRQGIGSALMKEALEDYKDAYQVQLV
FT                   TEETERTLGFYRSMGFEILSTYNCIGMTWMNRKK"
FT   gene            258644..259642
FT                   /gene="ruvB"
FT                   /locus_tag="SPP_0309"
FT   CDS_pept        258644..259642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SPP_0309"
FT                   /product="holliday junction DNA helicase RuvB"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05491; match to protein
FT                   family HMM PF05496; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21898"
FT                   /db_xref="GOA:C1CIE0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIE0"
FT                   /protein_id="ACO21898.1"
FT                   /translation="MSRILDNEIMGDEELVERTLRPQYLREYIGQDKVKDQLQIFIEAA
FT                   KMRDEALDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPVIEKAGDLVAILNELEPG
FT                   DVLFIDEIHRLPMSVEEVLYSAMEDFYIDIMIGAGEGSRSVHLELPPFTLIGATTRAGM
FT                   LSNPLRARFGITGHMEYYAHADLTEIVERTADIFEMEITHEAASELALRSRGTPRIANR
FT                   LLKRVRDFAQIMGNGVIDDIITDKALTMLDVDHEGLDYVDQKILRTMIEMYSGGPVGLG
FT                   TLSVNIAEERETVEDMYEPYLIQKGFIMRTRSGRVATAKAYEHLGYEYSEK"
FT   gene            259623..260195
FT                   /locus_tag="SPP_0310"
FT   CDS_pept        259623..260195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06042"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20254"
FT                   /protein_id="ACO20254.1"
FT                   /translation="MNTVKNKQEILEAFRENPDMMAILTIIRDLGLKDSWLAAGSVRNF
FT                   IWNLLSDKSPFDHETDIDVIFFDPDFSYEETLLLEKKLREDFPQYQWELKNQVYMHQHS
FT                   PHTASYTSSRDAMSKYPERCTTVGLRLNEESDFELYAPYGLEDILNFQVRPTPHFLENE
FT                   DRMELYQTRLSKKNWQEKWKNLIFKNT"
FT   gene            260426..261184
FT                   /gene="uppS"
FT                   /locus_tag="SPP_0311"
FT   CDS_pept        260426..261184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="SPP_0311"
FT                   /product="di-trans,poly-cis-decaprenylcistransferase"
FT                   /EC_number="2.5.1.31"
FT                   /note="identified by match to protein family HMM PF01255;
FT                   match to protein family HMM TIGR00055"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21269"
FT                   /protein_id="ACO21269.1"
FT                   /translation="MFGFFKKDKAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQPRVFGH
FT                   KAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPELHA
FT                   NNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQD
FT                   VLDAKINPGDITEELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYF
FT                   TDTLWPDFDEAALQEAILAYNRRHRRFGGV"
FT   gene            261193..261996
FT                   /gene="cdsA"
FT                   /locus_tag="SPP_0312"
FT   CDS_pept        261193..261996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="SPP_0312"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="identified by match to protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21690"
FT                   /protein_id="ACO21690.1"
FT                   /translation="MTQDLQKRTLFAGIALAIFLPILMIGGLLLQIAIGIIAMLAMHEL
FT                   LKMRGLETMTMEGLLTLFATFALTIPLENYLTFLPVDGNVVAYSVLISIMLGTTVFSKS
FT                   YTIEDAVFPLAMSFYVGFGFNALLDARVAGLDKALLALCIVWATDSGAYLVGMNYGKRK
FT                   LAPRVSPNKTLEGALGGILGAILVTIIFMIVDSTVALPYGIYKMSVFAIFFSIAGQFGD
FT                   LLESSIKRHFGVKDSGKFIPGHGGVLDRFDSMLLVFPIMHLFGLF"
FT   gene            262018..263277
FT                   /gene="rseP"
FT                   /locus_tag="SPP_0313"
FT   CDS_pept        262018..263277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /locus_tag="SPP_0313"
FT                   /product="RIP metalloprotease RseP"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF02163;
FT                   match to protein family HMM TIGR00054"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22132"
FT                   /protein_id="ACO22132.1"
FT                   /translation="MLGILTFILVFGIIVVVHEFGHFYFAKKSGILVREFAIGMGPKIF
FT                   AHIGKDGTAYTIRILPLGGYVRMAGWGDDTTEIKTGTPVSLTLADDGKVKRINLSGKKL
FT                   DQTALPMQVTQFDFEDKLFIKGLVLEEEKTFAVDHDATVVEADGTEVRIAPLDVQYQNA
FT                   TIWGKLITNFAGPMNNFILGVVVFWVLIFMQGGVRDVDTNQFHIMPQGALAKVGVPETA
FT                   QITKIGSHEVSNWESLIQAVETETKDKTAPTLDVTISEKGSDKQVTVTPEDSQGRYLLG
FT                   VQPGVKSDFLSMFVGGFTTAADSALRILSALKNLIFQPDLNKLGGPVAIFKASSDAAKN
FT                   GIENILYFLAMISINIGIFNLIPIPALDGGKIVLNILEAIRRKPLKQEIETYVTLAGVV
FT                   IMVVLMIAVTWNDIMRLFFR"
FT   gene            263290..265143
FT                   /gene="proS"
FT                   /locus_tag="SPP_0314"
FT   CDS_pept        263290..265143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="SPP_0314"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF04073; match to protein family HMM TIGR00409"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20486"
FT                   /db_xref="GOA:C1CIE5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIE5"
FT                   /protein_id="ACO20486.1"
FT                   /translation="MKQSKIPIPTLREMPSDAQVISHALMLRAGYVRQVSAGVYSYLPL
FT                   ANRVIEKAKNIMRQEFEKIGAVEMLAPALLSAELWRESGRYETYGEDLYKLKNREKSDF
FT                   ILGPTHEETFTAIVRDSVKSYKQLPLNLYQIQPKYRDEKRPRNGLLRTREFIMKDAYSF
FT                   HANYDSLDSVYDEYKAAYERIFTRSGLDFKAIIGDGGAMGGKDSQEFMAITSARTDLDR
FT                   WVVLDKSVASFDEIPAEVQEEIKAELLKWIVSGEDTIAYSSESSYAANLEMATNEYKPS
FT                   NRVVAEEEVTRVATPDVKSIDEVAAFLNVPEEQTIKTLFYIADGELVAALLVGNDQLNE
FT                   VKLKNHLGADFFDVASEEEVANVVQAGFGSLGPVGLPENIKIIADRKVQDVRNAVVGAN
FT                   EDGYHLTGVNPGRDFTSEYVDIREVREGEISPDGQGVLNFARGIEIGHIFKLGTRYSAS
FT                   MGADVLDENGRAVPIIMGCYGIGVSRLLSAVMEQHARLFVNKTPKGEYRYAWGINFPKE
FT                   LAPFDVHLITVNVKDEEAQALTEKLEASLMGAGYEVLTDDRNERVGVKFSDSDLIGLPI
FT                   RITVGKKAADGIVEVKIKATGDTIEVHADNVLETLEILSKK"
FT   gene            265242..266621
FT                   /locus_tag="SPP_0315"
FT   CDS_pept        265242..266621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0315"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21553"
FT                   /protein_id="ACO21553.1"
FT                   /translation="MLRFPKDFVWGSSTSGPQTEGRVAGDGKGDNLWDYWFQVEPNRYY
FT                   NGIGSDKTSTFYENWERDIELLLETGHTAFRTSIQWSRIFPQGCGKVNPQGVDFYRKVF
FT                   EAIKAKGIRLLVNLYHFDLPFALQEDGDGWENKATVSAYEDYARFCFETYGDLVDQWIT
FT                   FNEPIVPVEFGYFYDAHYPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLN
FT                   LTPAYPRSQHPADVKAARIAALFQAQSFLDPSVLGTYPQELVEILHEHGLLPDATEEEL
FT                   ELIRDNTVDFLGVNYYQPLRVMAPRFAKHPESPLLPEHFYEPYVMPGRKINSHRGWEIY
FT                   EQGIYDIAQNIKENYGNIEWMLTENGMGVEGEEKFRQDGMIQDDYRIDFVKGHLRELHR
FT                   AIEDGANCKGYLIWTFIDCWSWLNSYKNRYGLVELDLETQERRLKKSGHWFKELSDNNG
FT                   F"
FT   gene            266814..268622
FT                   /gene="glmS"
FT                   /locus_tag="SPP_0316"
FT   CDS_pept        266814..268622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="SPP_0316"
FT                   /product="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21682"
FT                   /protein_id="ACO21682.1"
FT                   /translation="MCGIVGVVGNTNATDILIQGLEKLEYRGYDSAGIFVLDGADNHLV
FT                   KAVGRIAELSAKTAGVEGTTGIGHTRWATHGKPTEDNAHPHRSETERFVLVHNGVIENY
FT                   LEIKEEYLAGHHFKGQTDTEIAVHLIGKFAEEEGLSVLEAFKKALHIIRGSYAFALVDS
FT                   QDPEVIYVAKNKSPLLIGLGEGYNMVCSDAMAMIRETNQYMEIHDQELVIVKADSVEVQ
FT                   DYDGNRRERASYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLIQAYTDEAGQVVVDP
FT                   DIIKAVQDADRIYILAAGTSYHAGFASKKMLEELTDTPVELGISSEWGYGMPLLSKKPL
FT                   FIFISQSGETADSRQVLVKANEMGIPSLTVTNVPGSTLSREANYTMLLHAGPEIAVAST
FT                   KAYTAQIAALAFLAKAVGEANGNAKAQAFDLVHELSIVAQSIESTLSEKETIEAKVREL
FT                   LETTRNAFYIGRGQDYYVAMEASLKLKEISYIQCEGFAAGELKHGTIALIEEGTPVLAL
FT                   LSDPVLANHTRGNIQEVAARGAKVLTIAEENVAKDTDDIVLTTVHPYLSPISMVVPTQL
FT                   VAYFATLHRGLDVDKPRNLAKSVTVE"
FT   gene            complement(268634..268837)
FT                   /locus_tag="SPP_0317"
FT   CDS_pept        complement(268634..268837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0317"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21672"
FT                   /protein_id="ACO21672.1"
FT                   /translation="MKIKEQTRKLAAGCSKQCFEVVDRTDEVSNHTYGKATLTWFEEIF
FT                   EEYNTNLEYKQPICSQEKGLDN"
FT   gene            268894..269943
FT                   /locus_tag="SPP_0318"
FT   CDS_pept        268894..269943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0318"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22122"
FT                   /protein_id="ACO22122.1"
FT                   /translation="MVELGISTFGEITELEGTGQTYSHAERIRQLVAEIELADKVGLDV
FT                   YGIGEHHRADFAVSAPEIVLAAGAVNTKKIRLTSAVSILSSMDPIRLFQQYATIDALSN
FT                   GRAEIMAGRGSFTESFPLFGYDLKDYDSLFDEKLDLLQLVNEKTKLDWQGRLTQTIAGK
FT                   EVYPRPVQDKLPLWIATGGHVESTVKIAQAGLPIVYAIIGGNPRYFKKLIQAYREIGSE
FT                   AGHADKDLKVGAHSWGWIAEDGEQAVKDYFHPTKQVVDAISKDRPHWQELRYEQYLEQV
FT                   GPNGAMFVGNPDQVAEKLIRMIEDLGLDRFMLHLPLGSMPHDQVLRAIELFGTQVAPKV
FT                   RAYFAMKEA"
FT   gene            complement(270043..273813)
FT                   /locus_tag="SPP_0319"
FT   CDS_pept        complement(270043..273813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0319"
FT                   /product="pullulanase, extracellular"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF02922; match to protein family HMM PF03714;
FT                   match to protein family HMM PF04650; match to protein
FT                   family HMM TIGR01167; match to protein family HMM
FT                   TIGR01168; match to protein family HMM TIGR02102"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20185"
FT                   /protein_id="ACO20185.1"
FT                   /translation="MRKTPSHTEKKMVYSIRSLKNGTGSVLIGASLVLLAMATPTISSD
FT                   ESTPTTNEPNNRNTTTLAQPLTDTAAGSGKNESDISSPRNANASLEKTEEKPATEPTTS
FT                   TSPVTTETKAEEPIEDNYFRIHVKKLPEENKDAQGLWTWDDVEKPSENWPNGALSFKDA
FT                   KKDDYGYYLDVKLKGEQAKKISFLINNTAGKNLTGDKSVEKLVPKMNEAWLDQDYKVFS
FT                   YEPQPAGTVRVNYYRTDGNYDKKSLWYWGDVKNPSSAQWPDGTDFTATGKYGRYIDIPL
FT                   NEAAREFGFLLLDESKQGDDVKIRKENYKFTDLKNHSQIFLKDDDESIYTNPYYVHDIR
FT                   MTGAQHVGTSSIESSFSTLVGAKKEDILKHSNITNHLGNKVTITDVAIDEAGKKVTYSG
FT                   DFSDTKHPYTVSYNSDQFTTKTSWRLKDETYSYDGKLGADLKEEGKQVDLTLWSPSADK
FT                   VSVVVYDKNDPDKVVGTVALEKGERGTWKQTLDSTNKLGITDFTGYYYQYQIERQGKTV
FT                   LALDPYAKSLAAWNSDDAKIDDAHKVAKAAFVDPAKLGPQDLTYGKIHNFKTREDAVIY
FT                   EAHVRDFTSDPAIAKDLTKPFGTFEAFIEKLDYLKDLGVTHIQLLPVLSYYFVNELKNH
FT                   ERLSDYASSNSNYNWGYDPQNYFSLTGMYSSDPKNPEKRIAEFKNLINEIHKRGMGAIL
FT                   DVVYNHTAKVDIFEDLEPNYYHFMDADGTPRTSFGGGRLGTTHHMTKRLLVDSIKYLVD
FT                   TYKVDGFRFDMMGDHDAASIEEAYKAARALNPNLIMLGEGWRTYAGDENMPTKAADQDW
FT                   MKHTDTVAVFSDDIRNNLKSGYPNEGQPAFITGGKRDVNTIFKNLIAQPTNFEADSPGD
FT                   VIQYIAAHDNLTLFDIIAQSIKKDPSKAENYAEIHRRLRLGNLMVLTAQGTPFIHSGQE
FT                   YGRTKQFRDPAYKTPVAEDKVPNKSHLLRDKDGNPFDYPYFIHDSYDSSDAVNKFDWTK
FT                   ATDGKAYPENVKSRDYMKGLIALRQSTDAFRLKSLQDIKDRVHLITVPGQNGVEKEDVV
FT                   IGYQITAPNGDIYAVFVNADEKAREFNLGTAFAHLRNAEVLADENQAGSVGIANPKGLE
FT                   WTEKGLKLNALTATVLRVSQNGTSHESTAEEKPDSTPSKPEHQDPAPEARPDSTKPDAK
FT                   VADAENKPSQATADSQAEQPAQEAQASSVKEAVQNESVENSSKKNIPVTPDKQAELPNT
FT                   GIKNENKLLFAGISLLALLGLGFLLKNKKEN"
FT   gene            274230..274643
FT                   /gene="rpsL"
FT                   /locus_tag="SPP_0320"
FT   CDS_pept        274230..274643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SPP_0320"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20924"
FT                   /db_xref="GOA:C1CIF1"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIF1"
FT                   /protein_id="ACO20924.1"
FT                   /translation="MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLP
FT                   GVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA"
FT   gene            274663..275133
FT                   /gene="rpsG"
FT                   /locus_tag="SPP_0321"
FT   CDS_pept        274663..275133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SPP_0321"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21911"
FT                   /db_xref="GOA:C1CIF2"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIF2"
FT                   /protein_id="ACO21911.1"
FT                   /translation="MSRKNRAPKRDVLPDPLYNSQLVTRLINRVMLDGKRGTAASIVYG
FT                   AFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW"
FT   gene            275558..277639
FT                   /gene="fusA"
FT                   /locus_tag="SPP_0322"
FT   CDS_pept        275558..277639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="SPP_0322"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21050"
FT                   /db_xref="GOA:C1CIF3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIF3"
FT                   /protein_id="ACO21050.1"
FT                   /translation="MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQ
FT                   LPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLDQAQEYREKLVEAVAETD
FT                   EELMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSP
FT                   LDIPAIKGINPDTDAEETRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLQSGSYV
FT                   LNTSKGKRERIGRILQMHANSRQEIETVYSGDIAAAVGLKDTTTGDSLTDEKAKIILES
FT                   INVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLD
FT                   VLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLALKEAAKSAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGED"
FT   gene            277743..282134
FT                   /gene="polC"
FT                   /locus_tag="SPP_0323"
FT   CDS_pept        277743..282134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polC"
FT                   /locus_tag="SPP_0323"
FT                   /product="DNA polymerase III, alpha subunit, Gram-positive
FT                   type"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM PF02811; match to protein family HMM PF07733;
FT                   match to protein family HMM TIGR00573; match to protein
FT                   family HMM TIGR01405"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21657"
FT                   /protein_id="ACO21657.1"
FT                   /translation="MSNSFEILMNQLGIPVEMRQHPALTQADIERVVVHKISKVWEFHF
FT                   VFSNILPIEIFLELKKGLSEEFSKTGNKAVFEIKVLSQDFSNQLLQAYYREAFSEGPCA
FT                   SQSFKSLYQNLQVRAEGNQLFIEGSEAIDKEHFKKNHLPNLAKQLEKFGFPTFNCQVEK
FT                   NDVLTQEQEDAFHAENEQIVQAANEEALRAMEQLEQMAPPPAEEKPAFDFQTKKAAAKP
FT                   KLDKAEITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVK
FT                   NEEEAQKFDLIKKNSWLRVRGNVEMNNFTRDLTMNVQDVQEVVHYERKDLMPEGERRVE
FT                   FHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKKAGIQLIYG
FT                   MEANIVEDRVPIVYNEVERDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAE
FT                   FDEFINPGYPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNATFDVGF
FT                   MNANYERHGLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALEHHHMANYDAEA
FT                   TGRLLFIFIKEVAEKHGVTDLARLNIDLISPDSYKKARIKHATIYVKNQVGLKNIFKLV
FT                   SLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDAVVSQGVDAAVEVAKYYDFI
FT                   EVMPPAIYAPLIAKEQVKDMEELQTIIKNLIEIGDRLGKPVLATGNVHYIEPEEEIYRE
FT                   IIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEELARKLVIENTN
FT                   ALAEIFEPVEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSI
FT                   LGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQ
FT                   YSEFITDGSYGSGFDMPNKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGED
FT                   QPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKFYRDAEVERLAQGAA
FT                   GVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVL
FT                   GHDDPTMIRKLQDLSGIDPNEIPMDDEGVMALFSGTDVLGVTPEQIGTPTGMLGIPEFG
FT                   TNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMV
FT                   YLMHAGLEPKMAFTIMERVRKGLWLKISEEERNDYIEAMKANKVPEWYIESCGKIKYMF
FT                   PKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISE
FT                   KRKNNEASNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMD
FT                   GLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFDE
FT                   LF"
FT   gene            282236..282499
FT                   /locus_tag="SPP_0324"
FT   CDS_pept        282236..282499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0324"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="identified by match to protein family HMM PF04221;
FT                   match to protein family HMM TIGR02384"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22133"
FT                   /protein_id="ACO22133.1"
FT                   /translation="MSKMSISIRLDSEVKEQAQQVFSNLGMDMTTAINIFLRQAIQYQG
FT                   LPFDVRLDENRKLLQALTDLDQNRNMSQSFESVSDLMEDLRA"
FT   gene            282492..282770
FT                   /locus_tag="SPP_0325"
FT   CDS_pept        282492..282770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0325"
FT                   /product="DNA damage inducible protein"
FT                   /note="identified by match to protein family HMM PF05016;
FT                   match to protein family HMM TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22126"
FT                   /protein_id="ACO22126.1"
FT                   /translation="MLKIRYHKQFKKDFKLAMKRGLKAELLEEVLNFLVQEKEHPARYR
FT                   DHSLTASKHFQGVRECHTQPDWLLVYKVDKSELILNLLRTGSHSDLF"
FT   gene            282791..282943
FT                   /locus_tag="SPP_0326"
FT   CDS_pept        282791..282943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21986"
FT                   /protein_id="ACO21986.1"
FT                   /translation="MKLRIFAEDKPAKKVFEYQLELADRTILLSTALLSGAIALAGIFS
FT                   ALREK"
FT   gene            282965..284206
FT                   /locus_tag="SPP_0327"
FT   CDS_pept        282965..284206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0327"
FT                   /product="aminopeptidase PepS"
FT                   /EC_number="3.4.11.-"
FT                   /note="identified by match to protein family HMM PF02073"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21820"
FT                   /protein_id="ACO21820.1"
FT                   /translation="MVLPNFKENLEKYAKLLVANGINVQPGHTLALSIDVEQRELAHLI
FT                   VKEAYALGAHEVIVQWTDDVINREKFLHAPMERLDNVPEYKIAEMNYLLENKASRLGVR
FT                   SSDPGALNGVDADKLSASAKAMGLAMKPMRIATQSNKVSWTVAAAAGLEWAKKVFPNAA
FT                   SDEEAVDFLWDQIFKTCRVYEADPVKAWEEHAAILKSKADMLNKEQFSALHYTAPGTDL
FT                   TLGLPKNHVWESAGAVNAQGEEFLPNMPTEEVFTAPDFRRADGYVTSTKPLSYNGNIIE
FT                   GIKVTFKDGQIVDITAEKGDQVMKDLVFENAGARALGECALVPDPSPISQSGITFFNTL
FT                   FDENASNHLAIGAAYATSVVDGAEMSEEELEAAGLNRSDVHVDFMIGSNQMDIDGIRED
FT                   GTRVPLFRNGNWAN"
FT   gene            284216..284446
FT                   /locus_tag="SPP_0328"
FT   CDS_pept        284216..284446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0328"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF04226"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20647"
FT                   /protein_id="ACO20647.1"
FT                   /translation="MLGSMFVGLLVGFLAGAMTNRGERMGCFGKMFLGWIGAFLGHLLF
FT                   GTWGPVLSGTAIIPAILGAMIVLAIFWRRGS"
FT   gene            284669..285391
FT                   /locus_tag="SPP_0329"
FT   CDS_pept        284669..285391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0329"
FT                   /product="ribosomal small subunit pseudouridine synthase A,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20905"
FT                   /protein_id="ACO20905.1"
FT                   /translation="MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKI
FT                   DEIRFDGQVLEYEEFVYYMMNKPKGVISATEDPKHRTVLDLLDDLARSKEVFPVGRLDI
FT                   DTHGLLLLTNDGQLAHVLLSPKRHVDKTYLAQVKGIMTQEDVETFAEGIPLKDFTCQPA
FT                   ILELVSIDTEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTMGTLVLDENLERG
FT                   EWRRLTKEELEILRANII"
FT   gene            285608..286942
FT                   /locus_tag="SPP_0330"
FT   CDS_pept        285608..286942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0330"
FT                   /product="aminopeptidase C (Bleomycin hydrolase)"
FT                   /EC_number="3.4.22.40"
FT                   /note="identified by match to protein family HMM PF03051"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21384"
FT                   /protein_id="ACO21384.1"
FT                   /translation="MNAIQESFTDKLFANYEANVKYQAIENAASHNGIFAALERRQSRV
FT                   DNTPVFSLDLTKDKVTNQKASGRCWMFAALNTFRHKLISQYKLENFELSQAHTFFWDKY
FT                   EKSNWFLEQVIATSDQELTSRKVSFLLQTPQQDGGQWDMVVSLFEKYGVVPKSVYPESV
FT                   SSSSSRELNAVLNKLLRQDAQILRDLLVSGADQVTVQAKKEDLLQEIFNFLAMSLGLPP
FT                   RKFDFAYRDKDNNYKSEKGITPQEFYKKYVNLPLEDYVSVINAPTADKPYGKSYTVEML
FT                   GNVVGSRAVRYINVPMERLKELAIAQMQAGETVWFGSDVGQLSNRKAGILATDVYDFES
FT                   SMDIKLTQDKAGRLDYSESLMTHAMVLTGVDLDENGKSTKWKVENSWGDKVGTDGYFVA
FT                   SDAWMDEYTYQIVVRKELLTAEEQAAYGAEPIVLAPWDPMGALAE"
FT   gene            complement(286998..287909)
FT                   /locus_tag="SPP_0331"
FT   CDS_pept        complement(286998..287909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0331"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /note="identified by match to protein family HMM PF03613;
FT                   match to protein family HMM TIGR00828"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21968"
FT                   /protein_id="ACO21968.1"
FT                   /translation="MTEKLQLTKSDRKKVWWRSTFLQGSWNFERMQNLGWAYTLIPAIK
FT                   KLYTKKEDQIAALERHLEFFNTHPYVAAPVMGVTLALEEERANGVEIDDAAIQGVKIGM
FT                   MGPLAGIGDPVFWFTVRPILGSLGASLALTGNILGPLLFFVAWNLIRMSFLWYVQEIGY
FT                   KAGSEITKDMSGGILQDITKGASILGMFILAVLVQRWVNIKFAFDVSKVQLDEKAYIHW
FT                   DKLPEGSKGIQEAFAQVGQGLSQTPEKVTTFQQNLDMLIPGLSGLLLTLLCMYLLKKKV
FT                   SPITIILALFAVGIVAHVLHIM"
FT   gene            complement(287933..288736)
FT                   /locus_tag="SPP_0332"
FT   CDS_pept        complement(287933..288736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0332"
FT                   /product="PTS system sorbose-specific IIC component"
FT                   /note="identified by match to protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20978"
FT                   /protein_id="ACO20978.1"
FT                   /translation="MSIISMVLVVVVAFFAGLEGILDQFQFHQPLVACTLIGLVTGHLE
FT                   AGIILGGSLQMIALGWSNIGAAIAPDAALASVAAAIIMVLGGDFTKTGIGVAQAVAIPL
FT                   AVAGLFLTMIVRTISVGLVHTADAAAKKGDFGAVERAHFIALLFQGLRIALPAALLLMV
FT                   PTETVQSILSAMPDWLKDGMAIGGGMVVAVGYAMVINMMATREVWPFFALGFVLAAVSD
FT                   ITLIGFGAIGVAIALIYLHLSKTGGNGGGGAATSNDPIGDILEDY"
FT   gene            complement(288764..289753)
FT                   /locus_tag="SPP_0333"
FT   CDS_pept        complement(288764..289753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0333"
FT                   /product="mannose-specific phosphotransferase system
FT                   component iiab"
FT                   /note="identified by match to protein family HMM PF03610;
FT                   match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21596"
FT                   /protein_id="ACO21596.1"
FT                   /translation="MSIGIIIASHGEFAAGIHQSGSMIFGEQEKVQVVTFMPNEGPDDL
FT                   YAKFNNAVAAFDAEDEVLVLADLWSGSPFNQASRVMGENPERKFAIITGLNLPMLIQAY
FT                   TERLMDAAAGVEKVAANIIKEAKDGIKALPEELNPVEEVASAAAAPVAQTAIPEGTVIG
FT                   DGKLKINLARLDTRLLHGQVATAWTPDSKANRIIVASDNVAKDDLRKELIKQAAPGNVK
FT                   ANVVPIQKLIEISKDPRFGETHALILFETPQDALRAIEGGVPIKTLNVGSMAHSTGKTL
FT                   VNTVLSMDKEDVATFEKMRDLGVEFDVRKVPNDSKKDLFDLINKANVK"
FT   gene            complement(289986..291005)
FT                   /locus_tag="SPP_0334"
FT   CDS_pept        complement(289986..291005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0334"
FT                   /product="alcohol dehydrogenase, propanol-preferring"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22183"
FT                   /protein_id="ACO22183.1"
FT                   /translation="MKAVVVNPESTGVAIEEKVLRPLETGEALVEVEYCGVCHTDLHVA
FT                   HGDFGQVPGRVLGHEGIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLC
FT                   RTVKNAGYSVDGGMAEQCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKIEPG
FT                   QWVVLYGAGGLGNLAVQYAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVAG
FT                   LIKEKTDGGAHSAVVTAVSKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQ
FT                   VIGSLVGTRKDLEEAFQFGAEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH"
FT   gene            complement(291114..291260)
FT                   /locus_tag="SPP_0335"
FT   CDS_pept        complement(291114..291260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0335"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21604"
FT                   /protein_id="ACO21604.1"
FT                   /translation="MKLTWFEEIFEEYDQLASWSLCSFHSLINQLIDCSTFCLQNLGKG
FT                   FLL"
FT   gene            complement(291344..292156)
FT                   /locus_tag="SPP_0336"
FT   CDS_pept        complement(291344..292156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0336"
FT                   /product="Cof family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21171"
FT                   /protein_id="ACO21171.1"
FT                   /translation="MTKKIIAVDLDGTLLNSDSQISDFTKKTIKKVAEKGHQVIITTGR
FT                   PYRMSKDFYRELGLDTPMINFNGSLTHLPDQVWDFEKCLTVDKKYLLDMVQRSEDIQAD
FT                   FIAGEYRKKFYITNPNEEIANPKLFGVEAFQPEDQFQPELVTKDPNCILLQTRASDKYA
FT                   LAKDMNAFYQHQLSINTWGGPLNILECTPKGVNKAFALDYLLKIMNRDKKDLIAFGDEH
FT                   NDTEMLAFAGKGYAMKNANPELLPYADEQISLTNDQDGVAKTLQDLFL"
FT   gene            292346..293764
FT                   /locus_tag="SPP_0337"
FT   CDS_pept        292346..293764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0337"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20963"
FT                   /protein_id="ACO20963.1"
FT                   /translation="MDKLFKLKENGTDVRTEVLAGLTTFFAMSYILFVNPQILSQTGMP
FT                   AQGVFLATIIGAVAGTLMMAFYANLPYAQAPGMGLNAFFTFTVVFGLGYSWQEALAMVF
FT                   ICGIISLIITLTNVRKMIIESIPNALRSAISAGIGVFLAYVGIKNAGLLKFTIDPGNYT
FT                   VVGEGADKAQATIAANSSAVPGLVSFNNPAVLVALAGLAITIFFVIKGIKGGIILSILT
FT                   TTVLAIAVGLVDLSSIDFANNHVGAAFEDLKTIFGAALGSEGLGALVSDTARLPETLMA
FT                   ILAFSLTDIFDTIGTLIGTGEKVGIVATNGENHQSAKLDKALYSDLIGTTVGAIAGTSN
FT                   VTTYVESAAGIGAGGRTGLTALVVAICFAISSFFSPLLAIVPTAATAPILIIVGIMMLG
FT                   SLKNIHWDDMSEAVPAFFTSIFMGFSYSITQGIAVGFLTYTLTKLVKGQVKDVHVMIWI
FT                   LDALFILNYISMAL"
FT   gene            293817..294524
FT                   /locus_tag="SPP_0338"
FT   CDS_pept        293817..294524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0338"
FT                   /product="caax amino protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21522"
FT                   /protein_id="ACO21522.1"
FT                   /translation="MKEKNMWKELLNRAGWILVFLLAVLLYQVPLVVTSILTLKEVALL
FT                   QSGLIVTGISIVVLVLFIIGARKTQLASFNFSFFRTKDLARLGLSYLVIICSNILGSIL
FT                   LQLSNETTTANQSQINDMVQNSSLISSFFLLALLAPICEEILCRGIVPKKIFRGKENLG
FT                   FVVGTIVFALLHQPSNLPSLLIYGGMSTVLSWTAYKTQRLEMSILLHMIVNGIAFCLLA
FT                   LVVIMSRTLGISV"
FT   gene            294620..295600
FT                   /gene="folP"
FT                   /locus_tag="SPP_0339"
FT   CDS_pept        294620..295600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="SPP_0339"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22020"
FT                   /protein_id="ACO22020.1"
FT                   /translation="MMKSLEGVTDMSSKANHAKTAICGIINVTPDSFSDGGQFFVLEQA
FT                   LQQARKLIAEGASMLDIGGESTRPRPGSSYVEIEEEIQRVVPVIKAIRKESDVLISIDT
FT                   RKSQVAEAALAAGANLVNDITGLMGDEKMAHVVAKAGAKVVIMFNPVMARPQHPSSLIF
FT                   PHFGFGQTFTEKELADFETLPIEEMMEAFFERALARAAEAGIAPENILLDPGIGFGLTK
FT                   KENLLLLRDLDKLHQKGYPIFLGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHV
FT                   TSIAARQGVEVVRVHDVASHRMAVEIASAIRLADEAENLDLKQYK"
FT   gene            295602..296924
FT                   /locus_tag="SPP_0340"
FT   CDS_pept        295602..296924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0340"
FT                   /product="dihydrofolate synthetase"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20393"
FT                   /protein_id="ACO20393.1"
FT                   /translation="MKEIENNQWIANYRTDQPHFGLERMVELLALRGNPHLKLKVLHIG
FT                   GTNGKGSTIAFLKKMLEKLGLRVGVFSSPYLIHYTDQISINGESISEARLEALMADYQS
FT                   LLEGEAVANLQGTTEFEIITALAYDYFASEQVDVAIMEVGMGGLLDSTNVCQPILTGIT
FT                   TIGLDHVALLGDTLEAIAEQKAGIIKQGMPLVTGRIAPEALTVIDRIAEGKDAPRLAYG
FT                   TDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQIENAGMAIALLDTFCQEDGREL
FT                   ASNDFLGQALEETSWPGRLEIVSRDPLMILDGAHNPHAIKALLVTLQERFADYHKEILF
FT                   TCIKTKALEDMLALLGAMPDTELTLTHFADSRATDESVLKEAAKSRNLSYQDWHDFLDQ
FT                   NLTDKKEEKQTVRIVTGSLYFLSQVRAYLMERKNENGYTKD"
FT   gene            296905..297459
FT                   /gene="folE"
FT                   /locus_tag="SPP_0341"
FT   CDS_pept        296905..297459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="SPP_0341"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227;
FT                   match to protein family HMM TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21099"
FT                   /db_xref="GOA:C1CIH2"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIH2"
FT                   /protein_id="ACO21099.1"
FT                   /translation="MDTQKIEAAVKMIIEAVGENANREGLQETPARVARMYQEIFSGLG
FT                   QTAEEHLSKSFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLAR
FT                   TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTV
FT                   ARGLFETDKDLRDQAYRLMGL"
FT   gene            297502..298314
FT                   /locus_tag="SPP_0342"
FT   CDS_pept        297502..298314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0342"
FT                   /product="bifunctional folate synthesis protein"
FT                   /EC_number="4.1.2.25"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM PF02152; match to protein
FT                   family HMM TIGR00525; match to protein family HMM
FT                   TIGR00526; match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21564"
FT                   /protein_id="ACO21564.1"
FT                   /translation="MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDL
FT                   DLTASVHYGELCQQWTTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPV
FT                   HLSLDTCSVTIHRRKQRAFIALGSNMGDKQANLKQAIDKLRARGIHILKESSVLATEPW
FT                   GGVEQDSFANQVVEVETWLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQI
FT                   LYTDDLILPHPYIAERLFVLESLQEIAPHFIHPILKQPIRNLYDALKK"
FT   gene            complement(298359..298676)
FT                   /locus_tag="SPP_0343"
FT   CDS_pept        complement(298359..298676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20229"
FT                   /protein_id="ACO20229.1"
FT                   /translation="MAFTNTHMRSASFGIVTSLPDDIIDSFWYIIDHFLKNVFELEEEL
FT                   EFQLLNNQGKITFHFSSQHLPTAIDFDFNHPFDPRYPPRVLVLDMDGRETILLPEENDL
FT                   F"
FT   gene            299033..299479
FT                   /gene="rplM"
FT                   /locus_tag="SPP_0344"
FT   CDS_pept        299033..299479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SPP_0344"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by match to protein family HMM PF00572;
FT                   match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20687"
FT                   /protein_id="ACO20687.1"
FT                   /translation="MNKTTFMAKPGQVERKWYVVDATDVPLGRLSAVVASVLRGKNKPT
FT                   FTPHTDTGDFVIVINAEKVKLTGKKATDKIYYTHSNHPGGLKQISAGELRSKNAVRLIE
FT                   KSVKGMLPHNTLGRAQGMKLKVFVGAEHTHAAQQPEVLDISGLI"
FT   gene            299498..299890
FT                   /gene="rpsI"
FT                   /locus_tag="SPP_0345"
FT   CDS_pept        299498..299890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SPP_0345"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20275"
FT                   /db_xref="GOA:C1CIH6"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIH6"
FT                   /protein_id="ACO20275.1"
FT                   /translation="MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLR
FT                   LVINQPFAVTSTVGSYDVFVNVIGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLL
FT                   TRDSRKVERKKPGLKKARKASQFSKR"
FT   gene            complement(300152..300574)
FT                   /locus_tag="SPP_0346"
FT   CDS_pept        complement(300152..300574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0346"
FT                   /product="integrase/recombinase, phage integrase family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21004"
FT                   /protein_id="ACO21004.1"
FT                   /translation="MRFIVETFPIFSISNDLLQLLTSWKKQQKYELAKFGIISNPEQFI
FT                   FTYIDTKGNINKPLHSDYLNNKMKTIRKRHPELTHATPHKLRHTGATLAKQAGMSLEAI
FT                   SEALIHSDTGTTQIYVNTSNVVPMAVGEFALQSLKQ"
FT   gene            300721..300897
FT                   /locus_tag="SPP_0347"
FT   CDS_pept        300721..300897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20416"
FT                   /protein_id="ACO20416.1"
FT                   /translation="MSLDIDKEKMTIMGIAFENRSVFKSVWYALSTNMIEGWRPTVSDV
FT                   EKLRDEALALGMT"
FT   gene            301299..303512
FT                   /locus_tag="SPP_0348"
FT   CDS_pept        301299..303512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0348"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /note="identified by match to protein family HMM PF01055"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22216"
FT                   /protein_id="ACO22216.1"
FT                   /translation="MKIFKGEFYRISVLTDKLVRLEYSRTGNFEDRTTQLIYNRDFGQV
FT                   SLDYIETSNVLDIMTDYFHLHFNKGEFNAENLFIELKGNFAVYGSRWYFGESIETLKGT
FT                   ARTLDKADGAISLEDGIISRNGIALLDDSQGFIWDEQSGYIERENQIDLYFFAYGHDYR
FT                   GAIRDFYHLTGSTPLLPRYALGNWWSRYWPYTSDEYLDLIDRFETEKIPLSIGVLDMDW
FT                   HITDIPARFGSGWTGYSWNRNLIPNPEQLLQQLHDRKLKLSLNVHPADGIRAYEEAYPQ
FT                   IAKRLGLNVELEEPAIFDFFNPSFREAYFKDVHYELEKQGVDFWWIDWQQGTQGMLDPL
FT                   WLLNHYHYQDSCKNAEGGLILSRYAGPGSHRYPVGFSGDTIISWNSLRFQPYFTATASN
FT                   IGYSWWSHDIGGHMLGDYDEELQTRWLQFGVFSPITRLHSSRSPFNSKEPWFFSETTSK
FT                   IMKKYLRLRHQMIPYLYTMNVKTHEEGAPLISPIYYFYPENDESYNVPNQYFFGTELMV
FT                   APIVEKMDLTFQSAKVDVWFPEGEWYDFFSEKKYTGGVKLSVYRDISTTPVFAKSGAII
FT                   PLVGSEIGMGVDLPEVVDWYVFPGKQHSFEMLEDQNGQRYKTRLSIDWEMGMVELALQG
FT                   DSSIVPSNRKHRIHFKGTNVSIIELPNKNDTAKFEWKDNKRTSLNDEVFRLLKTASLPY
FT                   ELKDRLLNQFINAKNSHDLMNILHHQDKELRGRLLEMIFTSQN"
FT   gene            complement(303734..304210)
FT                   /locus_tag="SPP_0349"
FT   CDS_pept        complement(303734..304210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0349"
FT                   /product="peroxiredoxin Hyr1 (hydrogen peroxide
FT                   resistanceprotein 1) (oxidant receptor peroxidase 1)
FT                   (glutathione peroxidase 3)(phospholipid hydroperoxide
FT                   glutathione peroxidase 3) (phgpx3)"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by match to protein family HMM PF00255"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21745"
FT                   /protein_id="ACO21745.1"
FT                   /translation="MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGL
FT                   QELYERYQDQGFEILDFPCNQFMGQAPGSAEEINAFCSLHFQTTFPRFAKIKVNGKEAD
FT                   PLYVWLKDQKSGPLGKRVEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL"
FT   gene            304433..307636
FT                   /locus_tag="SPP_0350"
FT   CDS_pept        304433..307636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0350"
FT                   /product="hyaluronate lyase"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF02018; match to protein
FT                   family HMM PF02278; match to protein family HMM PF02884;
FT                   match to protein family HMM PF08124; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21275"
FT                   /protein_id="ACO21275.1"
FT                   /translation="MQTKTKKLIVSLSSLVLSGFLLNHYMTVGAEETTTNTIQQSQKEV
FT                   QYQQRDTKNLVENGDFGQTEDGSSSWTGSKAQGWSAWVDQKNSSADASTRVIEAKDGAI
FT                   TISSHEKLRAALHRMVPIEVKKKYKLRFKIKTDNKVGIAKVRIIEESGKDKRLWNSATT
FT                   SGTKDWQTIEADYSPTLDVDKIKLELFYETGTGTVSFKDIELVEVAAQLSEDSQTDKQL
FT                   EEKIDLPIGKKHVFSLADYTYKVENPDVASVKNGILEPLKGGTTNVIVSKDGKEVKKIP
FT                   LKILASVKDTYTDRLDDWNGIIAGNQYYDSKNEQMAKLNQELEGKVADSLSSISSQADR
FT                   TYLWEKFSNYKTSANLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVRDSMEWMHKHVY
FT                   NSEKSIVGNWWDYEIGTPRAINNTLSLMKEYFSDEEIKKYTDVIEKFVPDPEHFRKTTD
FT                   NPFKALGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGEGFYQDGSYIDH
FT                   TNVAYTGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWIDKSFAPLLVNGELMDM
FT                   SRGRSISRANSEGHVAAVEVLRGIHRIADMSEGETKQRLQSLVKTIVQSDSYYDVFKNL
FT                   KTYKDISLMQSLLSDAGVASVPRPSYLSAFNKMDKTAMYNAEKGFGFGLSLFSSRTLNY
FT                   EHMNKENKRGWYTSDGMFYLYNGDLSHYSDGYWPTVNPYKMPGTTETDAKRADSDTGKV
FT                   LPSAFVGTSKLDDANATATMDFTNWNQTLTAHKSWFMLKDKIAFLGSNIQNTSTDTAAT
FT                   TIDQRKLESSNPYKVYVNDKEASLTEQEKDYPETQSVFLESSDSKKNIGYFFFKKSSIS
FT                   MSKALQKGAWKDINEGQSDKEVENEFLTISQAHKQNGDSYGYMLIPNVGRATFNQMIKK
FT                   LESSLIENNETLQSVYDAKQGVWGIVKYDDSVSTISNQFQVLKRGVYTIRKEGDEYKIA
FT                   YYNPETQESAPDQEVFKKLEQAAQPQVQNSKEKEKSEEEKNHSDQKNLPQTGEGQSILA
FT                   SLGFLLLGAFYLFRRGKNN"
FT   gene            308050..308403
FT                   /pseudo
FT                   /locus_tag="SPP_0351"
FT                   /note="hypothetical protein; this region contains one or
FT                   more premature stops and/or frameshifts;identified by
FT                   glimmer; putative"
FT   gene            complement(308779..309408)
FT                   /locus_tag="SPP_0352"
FT   CDS_pept        complement(308779..309408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0352"
FT                   /product="keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate
FT                   aldolase"
FT                   /note="identified by match to protein family HMM PF01081;
FT                   match to protein family HMM TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21300"
FT                   /protein_id="ACO21300.1"
FT                   /translation="MTKSDTIIELKKQKIVAVIRGNTKEEGLQASIACIKGGIKAIEIA
FT                   YTNQYAGQIIKELVDLYQDDQSVCIGAGTVLDAVTARDAILAGANYVVSPSFHAETAKM
FT                   CNLYSTPYIPGCITLTEITTALEAGSEIIKLFPGSTLSPAYISAVKAPIPQVSVMVTGG
FT                   VGLNNIPQWFAAGADAVGIGGELNKLASQGNFDRISEIAQQYITLR"
FT   gene            complement(309418..310419)
FT                   /locus_tag="SPP_0353"
FT   CDS_pept        complement(309418..310419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0353"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21006"
FT                   /protein_id="ACO21006.1"
FT                   /translation="MTKILLFGEPLIRISPLDATSIGDHVASSTYFGGSEINIACNLQA
FT                   LGISTKVFTALPANEIGDRFLTFLKQHQIDTSSICRLGDRIGLYYLENGFGCRQSEVFY
FT                   DRKHTSISQIRPNMLDMDSLFQGISHFHFSGITVAIGQEVRAILLLLLEEAKRRGIVVS
FT                   MDLNLRTKMISVLEAKYEFSKFARFTDYCFGIDPLMIDDQNLEMFPRDSASLEEVENRM
FT                   RLLKEAYGFKAIFHTLRSSDEQDKNVYQAYALEELFEESVQLKTAVYQRIGSGDAFISG
FT                   ALYQLLHHSSLKTTIDFAVASATLKCTLPGDHLSTSATSIENLLANAQDIIR"
FT   gene            complement(310450..311091)
FT                   /locus_tag="SPP_0354"
FT   CDS_pept        complement(310450..311091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0354"
FT                   /product="ribose 5-phosphate isomerase RpiB"
FT                   /note="identified by match to protein family HMM PF02502"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20405"
FT                   /protein_id="ACO20405.1"
FT                   /translation="MKIALINENSQASKNHIIYDSLKEATDKKDYQLFNYGMRGEEGES
FT                   QLTYVQNGLMAAILLNTKAVDFVVTGCGTGVGAMLALNSFPGVVCGLAVDPTDAYLYSQ
FT                   INGGNALSIPYAKGFGWGAELTLKLMFERLFAEEMGGGYPRERVIPEQRNARILNEVKQ
FT                   ITHNDLMTILKTIDQDFLKDTISGKYFQEYFFENCQDDEVAAYLKEVLAK"
FT   gene            complement(311110..311925)
FT                   /locus_tag="SPP_0355"
FT   CDS_pept        complement(311110..311925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0355"
FT                   /product="gluconate 5-dehydrogenase (5-keto-D-gluconate
FT                   5-reductase)"
FT                   /EC_number="1.1.1.69"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22174"
FT                   /protein_id="ACO22174.1"
FT                   /translation="MTNTSFSIEQFSLKGKIALITGASYGIGFAIAKSYAEAGATIVFN
FT                   DINQDLVNKGIKAYREVGIEAHGYVCDVTDEDGIQAMVKQIEQEIGVIDILVNNAGIIR
FT                   RVPMCEMSAADFRKVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSA
FT                   YAAAKGGLKMLTRNIASEYGGANIQCNGIGPGYIATPQTAPLRELQEDGSRHPFDQFII
FT                   AKTPAARWGNPEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQPE"
FT   gene            312196..312630
FT                   /locus_tag="SPP_0356"
FT   CDS_pept        312196..312630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0356"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21438"
FT                   /protein_id="ACO21438.1"
FT                   /translation="MKIVLVGHGHFATGIYSSLQLIAGNQENVEAIDFVEGMSADELKQ
FT                   KILLAISNEEEVLILSDLLGGSPFKVSSTIMGENPAKTMNVLSGLNLAMLMEAVFARMA
FT                   HSFDEVVNKSVVAAQGGVVNGKELFSTDAEEEEEDFESGI"
FT   gene            312642..313832
FT                   /locus_tag="SPP_0357"
FT   CDS_pept        312642..313832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0357"
FT                   /product="unsaturated glucuronyl hydrolase (UGL)
FT                   (Glycuronidase)(Unsaturated uronic acid hydrolase)
FT                   (Glycosaminoglycan hydrolase)"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF07470"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22103"
FT                   /protein_id="ACO22103.1"
FT                   /translation="MIKKVTIEKIKSPERFLEVPLLTKEEVGQAIDKVIRQLELNLDYF
FT                   KEDFPTPATFDNVYPIMDNTEWTNGFWTGELWLAYEYSQQDAFKNIAHKNVLSFLDRVN
FT                   KRVELDHHDLGFLYTPSCMAEYKINGDGEAREAALKAADKLIERYQEKGGFIQAWGDLG
FT                   KKEHYRLIIDCLLNIQLLFFAYQETGDQKYYDIAESHFYASANNVIRDDASSFHTFYFD
FT                   PETGQPFKGVTRQGYSDDSCWARGQSWGVYGIPLTYRHLKDESCFDLFKGVTNYFLNRL
FT                   PKDHVSYWDLIFNDGSDQSRDSSATAIAVCGIHEMLKHLPEVDADKDIYKHAMHAMLRS
FT                   LIEYYANDQFTPGGTSLLHGVYSWHSGKGVDEGNIWGDYYYLEALIRFYKDWNLYW"
FT   gene            313843..314334
FT                   /locus_tag="SPP_0358"
FT   CDS_pept        313843..314334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0358"
FT                   /product="N-acetylgalactosamine-specific phosphotransferase
FT                   enzyme iib component2 (pts system
FT                   n-acetylgalactosamine-specific eiibcomponent 2)
FT                   (eiib-aga')"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21472"
FT                   /protein_id="ACO21472.1"
FT                   /translation="MTMPNIIMTRIDERLIHGQGQLWVKYLGCNTVIVANDEVSTDKMQ
FT                   QTLMKTVVPDSVAMRFFPLQKVIDIIHKANPAQTIFIVVKDVKDALTLVEGGVPIKEIN
FT                   IGNIHNAPGKEQVTRSIFLGEEDKAALKELSQTHQVTFNTKTTPTGNDGAVQVNIMDYI
FT                   "
FT   gene            314349..315128
FT                   /locus_tag="SPP_0359"
FT   CDS_pept        314349..315128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0359"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="identified by match to protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21145"
FT                   /protein_id="ACO21145.1"
FT                   /translation="MSINVFQAILIGLWTAFCFSGMLLGIYTNRCIVLSFGVGIILGDL
FT                   PTALAMGAIGELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVSPEAALALSTPI
FT                   AVAIQFLQTFAYTVRAGAPETAMKHLKNHNLKKFKFTLNATIWLFAFIGFTLGCLGALS
FT                   MDTLLKLVDYIPPVLLTGLTVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAAYLNI
FT                   PTIGIAIVGTIFALIEFYNKPKTADHVVEEEAHDDWI"
FT   gene            315115..315933
FT                   /locus_tag="SPP_0360"
FT   CDS_pept        315115..315933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0360"
FT                   /product="PTS system, IID component"
FT                   /note="identified by match to protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20554"
FT                   /protein_id="ACO20554.1"
FT                   /translation="MTGSNKLTKRDYLKTSLRAFFCQNGFNYSNYQGLGYANVMYPALK
FT                   KHYGEDQEGFYQALEENCEFYNTNPHFLPFITSLHLVMLENGRPAKETRSIKMALMGPL
FT                   AGIGDSLSQFCLAPLFSTIAASFAQEGLVVGPILFFLAMNTILTAIKLSTGLYGYKLGT
FT                   TVIDKLSEQMATISRIANIIGVTVIAGLAATSVKIMVPITFAAGEVKADAKQSIVSIQG
FT                   MLDKVAPALLPALFTLLVYYLIKEKKWTTYKLVILTVIIGIIGSWLKIIA"
FT   gene            315969..316226
FT                   /locus_tag="SPP_0361"
FT   CDS_pept        315969..316226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0361"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21174"
FT                   /protein_id="ACO21174.1"
FT                   /translation="MAVSPLLLSSFHSIRQQKLLRKQMEQRQEYLASLTSGDEVLLLSG
FT                   IHGKIISIKDDLVSLQIAKGVVIYVEKESVMGKTKELLFK"
FT   gene            316248..318149
FT                   /locus_tag="SPP_0362"
FT   CDS_pept        316248..318149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0362"
FT                   /product="oligohyaluronate lyase"
FT                   /note="identified by match to protein family HMM PF07940"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20582"
FT                   /protein_id="ACO20582.1"
FT                   /translation="MKEERRQFFERVDGNQCRDYILSHCSKDYEKVKSSLERLMDNRFM
FT                   FDSPWDMEPCSKIHQIQPMVWDQVFEDDPEWSYMLNRQEYLLQFMIGYLVEGDKDYIQK
FT                   CKFFLFDWIEQVREFSPQSLMTRTLDTGIRSFTWLKLLLLLLKFDLLEEKELEKILVSL
FT                   EKQIDFMKSYYRAKYTLSNWGILQTIPMLAIYHFFSDKMDLEEAYHFASEELKQQIETQ
FT                   ILGDGSQFEQSILYHVEVYKALLDLCLLLPDLQDSYQELLEKMATYIQMMTGLDGRTLA
FT                   FGDSDSTETTEMLSLSAVVLNKEDLLNGLDVKVDLLSLLFLGREKVKRLQEFERRAWQP
FT                   KSMIFEDSGHVCIKDEHRYLFFKNGPLGSAHSHSDENSFCLQYQGQPIFIDAGRYSYRE
FT                   IYERYLLKSAWSHSTCIVDGKAPERITGSWEYEYYPHSLFCHHKEREGVHYIEGAYWSA
FT                   EPDLPYLHKRKILMLVEDVWLLVDDIRCQGQHEALIQFILDKDVTYQDGKINQLRLWSE
FT                   VDFDLEDTIISPKYNELERSSKLTKRQFFENQMLDYTIIAHESFEIIRHSVYQTDDREV
FT                   ENALAFEVKNDETDKLILLLSEDIGVGEKLCLVDGTKMRGKCLVYDKINERMIRLQC"
FT   gene            318209..319210
FT                   /locus_tag="SPP_0363"
FT   CDS_pept        318209..319210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0363"
FT                   /product="sugar binding transcriptional regulator RegR"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21844"
FT                   /protein_id="ACO21844.1"
FT                   /translation="MEKKLTIKDIAEMAQTSKTTVSFYLNGKYEKMSQETREKIEKVIH
FT                   ETNYKPSIVARSLNSKRTKLIGVLIGDITNSFSNQIVKGIEDIASQNGYQVMIGNSNYS
FT                   QESEDRYIESMLLLGVDGFIIQPTSNFRKYSRIIDEKKKKMVFFDSQLYEHRTSWVKTN
FT                   NYDAVYDMTQSCIEKGYEHFLLITADTSRLSTRIERASGFVDALTDANMRHASLTIEDK
FT                   HTNLEQIKEFLQKEIDPDEKTLVFIPNCWALPLVFTVIKELNYNLPQVGLIGFDNTEWT
FT                   CFSSPSVSTLVQPSFEEGQQATKILIDQIEGRNQEERQQVLDCSVNWKESTF"
FT   gene            complement(319320..319655)
FT                   /locus_tag="SPP_0364"
FT   CDS_pept        complement(319320..319655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0364"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21400"
FT                   /protein_id="ACO21400.1"
FT                   /translation="MKSLARLLIIHVFISIFLFFALISGAVSHTVLLLLLLFLPALNKG
FT                   LEKIQSKRIPVLNAALFFLLISFPQLLSNPVQWKFSIFLVVTIISSLAYFYNFYQVVKE
FT                   VDQKQLI"
FT   gene            complement(319666..319908)
FT                   /locus_tag="SPP_0365"
FT   CDS_pept        complement(319666..319908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0365"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20918"
FT                   /protein_id="ACO20918.1"
FT                   /translation="MKKEKKQLRYPGLKAGSIYGTVIFFIIPLIDTLTSENPNFISSLL
FT                   NTKHIFKTILGAFFFGVMIHIVDSLRIARAKKDQD"
FT   gene            complement(319919..320461)
FT                   /locus_tag="SPP_0366"
FT   CDS_pept        complement(319919..320461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20448"
FT                   /protein_id="ACO20448.1"
FT                   /translation="MKKETFTEKLIKRTYGISGPLDEYKRREADSIGNQVFIILFYLMI
FT                   FGNLIPLLLAYKYPQKVALIYPPLILVIALIAAGYVTYQMKKTGITVIEPDMLNEKESK
FT                   QLHYLGLKAGLFFGLWMFFITPLLSILIDEGQDYFHSLLTIRNGVSSILGSIFFGASIQ
FT                   FLISRRIAKTKKNQDED"
FT   gene            complement(320477..320671)
FT                   /locus_tag="SPP_0367"
FT   CDS_pept        complement(320477..320671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0367"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22199"
FT                   /protein_id="ACO22199.1"
FT                   /translation="MNRVKEFRKELGISQLELAKDIGVSRQTINMIENDKYNPTLELCL
FT                   NLARSLQTDLNSLFWEEDF"
FT   gene            320837..321787
FT                   /gene="mraW"
FT                   /locus_tag="SPP_0368"
FT   CDS_pept        320837..321787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="SPP_0368"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20723"
FT                   /db_xref="GOA:C1CIJ8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIJ8"
FT                   /protein_id="ACO20723.1"
FT                   /translation="MTKEFHHVTVLLHETIDMLDVKPDGIYVDATLGGAGHSEYLLSKL
FT                   SEKGHLYAFDQDQNAIDNAQKRLAPYIEKGMVTFIKDNFRHLQARLREAGVQEIDGICY
FT                   DLGVSSPQLDQRERGFSYKKDAPLDMRMNQDASLTAYEVVNHYDYHDLVRIFFKYGEDK
FT                   FSKQIARKIEQAREVKPIETTTELAEIIKLVKPAKELKKKGHPAKQIFQAIRIEVNDEL
FT                   GAADESIQQAMDMLALDGRISVITFHSLEDRLTKQLFKEASTVEVPKGLPFIPDDLKPK
FT                   MELVSRKPILPSAEELEANNRSHSAKLRVARKIHK"
FT   gene            321799..322116
FT                   /gene="ftsL"
FT                   /locus_tag="SPP_0369"
FT   CDS_pept        321799..322116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SPP_0369"
FT                   /product="cell division protein FtsL"
FT                   /note="identified by match to protein family HMM TIGR02209"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21032"
FT                   /protein_id="ACO21032.1"
FT                   /translation="MAEKMEKTGQILQMQLKRFSRVEKAFYFSIAVTTLIVAISIIFMQ
FT                   TKLLQVQNDLTKINAQIEEKKTELDDAKQEVNELLRAERLKEIANSHDLQLNNENIRIA
FT                   E"
FT   gene            322120..324372
FT                   /locus_tag="SPP_0370"
FT   CDS_pept        322120..324372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0370"
FT                   /product="penicillin-binding protein 2X"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717; match to protein
FT                   family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21626"
FT                   /protein_id="ACO21626.1"
FT                   /translation="MKWTKRVIRYATKNRKSPAENRRRVGKSLSLLSVFVFAIFLVNFA
FT                   VIIGTGTRFGTDLAKEAKKVHQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAVIDENY
FT                   KSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANM
FT                   MSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESS
FT                   LNSILAGTDGIITYEKDRLGNIVPGTEQVSQRTMDGKDVYTTISSPLQSFMETQMDAFQ
FT                   EKVKGKYMTATLVSAKTGEILATTQRPTFDADTKEGITEDFVWRDILYQSNYEPGSTMK
FT                   VMMLAAAIDNNTFPGGEVFNSSELKIADATIRDWDVNEGLTGGRMMTFSQGFAHSSNVG
FT                   MTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIVNIAQSSFGQGISVTQ
FT                   TQMIRAFTAIANDGVMLEPKFISAIYDPNDQTARKSQKEIVGNPVSKDAASLTRTNMVL
FT                   VGTDPVYGTMYNHSTGKPTVTVPGQNVALKSGTAQIADEKNGGYLVGVTDYIFSAVSMS
FT                   PAENPDFILYVTVQQPEHYSGIQLGEFANPILERASAMKDSLNLQTTAKALEQVSQQSP
FT                   YPMPSVKDISPGDLAEELRRNLVQPIVVGTGTKIKNSSAEEGKNLAPNQQVLILSDKAE
FT                   EVPDMYGWTKETAETFAKWLNIELEFQGSGSTVQKQDVRANTAIKDIKKITLTLGD"
FT   gene            324374..325354
FT                   /gene="mraY"
FT                   /locus_tag="SPP_0371"
FT   CDS_pept        324374..325354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SPP_0371"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="identified by match to protein family HMM PF00953;
FT                   match to protein family HMM TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20384"
FT                   /db_xref="GOA:C1CIK1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIK1"
FT                   /protein_id="ACO20384.1"
FT                   /translation="MFISISAGIVTFLLTLVGIPAFIQFYRKAQITGQQMHEDVKQHQA
FT                   KAGTPTMGGLVFLITSVLVAFFFALFSSQFSNNVGMILFILVLYGLVGFLDDFLKVFRK
FT                   INEGLNPKQKLALQLLGGIIFYLFYERGGDILSVFGYPVHLGFFYIFFALFWLVGFSNA
FT                   VNLTDGVDGLASISVVISLSAYGVIAYVQGQMDILLVILAMIGGLLGFFIFNHKPAKVF
FT                   MGDVGSLALGGMLAAISMALHQEWTLLIIGIVYVFETTSVMMQVSYFKLTGGKRIFRMT
FT                   PVHHHFELGGLSGKGNPWSEWKVDFFFWGVGLLASLLTLAILYLM"
FT   gene            325566..325682
FT                   /locus_tag="SPP_0372"
FT   CDS_pept        325566..325682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0372"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20971"
FT                   /protein_id="ACO20971.1"
FT                   /translation="MVDRTDEVSSKHGFEVVDKEKLMWFEEVFEECKKILVS"
FT   gene            325963..328068
FT                   /locus_tag="SPP_0373"
FT   CDS_pept        325963..328068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0373"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpL"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21316"
FT                   /protein_id="ACO21316.1"
FT                   /translation="MNNNFNNFNNMDDLFNQLMGGMRGYSSENRRYLINGREVTSEEFA
FT                   HYRATGQLPGNAETDVQMPQQASGMKQDGVLAKLGRNLTAEAREGKLDPVIGRNKEIQE
FT                   TSEILSRRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGLEAG
FT                   TQYRGSFEENVQNLVNEVKEAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKPALSR
FT                   GELTVIGATTQDEYRNTILKNAALARRFNEVKVNAPSAENTFKILQGIRDLYQQHHNVI
FT                   LPDEVLKAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDVHAVEREIETEKDK
FT                   QEKAVEAEDFEAALNYKTRIAELERKIENHTEDMKVTASVNDVAESVERMTGIPVSQMG
FT                   ASDIERLKDMAHRLQDKVIGQDKAVEAVARAIRRNRAGFDEGNRPIGSFLFVGSTGVGK
FT                   TELAKQLALDMFGTQDAIIRLDMSEYSDRTAVSKLIGTTAGYVGYDDNSNTLTERVRRN
FT                   PYSIILLDEIEKADPQVITLLLQVLDDGRLTDGQGNTVNFKNTVIIATSNAGFGYEANL
FT                   TEDADKPELMDRLKPFFRPEFLNRFNAVIEFSHLTKEDLSKIVDLMLAEVNQTLAKKDI
FT                   DLVVSQAAKDYITEEGYDEVMGVRPLRRVVEQEIRDKVTDFHLDHLDAKHLEADMEDGV
FT                   LVIREKA"
FT   gene            328506..328856
FT                   /locus_tag="SPP_0374"
FT   CDS_pept        328506..328856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0374"
FT                   /product="GBSi1, group II intron, maturase"
FT                   /note="identified by match to protein family HMM PF08388"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21859"
FT                   /protein_id="ACO21859.1"
FT                   /translation="MRKSREQLNLSIRGWINYFSLGNMKSIVASIDERLRTRLRVIIWK
FT                   QWKKKSRRLWGLLKLGVPKWIADKVSGWGDHYQLVAQKSVLKRAISKPVLEKRGLVSCL
FT                   DYYLERHALKVS"
FT   gene            328856..328921
FT                   /locus_tag="SPP_2303"
FT   ncRNA           328856..328921
FT                   /locus_tag="SPP_2303"
FT                   /product="group II catalytic intron"
FT                   /ncRNA_class="autocatalytically_spliced_intron"
FT   gene            complement(328923..329405)
FT                   /gene="luxS"
FT                   /locus_tag="SPP_0375"
FT   CDS_pept        complement(328923..329405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="SPP_0375"
FT                   /product="S-ribosylhomocysteinase LuxS"
FT                   /EC_number="4.4.1.21"
FT                   /note="identified by match to protein family HMM PF02664"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20637"
FT                   /db_xref="GOA:C1CIK5"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIK5"
FT                   /protein_id="ACO20637.1"
FT                   /translation="MSKEVIVESFELDHTIVKAPYVRLIGEETGPKGDIISNYDIRLVQ
FT                   PNEDSIPTAGLHTIEHLLAKLIRTRIDGMIDCSPFGCRTGFHMIMWGRHTSAKIAAVIK
FT                   DSLKEIAETTTWEDVPGTTIESCGNYKDHSLFSAKEWAKLILEQGISDDAFERHVI"
FT   gene            complement(329500..330984)
FT                   /locus_tag="SPP_0376"
FT   CDS_pept        complement(329500..330984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08903"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20936"
FT                   /db_xref="InterPro:IPR014999"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIK6"
FT                   /protein_id="ACO20936.1"
FT                   /translation="MKKQAFSSEQYLNLQRDHILERINQFDGKLYLEFGGKMLEDFHAA
FT                   RVLPGYEPDNKIKLLQELKEQVEVVIAINASNIEHSKARGDLGISYDQEVLRLIDKFNE
FT                   LGIFVGSVVITQYAGQPAADAFRNQLEKNGIDSYLHYPIKGYPTDMDHIISPEGMGKND
FT                   YIKTSRNLIVVTAPGPGSGKLATCMSNMYHDQINGIKSGYAKFETFPVWNLPLHHPVNL
FT                   AYEAATADLDDVNMIDPFHLQTYGETTVNYNRDIEIFPVLKRMLERILGKSPYASPTDM
FT                   GVNMVGFAITDDEAAVEASKQEIIRRYYQTVLDFKAEKVGEAAVKKIELLMNDLGITPA
FT                   DRKVAVVARQKAEETGGPALAFELPNGEIITGKNSELFGPTAAALINAIKKSADIAKEV
FT                   KLIEPEVVKPIQGLKIDHLGSRNPRLHSNEILIALAITATENPDAARAMEELGNLKGSE
FT                   AHSTIILTDEDKNVLRKLGINVTFDPYYQYDRLYRK"
FT   gene            331137..332744
FT                   /locus_tag="SPP_0377"
FT   CDS_pept        331137..332744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0377"
FT                   /product="trehalose-6-phosphate hydrolase
FT                   (Alpha,alpha-phosphotrehalase)"
FT                   /EC_number="3.2.1.93"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21465"
FT                   /protein_id="ACO21465.1"
FT                   /translation="MQEKWWHNAVVYQVYPKSFMDSNGDGIGDLPGITSKLDYLAKLGI
FT                   TAIWLSPVYDSPMDDNGYDIADYQAIATIFGTMEDMDQLIAEAKKRDIRIIMDLVVNHT
FT                   SDEHAWFVEACENPNSPERDYYIWRDEPNDLDSIFSGSAWEYDEKSGQYYLHFFSKKQP
FT                   DLNWENEKLRQKIYEMMNFWIDKGIGGFRMDVIDMIGKIPDEKVVNNGPMLHPYLKEMN
FT                   QATFGDKDLLTVGETWGATPEIAKLYSDPKGQELSMVFQFEHIGLQYQEGQPKWHYQKE
FT                   LNIAKLKEIFNKWQTELGVEDGWNSLFWNNHDLPRIVSIWGNDQEYREKSAKAFAILLH
FT                   LMRGTPYIYQGEEIGMTNYPFETLDQVEDIESLNYAREALEKGVPIEEIMDSIRVIGRD
FT                   NARTPMQWDESKNAGFSTGQPWLAVNPNYEMINVQEALANPDSIFYTYQKLVQIRKENS
FT                   WLVRADFELLDTADKVFAYIRKDGDRRFLVVANLSNEEQDLTVEGKVKSVLIENTLAQE
FT                   VFEKQILVPWDAFCVELL"
FT   gene            332903..333076
FT                   /locus_tag="SPP_0378"
FT   CDS_pept        332903..333076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0378"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21393"
FT                   /protein_id="ACO21393.1"
FT                   /translation="MNIKKRVLSAGLTFASVLLLAACGQSGSDTKTYSSTFSGNPTTFN
FT                   YLLDYYTDNIVN"
FT   gene            complement(333249..333776)
FT                   /pseudo
FT                   /locus_tag="SPP_0379"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            complement(333773..334555)
FT                   /pseudo
FT                   /locus_tag="SPP_0380"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts; identified by match to
FT                   protein family HMM PF01610"
FT   gene            334773..334898
FT                   /locus_tag="SPP_0381"
FT   CDS_pept        334773..334898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21245"
FT                   /protein_id="ACO21245.1"
FT                   /translation="MLVRETSETKLQKSRSSSSLRKSLERLTHHSFVRPATKEIL"
FT   gene            complement(334994..335392)
FT                   /locus_tag="SPP_0382"
FT   CDS_pept        complement(334994..335392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0382"
FT                   /product="Spn1, transposase Orf1"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF01710"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22219"
FT                   /protein_id="ACO22219.1"
FT                   /translation="MAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWLKLKEKT
FT                   GELNHQVKGTKPRKVDRDRLKNYLTDNPDAYLTEIASDFGCHPTTIHYALKAMGYTRKK
FT                   NHTYYEQDPEKVALFLKNFNSLKHLAPV"
FT   gene            335645..337090
FT                   /locus_tag="SPP_0383"
FT   CDS_pept        335645..337090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0383"
FT                   /product="integral membrane regulatory protein Wzg"
FT                   /note="identified by match to protein family HMM PF02916;
FT                   match to protein family HMM PF03816; match to protein
FT                   family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20155"
FT                   /protein_id="ACO20155.1"
FT                   /translation="MSRRFKKSRSQKVKRSVNIVLLTIYLLLICFLLFLIFKYNILAFR
FT                   YLNLVVTALVLLVALVGLLLIIYKKAEKFTIFLLLFSILVSSVSLFAVQQFVGLTNRLN
FT                   ATSNYSEYSISVAVLADSKIENVTQLTSVTAPTGTDNENIQKLLADIKSSQNTDLTVNQ
FT                   SSSYLAAYKSLIAGETKAIVLNSVFENIIESEYPDYASKIKKIYTKGFTKKVEAPKTSK
FT                   NQSFNIYVSGIDTYGPISSVSRSDVNILMTVNRDTKKILLTTTPRDAYVPIADSGNNQK
FT                   DKLTHAGIYGVDSSIHTLENLYGVDINYYVRLNFTSFLKMIDLLGGVDVHNDQEFSALH
FT                   GKFHFPVGNVHLDSEQALGFVRERYSLTDGDRDRGRNQQKVIVAIIQKLTSTEVLKNYS
FT                   SILQGLQDSLQTNIPIETMIDLVNTQLESGGNYKVNSQDLKGTGRMDLPSYAMPDSNLY
FT                   VMEIDDSSLTVVKAAIQDVMEGR"
FT   gene            337092..337823
FT                   /locus_tag="SPP_0384"
FT   CDS_pept        337092..337823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0384"
FT                   /product="tyrosine-protein phosphatase CpsB"
FT                   /EC_number="3.1.3.48"
FT                   /note="identified by match to protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20791"
FT                   /protein_id="ACO20791.1"
FT                   /translation="MIDIHSHIVFDVDDGPKSREESKALLAESYRQGVRTIVSTSHRRK
FT                   GMFETPEEKIAENFLQVREIAKEVADDLVIAYGAEIYYTLDALEKLEKKEIPTLNDSRY
FT                   ALIEFSMHTSYRQIHTGLSNILMLGITPVIAHIERYDALENNEKRVRELIDMGCYTQIN
FT                   SYHVSKPKFFGEKYKFMKKRARYFLERDLVHVVASDMHNLDSRPPYMQQAYDIIAKKYG
FT                   AKKAKELFVDNPRKIIMDQLI"
FT   gene            337832..338524
FT                   /locus_tag="SPP_0385"
FT   CDS_pept        337832..338524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0385"
FT                   /product="capsular polysaccharide biosynthesis protein Wzd"
FT                   /note="identified by match to protein family HMM PF02706;
FT                   match to protein family HMM TIGR01006"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20859"
FT                   /protein_id="ACO20859.1"
FT                   /translation="MKEQNTLEIDVLQLFRALWKRKLVILLVAIITSSVAFAYSTFVIK
FT                   PEFTSTTRIYVVNRNQGEKPGLTNQDLQAGAYLVKDYREIVLSQDVLEEVISDLKLDLM
FT                   PKGLANKIKVTVPVDTRIVSVSVSDRVPEEASRIANSLREVAAQKIISITRVSDVTTLE
FT                   EARPAISPSSPNIKRNTLIGFLAGVIGTSVIVLLLELLDTRVKRPEDIENALQMTLLGV
FT                   VPNLGKLK"
FT   gene            338534..339199
FT                   /locus_tag="SPP_0386"
FT   CDS_pept        338534..339199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0386"
FT                   /product="tyrosine-protein kinase CpsD"
FT                   /EC_number="2.7.10.2"
FT                   /note="identified by match to protein family HMM TIGR01007"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21747"
FT                   /protein_id="ACO21747.1"
FT                   /translation="MPTLEIAQKKLEFIKKAEEYYNTLCTNIQLSGDKLKVISVTSVNP
FT                   GEGKTTTSVNIAMSFARAGYKTLLFDGDIRNSVMSGFFKSREKITGLTEFLSGTADLSH
FT                   GLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVIDAA
FT                   IITQKCDASILITATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGRK"
FT   gene            339340..340476
FT                   /locus_tag="SPP_0387"
FT   CDS_pept        339340..340476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0387"
FT                   /product="galacturonosyl transferase"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21787"
FT                   /protein_id="ACO21787.1"
FT                   /translation="MNLQKKKIMLITNHDDDIYCFRKEVIESLVEYGYEVLVSCPYGDK
FT                   IELMKSIQFEYEDITIDRRGINPLKDIRLFLSYIRLLRKYRPDVVLTYTVKPNVYASLA
FT                   ATILGIKYINNVTGLGSVLTMGSCVRSLVLLLFRISFRKSNCVFFQNEYNMKMLKTLGL
FT                   ILGDSKLIPGSGVNIEKYPVQQYPNGGNGIQGETIVFNFIGRILKEKGIDTYLAAAQII
FT                   KSRYPKTEFNIIGFIEPTESNYELKICDLEKKGIVYYLGQQKDVIPHITRSHAIIHPSV
FT                   YGEGMSNVLLENASSGRVLITTDNPGCKEIVKDRETGYIFQGGNVEELVSILEVFLGLE
FT                   NEKRKEMGLQGRMYIEQYFSRQIIIDAYLDKIKGALDE"
FT   gene            340469..341020
FT                   /locus_tag="SPP_0388"
FT   CDS_pept        340469..341020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0388"
FT                   /product="galacturonic acid acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20413"
FT                   /protein_id="ACO20413.1"
FT                   /translation="MNRIIKNIVGLLRANICLILLKVCRNKDLTFHYFLKFGKNVTVEQ
FT                   ESNAKLILGKKIRVNAGGVLKVRKGAKLKISDDVFLSNNCMIACRKYIDIKSGVKCGPG
FT                   VLIYDHDYDVSVPGGLKAKKFKTAPVMIGENVWIGANSIVLKGVSIGENSVVAAGSVVT
FT                   KDIPADTIFIQKRLSREMKL"
FT   gene            341017..342171
FT                   /locus_tag="SPP_0389"
FT   CDS_pept        341017..342171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0389"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20863"
FT                   /protein_id="ACO20863.1"
FT                   /translation="MKVFIATEFRCTIYKNEIYLKPKAYFIYERYAKAFGEIVLCSRYE
FT                   KVESYPEGYHKANFINKFIPIEGLHQVLFGQNKNKIIEGMIDSDLIVVRIPSIIGSKTA
FT                   DYALKIGKPYLTEIMGDAWDSYWYHSLKGKLLAPYIYAKTKSIVKNANYCIYVTEKYLQ
FT                   DRYPNIKSNIVASNVNITSVENRSLKSRLYKLKKFNPQKISIMTTASVNVRAKGHRFVL
FT                   EAMKRLEIQGILLDYYLAGDGDQSFLKKKAEELGVANRIHFLGELTTSQIYEYLDKVDL
FT                   YIQPSLQEGLPRAVIEAMSRACPCIGSNKAGIPELLGPHCLFTPSSSQAIAGSIIDFIS
FT                   MDKEKMVIKQFEFSKKFLSSVLNKRRSDYFAQIRRELNNSDGLD"
FT   gene            342288..343592
FT                   /locus_tag="SPP_0390"
FT   CDS_pept        342288..343592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0390"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21593"
FT                   /protein_id="ACO21593.1"
FT                   /translation="MKFSLQSNDIKNKIILLVGVVFSGTLILCSENNDVTIPLFSMIFL
FT                   SFMAMIIVKFNIFHPYVWYSSFFTIYSISYPLLYRMEYINYGYTKDLIFMQWLALATLL
FT                   LTLPSKAIVLSERKINLNNNNYLLFLNNMNTFITTVAIIYLLGSGFRNKGEIYSGANIV
FT                   IMLVFSLVYFMILIHTYQLFIQLSTKKWRLLNCNTNTAIVICLFSIVTGERDYMFTLFI
FT                   LDVIILFYFHKIKRFYLVMLVPLAALLIPLSAVFKYTLLSGQVSSINTNNIWFDLLDGE
FT                   FVSASRNLQILILHNMGNYFEGRSFFNDIVRIFYNTGYSNQTWFMDTFFPNVHSTKYGF
FT                   TLVGEGYVNGGYFGIVMIFMLTGFLMRFLYINAQRNIYGMLIYLYMIPIFIYSTRADFA
FT                   NILSPLLKYAILGTLVIVFINRMVLISPLDEMGGE"
FT   gene            343778..344947
FT                   /locus_tag="SPP_0391"
FT   CDS_pept        343778..344947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0391"
FT                   /product="flippase Wzx"
FT                   /note="identified by match to protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21577"
FT                   /protein_id="ACO21577.1"
FT                   /translation="MRLSKKYWFALTSKFLLILLTLLSSIIINRGLGVEKKGDYAYVMN
FT                   LVEIFYILGGVGLGQAYSTFKRNHSNEYQNKFVFLTFIQGLLFGIIGLIIVLADVPIDY
FT                   GGVIIVLSSLSIMRTNLTMIAVIENSIKRNKIVLGVSVVYSVMLVLLLLFHLVSIEMVF
FT                   LVYAINEFLRIILFLYYYNMFPVFEHISIKEFFTIYKFGFLSMILTLLITFNYSIDIIM
FT                   LKQMSSSYNVGIYSVAVTFSNMFLMVPDSFKEILFGDSAKRTFEKNKAINAIKVSFLFM
FT                   ILLIIGFLSFGEFAITLLYGSSYIKAFPITLVIFLGSLSMIFFKILQPIYISQGKQSVA
FT                   IKILSVSALINISLNWYLIPNYQITGAAIASAISYTVCGLFFIIDYLRN"
FT   gene            345015..346085
FT                   /locus_tag="SPP_0392"
FT   CDS_pept        345015..346085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0392"
FT                   /product="UDP-glucuronate 5'-epimerase (UDP-glucuronic
FT                   acidepimerase)"
FT                   /EC_number="5.1.3.12"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22027"
FT                   /protein_id="ACO22027.1"
FT                   /translation="MRGKTILITGVAGFIGSNLVRKLLELEGTMTIIGLDNLNDYYDIA
FT                   LKDYRLLQLNKLIQDYPEKNWIFIKGDIADKMLINKIFKSYHPQIVVNLAAQAGVRYSI
FT                   TNPDVYIESNIVGFHNVLEACRHSYEIYDGGVEHLVYASSSSVYGGNKKIPFATEDKVD
FT                   NPISLYAATKKTNELQAYAYSKIYNIPSTGLRFFTVYGPAGRPDMAYFGFTDKLRSGSD
FT                   IEIYNHGNCKRDFTYIDDIVEGIVRVMQSAPKKLVGSDNLPLAPYKVYNIGNSKPENLL
FT                   DFVDVLQQELIKAGVLPENYDFDSHKKLVPMQPGDVPVTYADTSDLERDFGFKPKTSLR
FT                   EGLRKFAEWYKDYYNV"
FT   gene            346114..347346
FT                   /locus_tag="SPP_0393"
FT   CDS_pept        346114..347346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0393"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF01210; match to protein
FT                   family HMM PF03720; match to protein family HMM PF03721;
FT                   match to protein family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20794"
FT                   /protein_id="ACO20794.1"
FT                   /translation="MKIAVAGTGYVGLSIAILLAQHHQVVAVDIIPEKVELINKKKSPI
FT                   QDDYIEKYLAEKELNLVATLNAEEAYENADFIVIAAPTNYDPKKNFFDTSSVEAVIEAV
FT                   MKYNPDAIIIIKSTVPVGYTKSVRRKFLTDNIMFSPEFLRESKALYDNLYPSRIIIGTD
FT                   KDDKDLVKSAEIFVKMLQEGAVKENIETLYMDFTEAEAVKLFANTYLALRVSYFNELDT
FT                   YSEMKGLDTQAIIDGVCLDPRIGSHYNNPSFGYGGYCLPKDTKQLLANYSDVPQEMITA
FT                   IVQSNRTRKDYIADRILDLAGSYVGNDFYKPDKEKEIVVGIYRLTMKSNSDNFRQSSIQ
FT                   GIMKRLKAKGVTIIIYEPTLESGTTFYGSQVVNDFEIFKKSSQVIVANRFDETLEDVRG
FT                   KVYTRDIFKRD"
FT   gene            347562..347744
FT                   /locus_tag="SPP_0394"
FT   CDS_pept        347562..347744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0394"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21096"
FT                   /protein_id="ACO21096.1"
FT                   /translation="MAVIFKNVLIEEKTEEEKQHILSILNGEYDLSDDVSCRLRRLNEE
FT                   SKRLEVFVKETNSLV"
FT   gene            complement(348032..348382)
FT                   /locus_tag="SPP_0395"
FT   CDS_pept        complement(348032..348382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0395"
FT                   /product="transposase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21240"
FT                   /protein_id="ACO21240.1"
FT                   /translation="MSYSEDLKHHYQLYQLLLFHFQNKEPEKFFGLIEDNLKQVHPIFQ
FT                   TVFKTFLKDKEKIVNALQLHYSNAKLEATNNLIKLIKRNAFGFRNFENFKKRIFIALNI
FT                   KKERTKFVLSRA"
FT   gene            complement(348467..348601)
FT                   /pseudo
FT                   /locus_tag="SPP_0396"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            complement(348556..349338)
FT                   /pseudo
FT                   /locus_tag="SPP_0397"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts; identified by match to
FT                   protein family HMM PF01610"
FT   gene            349552..350409
FT                   /gene="rfbA"
FT                   /locus_tag="SPP_0398"
FT   CDS_pept        349552..350409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="SPP_0398"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01207"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22002"
FT                   /protein_id="ACO22002.1"
FT                   /translation="MKGIILAGGSGTRLYPLTRAASKQLMPVYDKPMIYYPLSTLMLAG
FT                   IRDILIISTPQDLHRFQELLQDGSEFGIKLSYAEQPSTDGLAIGEEFISDDSVALILGD
FT                   NIYHGPGLSTMLQKAAKKEKGATVFGYQVKDPERFGVVEFDTDMNAISIEEKPEYPRSN
FT                   YAVTGLYFYDNDVVEIAKSIKPSPRGELEITDVNKVYLDRGDLSVELMGRGFAWLNTGT
FT                   HESLLEASQYIETVQRMQNVQVANLEEIAYRMGYISREDVLALAQPLKKNEYGQYLLRL
FT                   IGEA"
FT   gene            350410..351006
FT                   /locus_tag="SPP_0399"
FT   CDS_pept        350410..351006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0399"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /note="identified by match to protein family HMM PF00908"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20477"
FT                   /protein_id="ACO20477.1"
FT                   /translation="MTDNFFGKTLAARKVEAIPGMLEFDIPVHGDNRGWFKENFQKEKV
FT                   LPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREGET
FT                   FGNTYQTVIDASKGIFVPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPS
FT                   LGIEWENLEEADVSEADKHHPLLKDVKPLKKEDLE"
FT   gene            351016..352065
FT                   /gene="rfbB"
FT                   /locus_tag="SPP_0400"
FT   CDS_pept        351016..352065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="SPP_0400"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF04321; match to protein family HMM PF07993;
FT                   match to protein family HMM TIGR01181"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20281"
FT                   /protein_id="ACO20281.1"
FT                   /translation="MTEYKNIIVTGGAGFIGSNFVHYVYENFPDVHVTVLDKLTYAGNR
FT                   ANIEEILGNRVELVVGDIADAELVDKLVAQADAIVHYAAESHNDNSLNDPSPFIHTNFI
FT                   GIYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETKYNPSSPYSS
FT                   TKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILSGIKPKLYGEGK
FT                   NVRDWIHTNDHSSGVWTILTKGQIGETYLIGADGEKNNKEVLELILKEMGQATDAYDHV
FT                   TDRAGHDLRYAIDASKLRDELGWKPEFTNFEAGLKATIKWYTDNQEWWKAEKEAVEANY
FT                   AKTQEIITV"
FT   gene            352131..352981
FT                   /pseudo
FT                   /locus_tag="SPP_0401"
FT                   /note="dTDP-4-keto-L-rhamnose reductase, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF04321"
FT   gene            353057..353491
FT                   /locus_tag="SPP_0403"
FT   CDS_pept        353057..353491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0403"
FT                   /product="transposase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22013"
FT                   /protein_id="ACO22013.1"
FT                   /translation="MLLVLVSLVHSFGSVSIIAHTIHQKFNLKVPNYRQEEDWARMGLP
FT                   ITRKEISNWHIKASQYYLESLYNLLREKLLEQPLLHADETSYRVLESDSHLTYYWTFLS
FT                   GKAENQAITLYHHDQRRSGLVVQEFLGDYSGYVHCDMLRQ"
FT   gene            353564..354013
FT                   /pseudo
FT                   /locus_tag="SPP_0404"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            354409..356391
FT                   /locus_tag="SPP_0405"
FT   CDS_pept        354409..356391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0405"
FT                   /product="oligopeptide binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20638"
FT                   /protein_id="ACO20638.1"
FT                   /translation="MKSSKLFALAGVTLLAATTLAACSGSGSSTKGEKTFSYIYETDPD
FT                   NLNYLTTAKAATANITSNVVDGLLENDRYGNFVPSMAEDWSVSKDGLTYTYTIRKDAKW
FT                   YTSEGEEYAAVKAQDFVTGLKYAADKKSDALYLVQESIKGLDAYVKGEIKDFSQVGIKA
FT                   LDEQTVQYTLNKPESFWNSKTTMGVLAPVNEEFLNSKGDDFAKATDPSSLLYNGPYLLK
FT                   SIVTKSSVEFAKNPNYWDKDNVHVDKVKLSFWDGQDTSKPAENFKDGSLTAARLYPTSA
FT                   SFAELEKSMKDNIVYTQQDSITYLVGTNIDRQSYKYTSKTSDEQKASTKKALLNKDFRQ
FT                   AIAFGFDRTAYASQLNGQTGASKILRNLFVPPTFVQADGKNFGDMVKEKLVTYGDEWKD
FT                   VNLADSQDGLYNPEKAKAEFAKAKSALQAEGVQFPIHLDMPVDQTATTKVQRVQSMKQS
FT                   LEATLGADNVIIDIQQLQKDEVNNITYFAENAAGEDWDLSDNVGWGPDFADPSTYLDII
FT                   KPSVGESTKTYLGFDSGEDNVAAKKVGLYDYEKLVTEAGDEATDVAKRYDKYAAAQAWL
FT                   TDSALIIPTTSRTGRPILSKMVPFTIPFALSGNKGTSEPVLYKYLELQDKAVTVDEYQK
FT                   AQEKWMKEKEESNKKAQEDLAKHVK"
FT   gene            356692..361995
FT                   /locus_tag="SPP_0406"
FT   CDS_pept        356692..361995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0406"
FT                   /product="endo-alpha-N-acetylgalactosaminidase"
FT                   /note="identified by match to protein family HMM PF00754;
FT                   match to protein family HMM PF04650; match to protein
FT                   family HMM TIGR01167; match to protein family HMM
FT                   TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21668"
FT                   /protein_id="ACO21668.1"
FT                   /translation="MNKGLFEKRCKYSIRKFSLGVASVMIGAAFFGTSPVLADSVQSGS
FT                   TANLPADLATALATAKENDGRDFEAPKVGEDQGSPEVTDGPKTEEELLALEKEKPAEEK
FT                   PKEDKPAAAKPETPKTVTPEWKTVEKKEQKGTVTIREEKGVRYNQLSSTAQNDNAGKPA
FT                   LFEKKGLTVDANGNATVDLTFKDDSEKGKSRFGVFLKFKDTNNNVFVGYDKDGWFWEYK
FT                   SPTTSTWYRGSRVAAPETGSTNRLSITLKSDGQLNASNNDVNLFDTVTLPAAVNDHLKN
FT                   EKKILLKAGSYDDERTVVSVKTDNQEGVKTEDTPAEKETGPEVDDSKVTYDTIQSKVLK
FT                   AVIDQAFPRVKEYTLNGHTLPGQVQQFNQVFINNHRITPEVTYKKINETTAEYLMKLRD
FT                   DAHLINAEMTVRLQVVDNQLHFDVTKIVNHNQVTPGQKIDDERKLLSSISFLGNALVSV
FT                   SSDQTGAKFDGATMSNNTHVSGDDHIDVTNPMKDLAKGYMYGFVSTDKLAAGVWSNSQN
FT                   SYGGGSNDWTRLTAYKETVGNANYVGIHSSEWQWEKAYKGIVFPEYTKELPSAKVVITE
FT                   DANADKNVDWQDGAIAYRSIMNNPQGWEKVKDITAYRIAMNFGSQAQNPFLMTLDGIKK
FT                   INLHTDGLGQGVLLKGYGSEGHDSGHLNYADIGKRIGGVEDFKTLIEKAKKYGAHLGIH
FT                   VNASETYPESKYFNEKILRKNPDGSYSYGWNWLDQGINIDAAYDLAHGRLARWEDLKKK
FT                   LGDGLDFIYVDVWGNGQSGDNGAWATHVLAKEINKQGWRFAIEWGHGGEYDSTFHHWAA
FT                   DLTYGGYTNKGINSAITRFIRNHQKDAWVGDYRSYGGAANYPLLGGYSMKDFEGWQGRS
FT                   DYNGYVTNLFAHDVMTKYFQHFTVSKWENGTPVTMTDNGSTYKWTPEMRVELVDADNNK
FT                   VVVTRKSNDVNSPQYRERTVTLNGRVIQDGSAYLTPWNWDANGKKLSTEKEKMYYFNTQ
FT                   AGTTTWTLPSDWAKSKVYLYKLTDQGKTEEQELTVKDGKITLDLLANQPYVLYRSKQTN
FT                   PEMSWSEGMHIYDQGFNSGTLKHWTISGDASKAEIVKSQGANDMLRIQGNKEKVSLTQK
FT                   LTGLKPNTKYAVYVGVDNRSNAKAIITVNTGEKEVTTYTNKSLALNYVKAYAHNTRRDN
FT                   ATVDDTSYFQNMYAFFTTGSDVSNVTLTLSREAGDEATYFDEIRTFENNSSMYGDKHDT
FT                   GQGTFKQDFENVAQGIFPFVVGGVEGVEDNRTHLSEKHDPYTQRGWNGKKVDDVIEGNW
FT                   SLKTNGLVSRRNLVYQTIPQNFRFEAGKTYRVTFEYEAGSDNTYAFVVGKGEFQSGRRG
FT                   TQASNLEMHELPNTWTDSKKAKKATFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANF
FT                   RGYNDFMMDNLQIEEITLTGNMLTENALKNYLPTVAMTNYTKESMDALKEAVFNLSQAD
FT                   DDISVEEARAEIAKIETLKNALVQKKTALVADDFASLTAPAQAQEGLANAFDGNLSSLW
FT                   HTSWNGGDVGKPATMVLKEPTEITGLRYVPRGSGSNGNLRDVKLVVTDESGKEHTFTAT
FT                   DWPDNNKPKDIDFGKTIKAKKIVLTGTKTYGDGGDKYQSAAELIFTRPQVAETPLDLSG
FT                   YEAALTKAQKLTDKDNQEEVASVQASMKYATDNHLLTERMVEYFADYLNQLKDSATKPD
FT                   APTVEKPEFKLSSLASEQGKTPDYKQEIARPETPEQILPATGESQSDTALFLAGVSLAL
FT                   SALFVVKTKKD"
FT   gene            complement(362162..364321)
FT                   /locus_tag="SPP_0407"
FT   CDS_pept        complement(362162..364321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0407"
FT                   /product="penicillin-binding protein 1A"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912; match to protein
FT                   family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20315"
FT                   /protein_id="ACO20315.1"
FT                   /translation="MNKPTILRLIKYLSISFLSLVIAAIVLGGGVFFYYVSKAPSLSES
FT                   KLVATTSSKIYDNKNQLIADLGSERRVNAQANDIPTDLVKAIVSIEDHRFFDHRGIDTI
FT                   RILGAFLRNLQSNSLQGGSTLTQQLIKLTYFSTSTSDQTISRKAQEAWLAIQLEQKATK
FT                   QEILTYYINKVYMSNGNYGMQTAAQNYYGKDLNNLSLPQLALLAGMPQAPNQYDPYSHP
FT                   EAAQDRRNLVLSEMKNQGYISAEQYEKAVNTPITDGLQSLKSASNYPAYMDNYLKEVIN
FT                   QVEEETGYNLLTTGMDVYTNVDQEAQKHLWDIYNTDEYVAYPDDELQVASTIVDVSNGK
FT                   VIAQLGARHQSSNVSFGINQAVETNRDWGSTMKPITDYAPALEYGVYDSTATIVHDEPY
FT                   NYPGTNTPVYNWDRGYFGNITLQYALQQSRNVPAVETLNKVGLNRAKTFLNGLGIDYPS
FT                   IHYSNAISSNTTESDKKYGASSEKMAAAYAAFANGGTYYKPMYIHKVVFSDGSEKEFSN
FT                   VGTRAMKETTAYMMTDMMKTVLSYGTGRNAYLAWLPQAGKTGTSNYTDEEIENHIKTSQ
FT                   FVAPDELFAGYTRKYSMAVWTGYSNRLTPLVGNGLTVAAKVYRSMMTYLSEGSNPEDWN
FT                   IPEGLYRNGEFVFKNGARSTWSSPAPQQPPSTESSSSSSDSSTSQSSSTTPSTNNSTTT
FT                   NPNNNTQQSNTTPDQQNQNPQSAQP"
FT   gene            complement(364318..364914)
FT                   /gene="recU"
FT                   /locus_tag="SPP_0408"
FT   CDS_pept        complement(364318..364914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="SPP_0408"
FT                   /product="recombination protein U"
FT                   /note="identified by match to protein family HMM PF03838;
FT                   match to protein family HMM TIGR00648"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21818"
FT                   /db_xref="GOA:C1CIN1"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIN1"
FT                   /protein_id="ACO21818.1"
FT                   /translation="MVNYPHKVSSQKRQTSLSQPKNFANRGMSFEKMINATNDYYLSQG
FT                   LAVIHKKPTPIQIVQVDYPQRSRAKIVEAYFRQASTTDYSGVYNGYYIDFEVKETKQKR
FT                   AIPMKNFHPHQIQHMEQVLAQQGICFVLLHFSSQQETYLLPAFDLIRFYHQDKRQKSMP
FT                   LEYIREYGYEIKAGAFPQIPYLNVIKEHLLGGKTR"
FT   gene            364980..365507
FT                   /locus_tag="SPP_0409"
FT   CDS_pept        364980..365507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06908"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21482"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIN2"
FT                   /protein_id="ACO21482.1"
FT                   /translation="MATALVLGYSAFDLGLFSDKDPRLKLIKKAIRKDLEAMAADGVSW
FT                   LVFTGSLGFEYWVLEVAQEMKTEYGFQLATIFAFETHGENWNEGNQMKLSRFKQVDFVK
FT                   YAYPRYEHKGQLRDYQQFLLENTTSSYLFYDEENETKLAYFYQKMKNQEDYFIKRLTFD
FT                   ELNELAENFSEN"
FT   gene            365577..365906
FT                   /locus_tag="SPP_0410"
FT   CDS_pept        365577..365906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0410"
FT                   /product="cell division initiation protein"
FT                   /note="identified by match to protein family HMM PF05103"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22085"
FT                   /db_xref="GOA:C1CIN3"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIN3"
FT                   /protein_id="ACO22085.1"
FT                   /translation="MASIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAAL
FT                   VKSLRQEIADLKEELTRKPKPSPVQAEPLEAAITSSMTNFDILKRLNRLEKEVFGKQIL
FT                   DNSDF"
FT   gene            365964..366302
FT                   /locus_tag="SPP_2304"
FT   ncRNA           365964..366302
FT                   /locus_tag="SPP_2304"
FT                   /product="bacterial RNase P, class B"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            366392..367549
FT                   /locus_tag="SPP_0411"
FT   CDS_pept        366392..367549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0411"
FT                   /product="methyltransferase"
FT                   /note="identified by match to protein family HMM PF01170"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20294"
FT                   /protein_id="ACO20294.1"
FT                   /translation="MKKEFNLIATVAAGLEAVVGREVRELGYDCQVENGRVRFQGDVRA
FT                   IIETNLWLRAADRIKIIVGTFPAKTFEELFQGVFALDWENYLPLGARFPISKAKCVKSK
FT                   LHNEPSVQAISKKAVVKKLQKHYARPEGVPLMENGPEFKIEVSILKDVATVMIDTTGSS
FT                   LFKRGYRTEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAVMIARKMAPG
FT                   LRRSFAFEEWNWISDRLIQEVRTEAAKKVERELELDIMGCDIDARMVEIAKANAQAAGV
FT                   AGDITFKQMRVQDLRSDKINGVIISNPPYGERLSDDAGVTKLYAEMGQVFAPLKTWSKF
FT                   ILTSDEAFESKYGSQADKKRKLYNGTLKVDLYQYFGQRVKRQEVK"
FT   gene            367562..368956
FT                   /locus_tag="SPP_0412"
FT   CDS_pept        367562..368956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20440"
FT                   /protein_id="ACO20440.1"
FT                   /translation="MSKKRRNRHKKEGQEPQFDFDEAKELTVGQAIRKNEEVEAGVLPE
FT                   DSILDKYVKQHRDEIEADKFATRQYKKEEFVETQSLDDLIQEMREAVEKSEASSEEVPS
FT                   SEDILLPLPLDDEEQGLDPLLLDDENPTEMTEEVEEEQNLSRLDQEDSEKKSKKGFILT
FT                   VLALVSVIICVSAYYVYRQVARSTKEIETSQSTTANQSDVDDFNTLYDAFYTDSNKTAL
FT                   KNSQFDKLSQLKTLLDKLEGSREHTLAKSKYDSLATQIKAIQDVNAQFEKPAIVDGVLD
FT                   TNAKAKSDAKFTDIKTGNTELDKVLDKAISLGKSQQTSTSSSSSSQTSSSSSSQASSNT
FT                   TSEPKPSSSNETRSSRSEVNMGLSSAGVAVQRSASRVAYNQSAIDDSNNSAWDFADGVL
FT                   EQILATSRSRGYITGDQYILERVNIVNGNGYYNLYKPDGTYLFTLNCKTGYFVGNGAGH
FT                   ADDLDY"
FT   gene            369032..370456
FT                   /gene="gnd"
FT                   /locus_tag="SPP_0413"
FT   CDS_pept        369032..370456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="SPP_0413"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="identified by match to protein family HMM PF00393;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM TIGR00873"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20562"
FT                   /protein_id="ACO20562.1"
FT                   /translation="MTKANFGVVGMAVMGRNLALNIESRGYTVAIYNRSKEKTEDVIAC
FT                   HPEKNFVPSYDVESFVNSIEKPRRIMLMVQAGPGTDATIQALLPHLDKGDILIDGGNTF
FT                   YKDTIRRNEELANSGINFIGTGVSGGEKGALEGPSIMPGGQKEAYELVADVLEEISAKA
FT                   PEDGKPCVTYIGPDGAGHYVKMVHNGIEYGDMQLIAESYDLMQHLLGLSAEDMAEIFTE
FT                   WNKGELDSYLIEITADILSRKDDEGQDGPIVDYILDAAGNKGTGKWTSQSSLDLGVPLS
FT                   LITESVFARYISTYKEERVHASKVLPKPAAFNFEGDKAELIEKIRQALYFSKIISYAQG
FT                   FAQLRVASKENNWNLPFADIASIWRDGCIIRSRFLQKITDAYNRDADLANLLLDEYFLD
FT                   VTAKYQQAVRDIVALAVQAGVPVPTFSAAITYFDSYRSADLPANLIQAQRDYFGAHTYQ
FT                   RKDKEGTFHYSWYDEK"
FT   gene            370468..371157
FT                   /locus_tag="SPP_0414"
FT   CDS_pept        370468..371157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0414"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22109"
FT                   /protein_id="ACO22109.1"
FT                   /translation="MGKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQT
FT                   DYDLMLLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKP
FT                   VLIENLVARISAIFRGRDFIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALTRREY
FT                   DLLATLMGSKKVLTREQLLESVWKYESATETNIVDVYIRYLRSKLDVKGQKSYIKTVRG
FT                   VGYTMQE"
FT   gene            371255..372274
FT                   /locus_tag="SPP_0415"
FT   CDS_pept        371255..372274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0415"
FT                   /product="choline-binding protein F"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20704"
FT                   /protein_id="ACO20704.1"
FT                   /translation="MKLLKKMMQVLLAVFFFGLLATNTVFANTTGGRFVDKDNRKYYVK
FT                   DDHKAIYWHKIDGKTYYFGDIGEMVVGWQYLEIPGTGYRDNLFDNQPVNEIGLQEKWYY
FT                   FGQDGALLEQTDKQVLEAKTSENTGKVYGEQYPLSAEKRTYYFDNNYAVKTGWIYEDGN
FT                   WYYLNKLGNFGDDSYNPLPISEVAKGWTQDFHVTIDIDRSKPAPWYYLDPETGIMRTGW
FT                   QYLGNNWYYLRSSGAMATGWYQEGTTWYYLDQPNGDMKTGWQNLGNKWYYLRSSGAMAT
FT                   GWYQDGSTWYYLNAGNGDMKTGWFQVNGNWYYAYSSGALAVNTTVDGYSVNYNGEWVR"
FT   gene            complement(372392..373624)
FT                   /locus_tag="SPP_0416"
FT   CDS_pept        complement(372392..373624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0416"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21390"
FT                   /protein_id="ACO21390.1"
FT                   /translation="MKLFWTNNIYRQLLLNSCFSSFGDSIFYLAIINYVAQYNFAPLAI
FT                   LLISISEMVPLLSQLFLGILGDFQENRVKHALCIAKIKILLYAILTVFLVLSPFSLVSV
FT                   IMIVIINLISDTLSYLSAYMMNALYISVIKDDLHDAMGFRQSLMRVVRIVANLAGAFLI
FT                   NVISIQTISLINTLTFVIAFLGLYVIRHTLYEVEKRIEMSHTALSFKKYFQHLKQSLAV
FT                   LLKLKDTVILLFLTTSMIAILDVSPRLIALRFIQQTLAQLSIGQLLALLSIIMSCGAIL
FT                   GNMTSSNLFKNIRFTHLLVFCEISLLALITSILCQAYIVIFMTSFISSTIIGILSPRLQ
FT                   AAVFAYIPSDKMGTVGSALSTVDILAPSLLSLLALSIASGVSVQLALIFLYLILIALIF
FT                   CQWLVKFNTHN"
FT   gene            complement(373784..374254)
FT                   /pseudo
FT                   /locus_tag="SPP_0417"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            375305..375484
FT                   /locus_tag="SPP_0418"
FT   CDS_pept        375305..375484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0418"
FT                   /product="choline binding protein J"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20429"
FT                   /protein_id="ACO20429.1"
FT                   /translation="MLPHDFPLYLMVWSFFHRSMTTGWFQVNGRWYYAYSSGALAVNTI
FT                   VDGYSVNYNGEWVR"
FT   gene            375606..376484
FT                   /gene="mvk"
FT                   /locus_tag="SPP_0419"
FT   CDS_pept        375606..376484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvk"
FT                   /locus_tag="SPP_0419"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00549"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20202"
FT                   /protein_id="ACO20202.1"
FT                   /translation="MTKKVGVGQAHSKIILIGEHAVVYGYPAISLPLLEVEVTCKVVPA
FT                   ESPWRLYEEDTLSMAVYASLEYLDITEACIRCEIDSAIPEKRGMGSSAAISIAAIRAVF
FT                   DYYQADLPHDVLEILVNRAEMIAHMNPSGLDAKTCLSDQPIRFIKNVGFTELEMDLSAY
FT                   LVIADTGVYGHTREAIQVVQNKGKDALPFLHALGELTQQAEVAISQKDAEGLGQILSQA
FT                   HLHLKEIGVSSPEADFLVETTLSHGALGAKMSGGGLGGCIIALVTNLTHAQELAERLEE
FT                   KGAVQTWIESL"
FT   gene            376466..377419
FT                   /gene="mvaD"
FT                   /locus_tag="SPP_0420"
FT   CDS_pept        376466..377419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="SPP_0420"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR01240"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20786"
FT                   /protein_id="ACO20786.1"
FT                   /translation="MDREPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTE
FT                   TTLSPLPANVTADEFYINGQLQNEVEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGL
FT                   SSSSSGLSALVKACNAYFKLGLDRSQLAQEAKFASGSSSRSFYGPLGAWDKDSGEIYPV
FT                   ETDLKLAMIMLVLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDF
FT                   AKIGELTEKNALAMHATTKTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNV
FT                   KVFCQEKDLEHLSEIFGQRYRLIVSKTKDLSQDDCC"
FT   gene            377406..378413
FT                   /locus_tag="SPP_0421"
FT   CDS_pept        377406..378413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0421"
FT                   /product="phosphomevalonate kinase"
FT                   /EC_number="2.7.4.2"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR01220"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21355"
FT                   /protein_id="ACO21355.1"
FT                   /translation="MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYR
FT                   IYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQNLRPFSLKICGKMEREGKKFGL
FT                   GSSGSVVVLVVKALLALYNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIVAEDLVLYQ
FT                   SFDRQKVAAWLEEENLATVLERDWGFFISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQ
FT                   NINQNFLSSSKETVVSLVEALEQGKAEKVIEQVEVASKLLEGLSTDIYTPLLRQLKEAS
FT                   QDLQAVAKSSGAGGGDCGIALSFDAQSTETLKNRWADLGIELLYQERIGHDDKS"
FT   gene            378397..379407
FT                   /gene="fni"
FT                   /locus_tag="SPP_0422"
FT   CDS_pept        378397..379407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fni"
FT                   /locus_tag="SPP_0422"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 2"
FT                   /EC_number="5.3.3.2"
FT                   /note="identified by match to protein family HMM PF01070;
FT                   match to protein family HMM TIGR02151"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21933"
FT                   /protein_id="ACO21933.1"
FT                   /translation="MTTNRKDEHILYALEQKSSYNSFDEVELIHSSLPLYNLDEIDLST
FT                   EFAGRKWDFPFYINAMTGGSNKGREINQKLAQVAESCGILFVTGSYSAALKNPTDDSFS
FT                   VKSSHPNLLLGTNIGLDKPVELGLQTVEEMNPVLLQVHVNVMQELLMPEGERKFRSWQS
FT                   HLADYSEQIPVPIVLKEVGFGMDAKTIERAYEFGVRTVDLSGRGGTSFAYIENRRSGQR
FT                   DYLNQWGQSTMQALLNAQEWKDKVELLVSGGVRNPLDMIKCLVFGAKSVGLSRTVLELV
FT                   ETYTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKVDYLLYGKLKEAKDQMKKA"
FT   gene            379484..380182
FT                   /locus_tag="SPP_0423"
FT   CDS_pept        379484..380182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20625"
FT                   /protein_id="ACO20625.1"
FT                   /translation="MRKFKIFLFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYYT
FT                   GKEGNNLLLVAATILFFFIVMLNPFVILAIFVAVIYSLFLLYPMMNQEKEQTNLVFEEV
FT                   VTVKKEKNRWFGNLHHFSSYQTCQFDDINLFRFMGKDTIHLERVILTNHDNVIILRKMV
FT                   GTTKIIVPVDVEVSLSVNCLYGDLTFFNQPKRALRNEHYHQETKDYLKSNKSVKIFLTT
FT                   MIGDVEVVRG"
FT   gene            380179..381174
FT                   /locus_tag="SPP_0424"
FT   CDS_pept        380179..381174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0424"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21100"
FT                   /protein_id="ACO21100.1"
FT                   /translation="MKKQAYVIIALTSFLFVFFFSHSLLEILDFDWSIFLHDVEKTEKF
FT                   VFLLLVFSMSITCLLALFWRGIEELSLRKMQANLKRLLAGQEVVQVADPDLDASFKSLS
FT                   GKLNLLTEALQKAENHSLAQEEEIIEKERKRIARDLHDTVSQELFAAHMILSGISQQAL
FT                   KLDREKMQIQLQSVTAILETAQKDLRVLLLHLRPVELEQKSLIEGIQILLKELEDKSDL
FT                   RVSLKQNMTKLPKKIEEHIFRILQELISNTLRHAQASCLDVYLYQTDVELQLKVVDNGI
FT                   GFQLGSLDDLSYGLRNIKERVEDMAGTVQLLTAPKQGLAVDIRIPLLDKE"
FT   gene            381188..381820
FT                   /locus_tag="SPP_0425"
FT   CDS_pept        381188..381820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0425"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20806"
FT                   /protein_id="ACO20806.1"
FT                   /translation="MKILLVDDHEMVRLGLKSYFDLQDDVEVVGEASNGSQGIDLALEL
FT                   RPDVIVMDIVMPEMNGIDATLAILKEWPEAKILIVTSYLDNEKIMPVLDAGAKGYMLKT
FT                   SSADELLHAVSKVAAGELAIEQEVSKKVEYHRNHMELHEELTARERDVLQLIAKGYENQ
FT                   RIADDLFISLKTVKTHVSNILAKLEVSDRTQAAVYAFQHHLVGQEEF"
FT   gene            381821..382063
FT                   /pseudo
FT                   /locus_tag="SPP_0426"
FT                   /note="conserved domain protein; this region contains one
FT                   or more premature stops and/or frameshifts"
FT   gene            382045..382299
FT                   /pseudo
FT                   /locus_tag="SPP_0427"
FT                   /note="DNA alkylation repair enzyme; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            382414..382590
FT                   /locus_tag="SPP_0428"
FT   CDS_pept        382414..382590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0428"
FT                   /product="DNA alkylation repair enzyme, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20322"
FT                   /protein_id="ACO20322.1"
FT                   /translation="MEKILLHNLNQTEFFINKAIGWTLRDYSKTNPTWVTCFIEKNKER
FT                   MAELSIKEASKYL"
FT   gene            382740..382979
FT                   /locus_tag="SPP_0429"
FT   CDS_pept        382740..382979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21825"
FT                   /protein_id="ACO21825.1"
FT                   /translation="MKKTVYKKLGISIIASTLLASQLSTVSALSVISSTGEEYEVSETL
FT                   EKGPESNDSSLSEISPTYGSYYQKQSEVLSVMMI"
FT   gene            382976..383653
FT                   /locus_tag="SPP_0430"
FT   CDS_pept        382976..383653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0430"
FT                   /product="choline binding protein G"
FT                   /note="identified by match to protein family HMM PF00089"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20558"
FT                   /protein_id="ACO20558.1"
FT                   /translation="MIKIDNTLQYPYSTSAMVLSKYYGVADGMNVEGRGSANFIKDNVL
FT                   ITAAHNYYRHDYGKEADDIYVLPAVSPSQELFGKIKVKEVRYLKEFRNLNSKDAREYDL
FT                   ALLILEEPIGAKLGTLGLPTSQKNLTGITVTITGYLSYNFKIHQMYTDKKQVLSDDGMF
FT                   LDYQVDTLEGSSGSTVYDASHRVVGVHTLGDGANQINSAVKLNERNLPFIYSVLKGYSL
FT                   EGW"
FT   gene            383952..384344
FT                   /locus_tag="SPP_0431"
FT   CDS_pept        383952..384344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0431"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21173"
FT                   /protein_id="ACO21173.1"
FT                   /translation="MDSPKSLASYRVIGISDRVLEILKEYLLLEEGDYIFTNNGSPLMI
FT                   TCFNYFLKNSFRKSEIKKDDFVLTAHVFRYSHISLLAELEVPITAIMDRVDYTNETKIL
FT                   SVYTHVTEKMKSNITEKLDKLVLEND"
FT   gene            384505..385788
FT                   /gene="tig"
FT                   /locus_tag="SPP_0432"
FT   CDS_pept        384505..385788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SPP_0432"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20618"
FT                   /db_xref="GOA:C1CIQ2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIQ2"
FT                   /protein_id="ACO20618.1"
FT                   /translation="MSVSFENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFR
FT                   KGHLPRPIFDKKFGEESLYQDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSMEKGQDW
FT                   VIAAEVVTKPEVKLGDYKNLEVSVDVEKEVTDADVEERIERERNNLAELVIKEAAAENG
FT                   DTVVIDFVGSIDGVEFDGGKGENFSLGLGSGQFIPGFEDQLVGHSAGETVDVIVTFPED
FT                   YQAEDLAGKEAKFVTTIHEVKAKEVPALDDELAKDIDEEVETLADLKEKYRKELAAAKE
FT                   EAYKDAVEGAAIDTAVENAEIVELPEEMIHEEVHRSVNEFLGNLQRQGINPDMYFQITG
FT                   TTQEDLHNQYQAEAESRTKTNLVIEAVAKAEGFDASEEEIQKEVEQLAADYNMEVAQVQ
FT                   NLLSADMLKHDITIKKAVELITSTATVK"
FT   gene            complement(385836..388202)
FT                   /locus_tag="SPP_0433"
FT   CDS_pept        complement(385836..388202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0433"
FT                   /product="helicase, RecD/TraA family"
FT                   /note="identified by match to protein family HMM TIGR01448"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20250"
FT                   /protein_id="ACO20250.1"
FT                   /translation="MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTG
FT                   TMADVIEGEDYTFWGQIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLKTA
FT                   QKIVDTYGENTIDEILQHPEKLEGIAGFSAKNREAFVSTLRLNYGTEMVLSKLANYGIP
FT                   NKLAFQIQDFYKEETLDVVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGL
FT                   VHSLFQACMETGDTYVEARDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQID
FT                   TKIFDNSLFFAEEGIRSHLIRILEKGKQKSQDLETIQKHITTVEQELGIEYDNIQKQAI
FT                   CDAIQNKVFILTGGPGTGKTTVINGIIAVYALLEGLDLRKKSNLPILLAAPTGRAARRM
FT                   NELTGLPSATIHRHLGMTGDDDTSHLEDYLDADFIIVDEFSMVDTWLANQLFSNISSNS
FT                   KILIVGDSDQLPSVSPGQVLADLLHIPLIPQTRLEKIYRQSKESTIVTLASQIRQGILP
FT                   ADFTQKKADRSYFEIASGHIPATIEKILGVALRNGIPARDIQVLAPMYRGTAGIDAINQ
FT                   LMQDLLNPPQKDQLSFEAPQCHYRKRDKVIHLVNDAEINVFNGDLGAITDLIPGKYTES
FT                   KQDEIVIDFDGNEVSYPRNEWYKIRLAYAMSIHKSQGSEFPVVILPITSASRRMLERNL
FT                   IYTAITRAKSKLILLGELQAFDYATQHIGTARKTYLIERFSDLLENVEEKQQAVSETVT
FT                   SSASEQSYILTEENWDRIPAMIGITDTDLKEIFGK"
FT   gene            complement(388330..388944)
FT                   /gene="lepB"
FT                   /locus_tag="SPP_0434"
FT   CDS_pept        complement(388330..388944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="SPP_0434"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22117"
FT                   /protein_id="ACO22117.1"
FT                   /translation="MNLFKNFLKEWGLFLLILSLLALSRIFFWSNVRVEGHSMDPTLAD
FT                   GEILFVVKHLPIDRFDIVVAHEEDGNKDIVKRVIGMPGDTIRYENDKLYINDKETDEPY
FT                   LADYIKRFKDDKLQSTYSGKGFEGNKGTFFRSIAQKAQAFTVDVNYNTNFSFTVPEGEY
FT                   LLLGDDRLVSSDSRHVGTFKAKDITGEAKFRLWPITRIGTF"
FT   gene            complement(388956..389828)
FT                   /gene="rnhC"
FT                   /locus_tag="SPP_0435"
FT   CDS_pept        complement(388956..389828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhC"
FT                   /locus_tag="SPP_0435"
FT                   /product="ribonuclease hiii"
FT                   /EC_number="3.1.26.-"
FT                   /note="identified by match to protein family HMM PF01351;
FT                   match to protein family HMM TIGR00716"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21548"
FT                   /db_xref="GOA:C1CIQ5"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR024568"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIQ5"
FT                   /protein_id="ACO21548.1"
FT                   /translation="MASITLTPSEKDIQAFLEHYQTSLAPSKNPYIRYFLKLPQATVSI
FT                   YTSGKILLQGEGAEKYASFFGYQAVEQTSGQNLPLIGTDEVGNGSYFGGLAVVAAFVTP
FT                   DQHDFLRKLGVGDSKTLTDQKIRQIAPILKEKIQHQALLLSPSKYNEVIGDRYNAVSVK
FT                   VALHNQAIYLLLQKGVQPEKIVIDAFTSAKNYDKYLAQEANRFSNSISLEEKAEGKYLA
FT                   VAVSSVIARDLFLENLENLGRELGYQLPSGAGTASDKVASQILQAYGMQGLNFCAKLHF
FT                   KNTEKAKNA"
FT   gene            389993..390217
FT                   /locus_tag="SPP_0436"
FT   CDS_pept        389993..390217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20424"
FT                   /protein_id="ACO20424.1"
FT                   /translation="MEEIAKVATEKYQAIKEQMPSADDETIALLLAVNCLSTQLSREIE
FT                   FDDKEQELEELRHKLVTCKQEQSKIEDSL"
FT   gene            390214..390762
FT                   /gene="cvpA"
FT                   /locus_tag="SPP_0437"
FT   CDS_pept        390214..390762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /locus_tag="SPP_0437"
FT                   /product="CvpA family protein"
FT                   /note="identified by match to protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21008"
FT                   /protein_id="ACO21008.1"
FT                   /translation="MISFLLLLVLVWGFYIGYRRGLLLQVYYLISAMASAFMAGQFYKG
FT                   LGEQFHLLLPYANSQEGQGTFFFPSDQLFQLDKVFYAGIGYLLVFGIVYSIGRLLGLLL
FT                   HLIPSKKLGGKLFQVSAGILSMLVTLFVLQMALTILATIPMAVIQNPLEKSIVAKHIIQ
FT                   SIPVTTSWLKQIWVTNLIG"
FT   gene            390866..393202
FT                   /locus_tag="SPP_0438"
FT   CDS_pept        390866..393202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0438"
FT                   /product="MutS2 family protein"
FT                   /note="identified by match to protein family HMM PF00488;
FT                   match to protein family HMM PF01713; match to protein
FT                   family HMM TIGR01069"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20777"
FT                   /db_xref="GOA:C1CIQ8"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIQ8"
FT                   /protein_id="ACO20777.1"
FT                   /translation="MNKKILETLEFDKVKALFEPHLLTEQGLEQLRQLAPTAKADKIKQ
FT                   AFAEMKEMQALFVEQPHFTILSTKEIAGVCKRLEMGADLNIEEFLLLKRVLLASRELQN
FT                   FYANLENVSLEELALWFEKLHDFPQLQGNLQAFNDAGFIENFASEELARIRRKIHDSES
FT                   QVRDVLQDLLKQKAQMLTEGIVASRNGRQVLPVKNTYRNKIAGVVHDISASGNTVYIEP
FT                   REVVKLSEEIASLRADERYEMLRILQEISERVRPHAAEIANDAWIIGHLDLIRAKVRFI
FT                   QERQAVVPQLSENQEIQLLHVCHPLVKNAVANDVYFGQDLTAIVITGPNTGGKTIMLKT
FT                   LGLTQVMAQSGLPILADKGSRVGIFEEIFADIGDEQSIEQSLSTFSSHMTNIVDILGKV
FT                   NQHSLLLLDELGAGTDPQEGAALAMAILEDLRLRQIKTMATTHYPELKAYGIETAFVQN
FT                   ASMEFDTATLRPTYRFMQGVPGRSNAFEIAKRLGLSEVIVGDASQQIDQDNDVNRIIEQ
FT                   LEEQTLESRKRLDNIREVEQENLKMNRALKKLYNELNREKETELNKAREQAAEIVDMAL
FT                   SESDQILKNLHSKSQLKPHEIIEAKAKLKKLAPEKVDLSKNKVLQKAKKKRAPKVGDDI
FT                   VVLSYGQRGTLTSQLKDGRWEAQVGLIKMTLEEKEFDLVQAQQEKPVKKKQVNVVKRTS
FT                   GRGPQARLDLRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTGVIREGVTKYLQRN
FT                   KHVKSFGYAPQNAGGSGATIVTFKG"
FT   gene            393545..394867
FT                   /locus_tag="SPP_0439"
FT   CDS_pept        393545..394867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0439"
FT                   /product="D-alanine glycine permease"
FT                   /note="identified by match to protein family HMM PF01235;
FT                   match to protein family HMM TIGR00835"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21368"
FT                   /protein_id="ACO21368.1"
FT                   /translation="MLELLKSIDDFAWGPPLLILLVGTGIYLTMRLGLLQVLRLPKAFQ
FT                   LIFIQDKGHGDVSSFAALCTALASTVGTGNIIGVATAIKVGGPGALFWMWMAAFFGMAT
FT                   KYAEGLLAIKYRTKDDHGAVAGGPMHYILLGMGEKWRPLAVLFAVAGVLVALLGIGTFT
FT                   QVNSITESIQNTTTISPVITALVLSVFVAIAVFGGLKSISKVSTTVVPFMTIIYILGTL
FT                   IVIFFNIGKIPGTIALVFTSAFSPLAAVGGFAGASVRMAIQNGVARGVFSNESGLGSAP
FT                   IAAAAAKTNEPVEQGLISMTGTFIDTLIICTLTGLTILVTGVWSGDLNGVALTQSAFST
FT                   VFSHFGPALLTIFLVLFAFTTILGWNYYGERCFEFLFGVRFIWLYRVVFVLMVLLGGFI
FT                   ELDMVWIIADIVNALMALPNLIALLVLSQVVIAETKKYFDK"
FT   gene            395085..395633
FT                   /locus_tag="SPP_0440"
FT   CDS_pept        395085..395633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0440"
FT                   /product="macrophage infectivity potentiator protein"
FT                   /note="identified by match to protein family HMM PF02627;
FT                   match to protein family HMM TIGR00778"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22175"
FT                   /protein_id="ACO22175.1"
FT                   /translation="MTTFTIHTVESAPAEVKEILETVEKDNNGYIPNLIGLLANAPTVL
FT                   EAYQIVSSIHRRNSLTPVEREVVQITAAVTNGCAFCVAGHTAFSIKQIQMNDDLIQALR
FT                   NRTPIETDPKLDTLAKFTLAVINTKGRVGDEALSEFLEAGYTQQNALDVVFGVSLAILC
FT                   NYANNLANTPINPELQPYA"
FT   gene            395743..396642
FT                   /locus_tag="SPP_0441"
FT   CDS_pept        395743..396642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0441"
FT                   /product="exfoliative toxin A"
FT                   /note="identified by match to protein family HMM PF03595"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20150"
FT                   /protein_id="ACO20150.1"
FT                   /translation="MKKLPLVFSGCLLGLAGAGNLILDTLPVLSHLFSLTGLVLWIYFL
FT                   ILHLFNWKETKQELTKPPLLSGMATFPMAGMILSTYVFRVFSYLPLVAQGIWWFSFLLD
FT                   LTLIAGFTIKFACSGRRVHATPSWTVLYVGIAVAALTYPLVGIIEIAYATLSFGFLLTF
FT                   YLYPLIYSDLKKHPLPLALLGQEGIYCAPFSLLLASLVRVGGTSLPNWVLIVMILASQS
FT                   FFFFVLTRLPNILKQGFQPAFSALTFPTIITATSLKMAQGILKLPFLDYLVLAETIICL
FT                   TILFFVLGAYLIWLRKKV"
FT   gene            complement(396667..397941)
FT                   /gene="serS"
FT                   /locus_tag="SPP_0442"
FT   CDS_pept        complement(396667..397941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="SPP_0442"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21139"
FT                   /db_xref="GOA:C1CIR2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIR2"
FT                   /protein_id="ACO21139.1"
FT                   /translation="MLDIKRIRTDFEAVAEKLATRGVDAAVLNEMKEIDAKRRNILVKV
FT                   ETLKAERNTVSAEIAQAKRNKENTDDKIAAMQNLSAEVKALDAELAEIDAKLTEFTTTL
FT                   PNIPADSVPVGADEDDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARF
FT                   LFYKGLGARLERAIYNFMLDEHGKEGYTEVITPYIVNHDSMFGTGQYPKFKEDTFELSD
FT                   TNFVLIPTAEVPLANYYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFH
FT                   KVEMVKFAKPEESYEELEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWI
FT                   PAQNNYREISSCSNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENY
FT                   QNEDGSVTIPEALRPYMGGAEVIKP"
FT   gene            complement(398155..398526)
FT                   /locus_tag="SPP_0443"
FT   CDS_pept        complement(398155..398526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0443"
FT                   /product="ManO"
FT                   /note="identified by match to protein family HMM PF06115"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21573"
FT                   /protein_id="ACO21573.1"
FT                   /translation="MAQSLNKTVLLSTTGTSYLSIAGKVGKFLVGDQALEFYPDVNVEQ
FT                   FIQIPWSHINQIGANVTGCKISRHFEVFTDKGKFLFASKDSGAILKIARDKLGNDKVVK
FT                   LPTLIQTISQKFKNLFAKK"
FT   gene            complement(398529..399893)
FT                   /locus_tag="SPP_0444"
FT   CDS_pept        complement(398529..399893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0444"
FT                   /product="aspartate kinase"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21938"
FT                   /protein_id="ACO21938.1"
FT                   /translation="MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAED
FT                   TKVTDALIKYYRDYVAGNDISKSQSWIIDRYAAMVSELGLKPAVLEKISKSIHALATLP
FT                   IEENEFLYDTFLAAGENNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARIIPSS
FT                   YDKIEELTNTNEVLVIPGFFGVTKENQICTFSRGGSDITGSIIAAGVKADLYENFTDVD
FT                   GIFAAHPGIIHQPHSIPELTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPD
FT                   HPGTRIVLKHSNDEFPVVGIAGDSGFVSINMSKYLMNREVGFGRKVLQILEELNIGWEH
FT                   MPTGIDDLSIILRSRQLTPIKEEEILRQLVQKAKVDHAEIEHDLSIIMIVGEKMKSHIG
FT                   VTATATRALSENKINIQMMSQGSSEVSIMFVVNKDQEKAAIKALYNAFFGESKED"
FT   gene            complement(400071..400226)
FT                   /locus_tag="SPP_0445"
FT   CDS_pept        complement(400071..400226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22007"
FT                   /protein_id="ACO22007.1"
FT                   /translation="MFHQGSFLFYKQFILFENLFKPRQLPSVTSKQYFEQSAASFLVCS
FT                   LIFIEC"
FT   gene            400218..401003
FT                   /locus_tag="SPP_0446"
FT   CDS_pept        400218..401003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0446"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21977"
FT                   /protein_id="ACO21977.1"
FT                   /translation="MEHIIYQLEEDLAILTLNRPEVANGFHIPMCEEILEALTLAEENP
FT                   AVHFILINANGKVFSVGGDLVEMKRAVDEDDIPSLTKIAELVNTISYKIKQIAKPVLME
FT                   VDGAVAGAAANMAVAADFCLATDKAKFIQAFVGVGLAPDAGGIHLLSRSIGVTRAAQLA
FT                   MTGEALTAEKALEWGLVYRVSEAEKLEKTREQLLKKLRRASSNSYAAIKKLVWESQFKD
FT                   WQGYATLELNLQKSLAQTEDFKEGVRAHSERRRPKFTGK"
FT   gene            401097..401531
FT                   /locus_tag="SPP_0447"
FT   CDS_pept        401097..401531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0447"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01047;
FT                   match to protein family HMM PF03965"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21244"
FT                   /protein_id="ACO21244.1"
FT                   /translation="MDYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVIG
FT                   KAPDVTPSQVSKELMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGRLIHR
FT                   LHKRFHKAMVEKIIDGMSEEEIAVMGKGLTNLYQFLEDLK"
FT   gene            401531..402505
FT                   /locus_tag="SPP_0448"
FT   CDS_pept        401531..402505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0448"
FT                   /product="beta-ketoacyl-acyl carrier protein synthase III"
FT                   /note="identified by match to protein family HMM PF08541;
FT                   match to protein family HMM PF08545; match to protein
FT                   family HMM TIGR00747"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20732"
FT                   /db_xref="GOA:C1CIR8"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="PDB:5BQS"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIR8"
FT                   /protein_id="ACO20732.1"
FT                   /translation="MAFAKISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHI
FT                   SRTESTSDLATEVAKKLMAKAGITGKELDFIILATITPDSMMPSTAARVQANIGANKAF
FT                   AFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSETLSKAVDWSDRSTAVLFGDGAGG
FT                   VLLEASEQEHFLAESLNSDGSRSECLTYGHSGLHSPFSDQESADSFLKMDGRTVFDFAI
FT                   RDVAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEYGNTS
FT                   AASIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI"
FT   gene            402565..402789
FT                   /locus_tag="SPP_0449"
FT   CDS_pept        402565..402789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0449"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21095"
FT                   /protein_id="ACO21095.1"
FT                   /translation="MAVFEKVQEIIVEELGKDASEVTLESTFDDLDADSLDLFQVISEI
FT                   EDAFDIQIEAENDLKTVGDLVAYVEEQAK"
FT   gene            402908..403882
FT                   /locus_tag="SPP_0450"
FT   CDS_pept        402908..403882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0450"
FT                   /product="putative enoyl-(acyl-carrier-protein) reductase
FT                   II"
FT                   /EC_number="1.3.-.-"
FT                   /note="identified by match to protein family HMM PF03060;
FT                   match to protein family HMM TIGR03151"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22205"
FT                   /protein_id="ACO22205.1"
FT                   /translation="MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGN
FT                   APKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKYME
FT                   RFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATAISI
FT                   PVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISA
FT                   QHFGHAVRAIKNQLTRDFELAEKDAFKQEDPDLEIFEQMGAGALAKAVVHGDVDGGSVM
FT                   AGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWAGVVRND"
FT   gene            403875..404795
FT                   /gene="fabD"
FT                   /locus_tag="SPP_0451"
FT   CDS_pept        403875..404795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="SPP_0451"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="identified by match to protein family HMM PF00698;
FT                   match to protein family HMM TIGR00128"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21496"
FT                   /protein_id="ACO21496.1"
FT                   /translation="MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLR
FT                   YLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALD
FT                   FEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPA
FT                   QIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTALLEPASQKLAETLAQVSFSDF
FT                   TCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGF
FT                   VKKIDQTAHLAHVEDQASLVALLEK"
FT   gene            404829..405560
FT                   /gene="fabG"
FT                   /locus_tag="SPP_0452"
FT   CDS_pept        404829..405560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="SPP_0452"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM PF08659; match to protein family HMM TIGR01830"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20886"
FT                   /protein_id="ACO20886.1"
FT                   /translation="MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELL
FT                   AEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEAD
FT                   FEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGF
FT                   TKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTV
FT                   FLAGQDYLTGQVVAIDGGLSM"
FT   gene            405582..406817
FT                   /gene="fabF"
FT                   /locus_tag="SPP_0453"
FT   CDS_pept        405582..406817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="SPP_0453"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 2"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801; match to protein
FT                   family HMM TIGR03150"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20289"
FT                   /protein_id="ACO20289.1"
FT                   /translation="MKLNRVVVTGYGVTSPIGNTPEEFWNSLATGKIGIGGITKFDHSD
FT                   FDVHNAAEIQDFPFDKYFVKKDTNRFDNYSLYALYAAQEAVNHANLDVEALNRDRFGVI
FT                   VASGIGGIKEIEDQVLRLHEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSINTA
FT                   CSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAIAGFQALTALSTTEDPTRASIPF
FT                   DKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQGAIK
FT                   AIKLALEEAEISPEQVAYVNAHGTSTPANEKGESGAIVAVLGKEVPVSSTKSFTGHLLG
FT                   AAGAVEAIVTIEAMRHNFVPMTAGTSEVSDYIEANVVYGQGLEKEIPYAISNTFGFGGH
FT                   NAVLAFKRWENR"
FT   gene            406820..407305
FT                   /gene="accB"
FT                   /locus_tag="SPP_0454"
FT   CDS_pept        406820..407305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="SPP_0454"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00364;
FT                   match to protein family HMM TIGR00531"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20299"
FT                   /protein_id="ACO20299.1"
FT                   /translation="MNLNDIKDLMTQFDQSSLREFSYKNGTDELQFSKNEARPVPEVAT
FT                   QVAPAPVLATPNPVAPTSAPAETVAEEVPAPAEASVASEGNLVESPLVGVVYLAAGPDK
FT                   PAFVTVGDSVKKGQTLVIIEAMKVMNEIPAPKDGVVTEILVSNEEMVEFGKGLVRIK"
FT   gene            407302..407724
FT                   /gene="fabZ"
FT                   /locus_tag="SPP_0455"
FT   CDS_pept        407302..407724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="SPP_0455"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF07977;
FT                   match to protein family HMM TIGR01750"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22075"
FT                   /db_xref="GOA:C1CIS5"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIS5"
FT                   /protein_id="ACO22075.1"
FT                   /translation="MIDIQGIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFFN
FT                   GHFPQYPVMPGVLIMEALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQLVM
FT                   TATFVKRRGTIAVVEAKAEVDGKLAASGILTFAIGN"
FT   gene            407736..409103
FT                   /gene="accC"
FT                   /locus_tag="SPP_0456"
FT   CDS_pept        407736..409103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="SPP_0456"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF02785; match to protein
FT                   family HMM PF02786; match to protein family HMM PF08443;
FT                   match to protein family HMM TIGR00514"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21889"
FT                   /protein_id="ACO21889.1"
FT                   /translation="MFRKILIANRGEIAVRIIRAARELGIATVAVYSTADKEALHTLLA
FT                   DEAVCIGPGKATESYLNINAVLSAAVLTEAEAIHPGFGFLSENSKFATMCEEVGIKFIG
FT                   PSGHVMDMMGDKINARAQMIKAGVPVIPGSDGEVHNSEEALIVAEKIGYPVMLKASAGG
FT                   GGKGIRKVEKPDDLVSAFETASSEAKANYGNGAMYIERVIYPARHIEVQILGDEHGHVI
FT                   HLGERDCSLQRNNQKVLEESPSIAIGKTLRHEIGAAAVRAAEFVGYENAGTIEFLLDEA
FT                   SSNFYFMEMNTRVQVEHPVTEFVSGVDIVKEQICIAAGQPLSVKQEDIVLRGHAIECRI
FT                   NAENPAFNFAPSPGKITNLYLPSGGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRF
FT                   DALMKMQRALYELEIEGVQTNADFQLDLISDRNVIAGDYDTSFLMETFLPKYQEKE"
FT   gene            409140..410006
FT                   /gene="accD"
FT                   /locus_tag="SPP_0457"
FT   CDS_pept        409140..410006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="SPP_0457"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM TIGR00515"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21295"
FT                   /protein_id="ACO21295.1"
FT                   /translation="MALFSKKDKYIRINPNRSVREKPQAKPEVPDELFSQCPGCKHTIY
FT                   QKDLGSERICPHCSYTFRISAQERLALTIDMGTFKELFTGIESKDPLHFPGYQKKLASM
FT                   REKTGLHEAVVTGTALIKGQTVALGIMDSNFIMASMGTVVGEKITRLFEYATVEKLPVV
FT                   LFTASGGARMQEGIMSLMQMAKISAAVKRHSNVGLFYLTILTDPTTGGVTASFAMEGDI
FT                   ILAEPQSLVGFAGRRVIENTVRESLPEDFQKAEFLLEHGFVDAIVKRRDLPDTIASLVR
FT                   LHGGSPR"
FT   gene            410003..410770
FT                   /gene="accA"
FT                   /locus_tag="SPP_0458"
FT   CDS_pept        410003..410770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SPP_0458"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF03255;
FT                   match to protein family HMM TIGR00513"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21155"
FT                   /db_xref="GOA:C1CIS8"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIS8"
FT                   /protein_id="ACO21155.1"
FT                   /translation="MNIAKIVREAREQSRLTTLDFATGIFDEFIQLHGDRSFRDDGAVV
FT                   GGIGWLGDQAVTVVGIQKGKSLQDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVVTFI
FT                   NTAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADRVWML
FT                   ENSIYAILSPEGFASILWKDGTRAMEAAELMKITSHELLEMDVVDKVISEIGLSSKELI
FT                   KSVKKELQTELARLSQKPLEELLEERYQRFRKY"
FT   gene            410929..411114
FT                   /locus_tag="SPP_0459"
FT   CDS_pept        410929..411114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20557"
FT                   /protein_id="ACO20557.1"
FT                   /translation="MTGTNTFTVLSTEDLEQTSGGLAVWEDGYSRWLYYREFAPYMRQG
FT                   ALNSYIDAWKYGFRAG"
FT   gene            411171..411605
FT                   /locus_tag="SPP_0460"
FT   CDS_pept        411171..411605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20575"
FT                   /protein_id="ACO20575.1"
FT                   /translation="MLIILLSTYLPQTIGLYVTIILGLGADVYSLILTMGLVGSFLLLI
FT                   WRLKKKKMLFIFEKKSWNWSFVFYLFATYVVYQILGNFWARYAHLINHRNIHDEYFTVL
FT                   FSNGQPTFLSTILSFVLPVIIGPVFEETLDRGYFMNTFFP"
FT   gene            complement(411756..411890)
FT                   /locus_tag="SPP_0461"
FT   CDS_pept        complement(411756..411890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0461"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22091"
FT                   /protein_id="ACO22091.1"
FT                   /translation="MIDIKHFFLCLPLSKKMIIDIIVNKNPDRFCMIEKVKKTMAENR"
FT   gene            complement(411904..412326)
FT                   /gene="nusB"
FT                   /locus_tag="SPP_0462"
FT   CDS_pept        complement(411904..412326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SPP_0462"
FT                   /product="transcription antitermination factor NusB"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM TIGR01951"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21502"
FT                   /db_xref="GOA:C1CIT2"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIT2"
FT                   /protein_id="ACO21502.1"
FT                   /translation="MTSPLLESRRQLRKCAFQALMSLEFGTDVETACRFAYTHDREDTD
FT                   VQLPAFLIDLVSGVQAKKEELDKQITQHLKAGWTIERLTLVERNLLRLGVFEITSFDTP
FT                   QLVAVNEAIELAKDFSDQKSARFINGLLSQFVTEEQ"
FT   gene            complement(412319..412708)
FT                   /locus_tag="SPP_0463"
FT   CDS_pept        complement(412319..412708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0463"
FT                   /product="general stress protein, Gls24 family"
FT                   /note="identified by match to protein family HMM PF03780"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20397"
FT                   /protein_id="ACO20397.1"
FT                   /translation="MGIEEQLGEIVIAPRVLEKIIAIATAKVEGVHSFSNRSVSDTLSK
FT                   LSLGRGIYLKNVDEELTADIYLYLEYGVKVPKVAVAIQKAVKDAVRNMADVELAAINIH
FT                   VAGIVPDKTPKPELKDLFDEDFLND"
FT   gene            complement(412730..413290)
FT                   /gene="efp"
FT                   /locus_tag="SPP_0464"
FT   CDS_pept        complement(412730..413290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="SPP_0464"
FT                   /product="translation elongation factor P"
FT                   /note="identified by match to protein family HMM PF01132;
FT                   match to protein family HMM PF08207; match to protein
FT                   family HMM PF09285; match to protein family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20255"
FT                   /db_xref="GOA:C1CIT4"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIT4"
FT                   /protein_id="ACO20255.1"
FT                   /translation="MIEASKLKAGMTFETADGKLIRVLEASHHKPGKGNTIMRMKLRDV
FT                   RTGSTFDTSYRPEEKFEQAIIETVPAQYLYKMDDTAYFMNTETYDQYEIPVVNVENELL
FT                   YILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSIKGATVTGSGKPATMETGLVVNV
FT                   PDFIEAGQKLVINTAEGTYVSRA"
FT   gene            413458..413643
FT                   /locus_tag="SPP_0465"
FT   CDS_pept        413458..413643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0465"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21871"
FT                   /protein_id="ACO21871.1"
FT                   /translation="MEIKEQTRKLAAGCSKHCFEVVDRTDEVSNHIYGNVTLTWFEEIF
FT                   EEYYISKGRSKFTPTC"
FT   gene            complement(413668..414711)
FT                   /locus_tag="SPP_0466"
FT   CDS_pept        complement(413668..414711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0466"
FT                   /product="L-iditol 2-dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21379"
FT                   /protein_id="ACO21379.1"
FT                   /translation="MATMKAARWHAAKDVRIQEIEVPEVLPHQVKVAVKFTGICGTDLH
FT                   EFLDGPIFIPTDEHVYSGQKAPVTLGHEFSGEIIEVGSDVTRVKVGDRVAVEPILAKNN
FT                   LVGDYNLDPNLNFVGLAADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVR
FT                   QSSLKAGDTAVVFGLGPIGLLIVEALRAAGASKIYAVELSPERQAKAEELGAIVVRPEE
FT                   GETAVEAIHRLTNGGVDVSYEVTGVPVVLGQALAAVHKAGECMVVSIWEREANINPNEF
FT                   AIQEKTLKGIIAYRHIFPKVLELMEQGYFSAEKLVTKKIKLENIVEEGFIELTQDKSQI
FT                   KILVEPE"
FT   gene            complement(414835..416277)
FT                   /locus_tag="SPP_0467"
FT   CDS_pept        complement(414835..416277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0467"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B (Asp/Glu-ADT subunit B)"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21018"
FT                   /db_xref="GOA:C1CIT7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIT7"
FT                   /protein_id="ACO21018.1"
FT                   /translation="MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFP
FT                   GVLPVLNKGVVDAGIKAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IEVKLEDGTTKKIGIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNV
FT                   RKGLEYEIQRQAEILRSGGQIRQETRRYDEANKTTILMRVKEGAADYRYFPEPDLPLFE
FT                   ISDEWIEEMRTELPEFPKERRARYVSDLGLSDYDANQLTANKVTSDFFEKAVALGGDAK
FT                   QVSNWLQGEVAQFLNAEGKTLEQIELTPENLVEMITIIEDGTISSKIAKKVFVHLAKNG
FT                   GGAREYVEKAGMVQISDPAILIPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATK
FT                   GQANPQVALKLLAQELAKLKEN"
FT   gene            complement(416277..417743)
FT                   /locus_tag="SPP_0468"
FT   CDS_pept        complement(416277..417743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0468"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit A
FT                   (Glu-ADTsubunit A)"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20212"
FT                   /db_xref="GOA:C1CIT8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIT8"
FT                   /protein_id="ACO20212.1"
FT                   /translation="MTFNNKTIEELHNLLVSKEISATELTQATLENIKSREEALNSFVT
FT                   IAEEQALVQAKAIDEAGIDADNVLSGIPLAVKDNISTDGILTTAASKMLYNYEPIFDAT
FT                   AVANAKTKGMIVVGKTNMDEFAMGGSGETSHYGATKNAWDHSKVPGGSSSGSAAAVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGIVGLKPTYGTVSRFGLIAFGSSLDQIGPFAPTVKENA
FT                   LLLNAIASEDAKDSTSAPVRIADFTSKIGQDIKGMKIALPKEYLGEGINPEVKETILNA
FT                   AKHFEKLGAIVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRAEDATNLDEI
FT                   YVNSRSQGFGEEVKRRIMLGTFSLSSGYYDAYYKKAGQVRTLIIQDFEKVFADYDLILG
FT                   PTAPSVAYDLDSLNHDPVAMYLADLLTIPVNLAGLPGISIPAGFSQGLPVGLQLIGPKY
FT                   SEETIYQAAAAFEATTDYHKQQPVIFGGDN"
FT   gene            complement(417743..418045)
FT                   /gene="gatC"
FT                   /locus_tag="SPP_0469"
FT   CDS_pept        complement(417743..418045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="SPP_0469"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21966"
FT                   /db_xref="GOA:C1CIT9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIT9"
FT                   /protein_id="ACO21966.1"
FT                   /translation="MKITQEEVTHVANLSKLRFSEKETAAFATTLSKIVDMVELLGEVD
FT                   TTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPEQDNYYIKVPAILDDGGDA"
FT   gene            418258..419802
FT                   /gene="prfC"
FT                   /locus_tag="SPP_0470"
FT   CDS_pept        418258..419802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="SPP_0470"
FT                   /product="peptide chain release factor 3"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03144; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00503"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22146"
FT                   /db_xref="GOA:C1CIU0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIU0"
FT                   /protein_id="ACO22146.1"
FT                   /translation="MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIRDAGTVKG
FT                   KKTGTFAKSDWMDIEKQRGISVTSSVMQFDYDGKRVNILDTPGHEDFSEDTYRTLMAVD
FT                   AAVMVVDSAKGIEAQTKKLFEVVKHRGIPVFTFMNKLDRDGREPLDLLQELEEILGIAS
FT                   YPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNPFYEQVKDDIELL
FT                   NEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLEIFLKFAPEPHGHKKTDGEIVDPY
FT                   DKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAE
FT                   SRENVTNAVAGDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQ
FT                   KSFHKGIEQLVQEGAVQLYKNYQTGEYMLGAVGQLQFEVFKHRMESEYNAEVVMNPMGK
FT                   KTVRWIKPEDLDERMSSSRNILAKDRFDQPVFLFENDFALRWFADKYPDVELEEKM"
FT   gene            420071..420556
FT                   /locus_tag="SPP_0471"
FT   CDS_pept        420071..420556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0471"
FT                   /product="glycosyl transferase, family 8"
FT                   /note="identified by match to protein family HMM PF01501"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20787"
FT                   /protein_id="ACO20787.1"
FT                   /translation="MKEEKKAIVLGADNAYMDKVETTIKSLCVHHYNLKFYVFNDDLPR
FT                   EWFQLMEKRLETLNSEIVNVQIDSSILKGYRLPFEGLSYAAFFRYFIPKYVSESRVLYL
FT                   DSDIVVRKSIDELWDLDLTAIPLAAVRDDFYTHNFNSGVLLINNGMWRAENVTQDLI"
FT   gene            420672..420860
FT                   /gene="rpmB"
FT                   /locus_tag="SPP_0472"
FT   CDS_pept        420672..420860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SPP_0472"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20974"
FT                   /db_xref="GOA:C1CIU2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIU2"
FT                   /protein_id="ACO20974.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPK
FT                   KVWASARALKSGKVERV"
FT   gene            421017..421382
FT                   /locus_tag="SPP_0473"
FT   CDS_pept        421017..421382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0473"
FT                   /product="alkaline shock protein"
FT                   /note="identified by match to protein family HMM PF03780"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20639"
FT                   /protein_id="ACO20639.1"
FT                   /translation="MTVKINTKDGQIELTDEVIATVVGGAATEIFGVVGMASKNALKDN
FT                   FQALLGKENYSKGVVVKAAEDGSIAVDVYTVLSYGTKISEVSKNIQERVAFSLENQLGI
FT                   TAQTVNVYIQNIKVVGE"
FT   gene            421385..423052
FT                   /locus_tag="SPP_0474"
FT   CDS_pept        421385..423052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0474"
FT                   /product="dihydroxyacetone kinase family protein"
FT                   /note="identified by match to protein family HMM PF02734"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20715"
FT                   /protein_id="ACO20715.1"
FT                   /translation="MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMG
FT                   MTIENGAKEVADKPASTVGEVASILAKGLLMGARGNSGVITSQLFRGFSQAIKDKDELT
FT                   GQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAIGAKKKAEQTDDAVEVMRAALEGA
FT                   KTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALTGEYIASEDFVATPANMSEMI
FT                   NVEHHKSVAGHVATEDITFGYCTEIMVALKQGPTYAKDFDYDEFRNYLDELGDSLLVVN
FT                   DDEIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKSAEEKEY
FT                   ALIAVVAGKGLADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNIF
FT                   MAAQSAAEVLEQPAVVVEARTLPQGMTSLLAFDPSKSIEENQERMTAALSDVVSGSVTT
FT                   AVRDTTIDGLEIHENDNLGMVDGKILVSNPDMHQTLTETLKHMLDEDSEIVTFYVGEDG
FT                   SEELANEIAQEIVEEFEDVEVEIHQGQQPVYPYLFSVE"
FT   gene            423253..424953
FT                   /gene="ilvB"
FT                   /locus_tag="SPP_0475"
FT   CDS_pept        423253..424953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="SPP_0475"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20386"
FT                   /protein_id="ACO20386.1"
FT                   /translation="MEKISLESPKTGSDLVLETLRDLGVDTIFGYPGGAVLPFYDAIYN
FT                   FKGIRHILGRHEQGCLHEAEGYAKSTGKLGVAVVTSGPGATNAITGIADAMSDSVPLLV
FT                   FTGQVARAGIGKDAFQEADIVGITMPITKYNYQVRETADIPRIITEAVHIATTGRPGPV
FT                   VIDLPKDISALETDFIYSPEVNLPSYQPTLEPNDMQIKKILKQLSKAKKPVLLAGGGIS
FT                   YAEAATELNEFAERYQIPVVTSLLGQGTIATSHPLFLGMGGMHGSFAANIAMTEADFMI
FT                   SIGSRFDDRLTGNPKTFAKNAKVAHIDIDPAEIGKIISADIPVVGDAKKALQMLLAEPT
FT                   VHNNTEKWIEKVTKDKNRVRSYDKKERVVQPQAVIERIGELTNGDAIVVTDVGQHQMWT
FT                   AQYYPYQNERQLVTSGGLGTMGFGIPAAIGAKIANPDKEVVLFVGDGGFQMTNQELAIL
FT                   NIYKVPIKVVMLNNHSLGMVRQWQESFYEGRTSESVFDTLPDFQLMAQAYGIKNYKFDN
FT                   PETLAQDLEVITEDVPMLIEVDISRKEQVLPMVPAGKSNHEMLGVKFHA"
FT   gene            424946..425422
FT                   /gene="ilvN"
FT                   /locus_tag="SPP_0476"
FT   CDS_pept        424946..425422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="SPP_0476"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20836"
FT                   /protein_id="ACO20836.1"
FT                   /translation="MRRMLTAKLQNRSGVLNRFTGVLSRRQVNIESISVGATEDPNVSR
FT                   ITIIIDVASHDEVEQIIKQLNRQIDVIRIRDITDKPHLEREVILVKMSAPAEKRAEILA
FT                   IIQPFRATVVDVAPSSITIQMTGNAEKSEALLRVIRPYGIRNIARTGATGFTRD"
FT   gene            425488..426510
FT                   /gene="ilvC"
FT                   /locus_tag="SPP_0477"
FT   CDS_pept        425488..426510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="SPP_0477"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="identified by match to protein family HMM PF01450;
FT                   match to protein family HMM PF02629; match to protein
FT                   family HMM PF07991; match to protein family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20408"
FT                   /db_xref="GOA:C1CIU7"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIU7"
FT                   /protein_id="ACO20408.1"
FT                   /translation="MTVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDSGRDVI
FT                   IGVRPGKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAEIAPNLEAGNAV
FT                   GFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAVYQDATGNAKN
FT                   IAMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLTALIEAGFEVLTEAGYAPE
FT                   LAYFEVLHEMKLIVDLIYEGGFKKMRQSISNTAEYGDYVSGPRVITEQVKENMKAVLAD
FT                   IQNGKFANDFVNDYKAGRPKLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN
FT                   "
FT   gene            426617..426853
FT                   /locus_tag="SPP_0478"
FT   CDS_pept        426617..426853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21901"
FT                   /protein_id="ACO21901.1"
FT                   /translation="MLADQNKADWSYDENAVINIYDDANFEDGRLHMTFEQFFKLAQIA
FT                   REEGLEIHSPFERADATKSARYIAKWILRNKKH"
FT   gene            427091..427447
FT                   /locus_tag="SPP_0479"
FT   CDS_pept        427091..427447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0479"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21206"
FT                   /protein_id="ACO21206.1"
FT                   /translation="MNITNLFSIKTGCDETDRQLQKLFFQLDLQLGELTDQLRKLDSNF
FT                   VPRSQFVDTLDLNDVEYKEILNYFIFHRNDSEESLVEWLYDWISTNRYELPKEFSIRMA
FT                   HKYHESVTEVFGDE"
FT   gene            427497..428747
FT                   /gene="ilvA"
FT                   /locus_tag="SPP_0480"
FT   CDS_pept        427497..428747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="SPP_0480"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM PF00585; match to protein
FT                   family HMM TIGR02079"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21205"
FT                   /protein_id="ACO21205.1"
FT                   /translation="MLSSKDIIKAHKVLNGVVVNTPLDYDHYLSEKYGAKIYLKKENAQ
FT                   RVRSFKIRGAYYAISQLSKEERERGVVCASAGNHAQGVAYTCNEMKIPATIFMPITTPQ
FT                   QKIGQVRFFGGDFVTIKLVGDTFDASAKAAQEFTVSENRTFIDPFDDAHVQAGQGTVAY
FT                   EILEEARKESIDFDAVLVPVGGGGLIAGVSTYIKETSPEIEVIGVEANGARSMKAAFEA
FT                   GGPVKLKEIDKFADGIAVQKVGQLTYEATRQHIKTLVGVDEGLISETLIDLYSKQGIVA
FT                   EPAGAASIASLEVLAEYIKGKTICCIISGGNNDINRMPEMEERALIYDGIKHYFVVNFP
FT                   QRPGALREFVNDILGPNDDITRFEYIKRASKGTGPVLIGIALADKHDYAGLIRRMEGFD
FT                   PAYINLNGNETLYNMLV"
FT   gene            428889..429077
FT                   /locus_tag="SPP_0481"
FT   CDS_pept        428889..429077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20626"
FT                   /protein_id="ACO20626.1"
FT                   /translation="MAQISILHFDFLSIDKHSHTVFNTLRKSLQTTLALSATSKQCFEQ
FT                   LAASFLVCSLIFIEYKV"
FT   gene            429618..429833
FT                   /locus_tag="SPP_0482"
FT   CDS_pept        429618..429833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0482"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22192"
FT                   /protein_id="ACO22192.1"
FT                   /translation="MAKSNFEKVESVVGWVRDKKITGYRISKETNAREMSIIALAQGRA
FT                   KVKNISFETALGLIDFYEKNYEKFED"
FT   gene            complement(429942..430682)
FT                   /gene="gltL"
FT                   /locus_tag="SPP_0483"
FT   CDS_pept        complement(429942..430682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="SPP_0483"
FT                   /product="glutamate/aspartate ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21461"
FT                   /protein_id="ACO21461.1"
FT                   /translation="MTQAILEIKHLKKSYGQNEVLKDISLTVHKGEVISIIGSSGSGKS
FT                   TFLRSINLLETPTDGQILYHGQNVLEKGYDLTQYREKLGMVFQSFNLFENLNVLENTIV
FT                   AQTTVLKRERTEAEKIAKENLEKVGMGERYWQAKPKQLSGGQKQRVAIARALSMNPDAI
FT                   LFDEPTSALDPEMVGEVLKIMQDLAQEGLTMIVVTHEMEFARDVSHRVIFMDKGVIAEE
FT                   GKPEDLFTNPKEDRTKEFLQRYLK"
FT   gene            complement(430682..432247)
FT                   /locus_tag="SPP_0484"
FT   CDS_pept        complement(430682..432247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0484"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein/permease protein"
FT                   /note="identified by match to protein family HMM PF00497;
FT                   match to protein family HMM PF00528; match to protein
FT                   family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21655"
FT                   /protein_id="ACO21655.1"
FT                   /translation="MRKIYLSIFTSLLLMLGLVNVAQADEYLRIGMEAAYAPFNWTQDD
FT                   DSNGAVKIDGTNQYANGYDVQIAKKIAKDLGKEPLVVKTKWEGLVPALTSGKIDMIIAG
FT                   MSPTAERKQEITFSSSYYTSEPVLLVKKDSAYASAKSLDDFNGAKITSQQGVYLYNLIA
FT                   QIPGAKKETAMGDFAQMRQALEAGVIDAYVSERPEALTAEAANSKFKMIQVEPGFKTGE
FT                   EDTAIAIGLRKNDNRISQINASIETISKDDQVALMDRMIKEQPAEATTTEETSSSFFSQ
FT                   VAKILSENWQQLLRGAGITLLISIVGTIIGLIIGLAIGVFRTAPLSENKVIYGLQKLVG
FT                   WVLNVYIEIFRGTPMIVQSMVIYYGTAQAFGINLDRTLAAIFIVSINTGAYMTEIVRGG
FT                   ILAVDKGQFEAATALGMTHNQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLNVISVV
FT                   ELYFSGNTVATQTYQYFQTFTIIAVIYFVLTFTVTRILRFIERRMDMDTYTTGANQMQT
FT                   EDLK"
FT   gene            432385..434274
FT                   /locus_tag="SPP_0486"
FT   CDS_pept        432385..434274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21267"
FT                   /protein_id="ACO21267.1"
FT                   /translation="MKKTFFLLVLGLFCLLPLSVFAIDFKINSYQGDLYIHADNTAEFR
FT                   QKIVYQFEEDFKGQIVGLGRAGKMPSGFDIDPHPKIQAAKNGAELADVTSEVTEEADGY
FT                   TVRVYNPGQEGDIVEVDLVWNLKNLLFLYDDIAELNWQPLTDSSESIEKFEFHVRGDKG
FT                   AEKLFFHTGKLFRERTVEKSNLDYTIRLDNLPAKRGVELHAYWPRTDFASARDQGLKGN
FT                   RLEEFNKIEDSIVKEKDQSKQLLTWIFPSILSISLLLSICFYFIYRRKTAPSIKYAKNH
FT                   RLYEPPMELEPMVLSEAVYSTSLEEVSPLVKGAGKFTFDQLIQATLLDVIDRGNVSIIS
FT                   EGDAVGLRLVKEDGLSSFEKDCLNLAFSGKKEETLSNLFADYKVSDSLYRRAKVSDEKR
FT                   IQARGLQLKSSFEEVLNQMQEGVRKRVSFWGLPDYYRPLTGLEKALQVGMGVLTILPLF
FT                   IGFGLFLYSLDVHGYLYLPLPILGFLGLVLSVFYYWKLRLDNRDGVLNEAGAEVYYLWT
FT                   SFENMLREIARLDKAELESIVVWNRLLVYATLFGYADKVSHLMKVHQIQVENPDINLYV
FT                   AYGWHSMFYHSSAQMSHYASVANTASTYSVSSGSGSSGGGFSGGGGGGSIGAF"
FT   gene            complement(434271..434441)
FT                   /locus_tag="SPP_0485"
FT   CDS_pept        complement(434271..434441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0485"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22088"
FT                   /protein_id="ACO22088.1"
FT                   /translation="MKKWTFSRAFCRALKSSPNHQIEIRNSLDKTIDFSYSLSFFYLPL
FT                   YHTFSVYGSSL"
FT   gene            complement(434575..435123)
FT                   /locus_tag="SPP_0487"
FT   CDS_pept        complement(434575..435123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0487"
FT                   /product="transposase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21734"
FT                   /protein_id="ACO21734.1"
FT                   /translation="MDKIVGKHSEYTYQLLTRYPNPQKRLEARFDKLIEIKRLTASKIQ
FT                   DILSVAPRSIGTTSPAREFEIIEIIKHYKRLIDKAETCVNDLMAEFNSVITTVTGIGGR
FT                   LGAVILAEIRNIHAFDNPAQLQAFAGLDSSIYQSGQIDLAGRMIKRGSPHLRWALIQAA
FT                   KACARFSPAFKAYLKTKLE"
FT   gene            complement(435321..435443)
FT                   /locus_tag="SPP_0488"
FT   CDS_pept        complement(435321..435443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0488"
FT                   /product="transposase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21142"
FT                   /protein_id="ACO21142.1"
FT                   /translation="MLYVGIDVAKNKHDVTALNVRGKLFLNHSLFQIIKLVLNS"
FT   gene            435699..436544
FT                   /locus_tag="SPP_0489"
FT   CDS_pept        435699..436544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0489"
FT                   /product="undecaprenyl-diphosphatase (Undecaprenyl
FT                   pyrophosphatephosphatase) (Bacitracin resistance protein)"
FT                   /EC_number="3.6.1.27"
FT                   /note="identified by match to protein family HMM PF02673"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21479"
FT                   /db_xref="GOA:C1CIV9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIV9"
FT                   /protein_id="ACO21479.1"
FT                   /translation="MYLIEILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEA
FT                   FMSMFNVVIQLGAILAVMVIYFNKLNPFKPTKDKQEVRKTWRLWLKVLIATLPLLGVFK
FT                   FDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRNKARAIEPSVTELDKLPYTTAFYIGLF
FT                   QVLALLPGTSRSGATIVGGLLNGTSRSVVTEFTFYLGIPVMFGASALKIFKFVKAGELL
FT                   SFGQLFLLLVAMGVAFAVSMVAIRFLTSYVKKHDFTLFGKYRIVLGSVLLLYSFVRLFV
FT                   "
FT   gene            436537..436665
FT                   /locus_tag="SPP_0490"
FT   CDS_pept        436537..436665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22078"
FT                   /protein_id="ACO22078.1"
FT                   /translation="MYKKNLEGATLQGFILLENLFKPRQLYLQPQNSVLSSLRLAS"
FT   gene            complement(436691..437752)
FT                   /locus_tag="SPP_0491"
FT   CDS_pept        complement(436691..437752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0491"
FT                   /product="DNA polymerase IV (Pol IV)"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20313"
FT                   /protein_id="ACO20313.1"
FT                   /translation="MLIFPLLNDLSRKIIHIDMDAFFAAVEIKDNPKLRGKPVIIGSDP
FT                   RQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKAVGLQIRAIFK
FT                   RYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGISYNKFLAK
FT                   MASDYQKPHGLTVILPEQAENFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEV
FT                   TLIDRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIKKELTLLSE
FT                   KVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQISQIALQLYEELSEKE
FT                   RGVRLLGITLTGF"
FT   gene            complement(437797..437919)
FT                   /locus_tag="SPP_0492"
FT   CDS_pept        complement(437797..437919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0492"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20892"
FT                   /protein_id="ACO20892.1"
FT                   /translation="MEIEKQTRKLAAGCSKHCFEVVNRTDEVSSKYCFEVADGS"
FT   gene            438147..440471
FT                   /gene="pflB"
FT                   /locus_tag="SPP_0493"
FT   CDS_pept        438147..440471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflB"
FT                   /locus_tag="SPP_0493"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF02901; match to protein
FT                   family HMM TIGR01255"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21227"
FT                   /protein_id="ACO21227.1"
FT                   /translation="MVVKTVVEAQDIFDKAWEGFKGVDWKEKASVSRFVQANYTPYDGD
FT                   ESFLAGPTERSLHIKKIVEETKAHYEETRFPMDTRPTSIADIPAGFIDKENEVIFGIQN
FT                   DELFKLNFMPKGGIRMAETTLKENGYEPDPAVHEIFTKYVTTVNDGIFRAYTSNIRRAR
FT                   HAHTVTGLPDAYSRGRIIGVYARLALYGADYLMQEKVNDWNAIKEIDEETIRLREEVNL
FT                   QYQALQQVVRLGDLYGVDVRKPAMNVKEAIQWVNIAFMAVCRVINGAATSLGRVPIVLD
FT                   IFAERDLARGTFTESEIQEFVDDFVMKLRTVKFARTKAYDQLYSGDPTFITTSMAGMGN
FT                   DGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWTDKLPYNFRRYCMHMSHKHSSIQYEGV
FT                   TTMAKDGYGEMSCISCCVSPLDPENEEQRHNIQYFGARVNVLKALLTGLNGGYDDVHKD
FT                   YKVFDIDPIRDEVLEFESVKANFEKSLDWLTDTYVDALNIIHYMTDRYNYEAVQMAFLP
FT                   TKQRANMGFGICGFANTVDTLSAIKYATVKPIRDEDGYIYDYETIGDYPRWGEDDPRSN
FT                   ELAEWLIEAYTTRLRSHKLYKDAEATVSLLTITSNVAYSKQTGNSPVHKGVYLNEDGSV
FT                   NLSKLEFFSPGANPSNKAKGGWLQNLNSLSSLDFSYAADGISLTTQVSPRALGKTRDEQ
FT                   VDNLVTILDGYFENGGQHVNLNVMDLNDVYEKIMSGEDVIVRISGYCVNTKYLTPEQKT
FT                   ELTQRVFHEVLSMDDALDALS"
FT   gene            complement(440843..441061)
FT                   /locus_tag="SPP_0494"
FT   CDS_pept        complement(440843..441061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20678"
FT                   /protein_id="ACO20678.1"
FT                   /translation="MMSIREQDLQDIGAIIKYKNFHSPFDTFKYLKDMGFDTIDLSVLL
FT                   EGFSYAYGMDWLEKFFKENQDKLREFY"
FT   gene            complement(441388..441672)
FT                   /locus_tag="SPP_0495"
FT   CDS_pept        complement(441388..441672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21414"
FT                   /protein_id="ACO21414.1"
FT                   /translation="MDWYDYMIQASKQSQFNASHWFRYLRKVIFEDYSYLTNQDVEKLL
FT                   DSKELTRFQKISLKYAFQEHTPTHKYVISLNKPAKLTNVQKLMEKYKHG"
FT   gene            442064..442237
FT                   /locus_tag="SPP_0496"
FT   CDS_pept        442064..442237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20842"
FT                   /protein_id="ACO20842.1"
FT                   /translation="MLIINRFFSLFVLDWYRTDLWINPLVSYPVPKYVGRKMKQLLRVS
FT                   VLEKILSIQFFK"
FT   gene            complement(442876..442989)
FT                   /locus_tag="SPP_0497"
FT   CDS_pept        complement(442876..442989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20391"
FT                   /protein_id="ACO20391.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVVDRTDEVSNIYTVRRR"
FT   gene            complement(443277..444500)
FT                   /locus_tag="SPP_0498"
FT   CDS_pept        complement(443277..444500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0498"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21797"
FT                   /protein_id="ACO21797.1"
FT                   /translation="MITKQSAFLQNRATILEFLYRNPATSRTDIVNETGLTPATTTNII
FT                   KELSEQSLIYETGDEFSEFSGSGRRRKTISITDNIPYVVGGIEINVLGIFLSLCDLQGK
FT                   TLFETEILNEDYPISEINSTITNMIKTAIEYVPLETKLLGFGLSIPGHYNKDSGSIITN
FT                   NPIWESFNLLNVIKRFNFPFIVKNNIDCMAIGQYLFNPHNTPDNFIFLHAGLGIYTSFF
FT                   TKEKIGASKNPYIGEIGHTIVELNGQYCECGKKGCLQTYISDAWLIKHAQLLFKNSQLT
FT                   VLKSLVKTEKDIHLDTLLTAYNLGDSALRQQIDKGVNLLATSIANLLLINPADKIYINS
FT                   QLLNYQPFTHEVRDKIQDQLHFVPFTRNIEIEILPYNKHRGSIGACALAIVAFFIEHSN
FT                   VLQDIISP"
FT   gene            444668..445990
FT                   /locus_tag="SPP_0499"
FT   CDS_pept        444668..445990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0499"
FT                   /product="lichenan permease iic component (pts system
FT                   lichenan-specific eiiccomponent) (eiic-lic)"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21304"
FT                   /protein_id="ACO21304.1"
FT                   /translation="MNNILAFLETKVAPFGEKVGNQRHLKAIREGFMMAMPLILVGSLF
FT                   LILISWPQEDFTNWLNSVGLLSILTTMNQSTVAIISLVACFGIAYRLSEGYGTDGPSAG
FT                   IIALSSFVLMAPRFSSMVYDKNGEQVKQLFGGAIPFSSLNASSLFMAITIGLVTAEIYR
FT                   MFIQRGITIKMPSGVPDVVSKSFSALLPGFTTFVLWALVLKGLEAAGVAGGLNGLLGGI
FT                   VGTPLKLIAGTLPGMILCVIVNSFFWFCGVNGGQVLNAFVDPVWLQFTIENQEAVAAGQ
FT                   TLQHIITLPFKDLFVFIGGGGATIGLAICLFLFSKSRANKTLGKLAIIPSIFNINTAIL
FT                   FTFPTVLNPIMLIPFIATPTINALITYVSMAVGLVPYTTGVILPWTMPPIIGGFLATGA
FT                   SWRGALLQVVLILVSVAIYYPFFKIADKRNLEKEKATVGGK"
FT   gene            445992..447878
FT                   /locus_tag="SPP_0500"
FT   CDS_pept        445992..447878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21481"
FT                   /protein_id="ACO21481.1"
FT                   /translation="MVIRVFDQQKNTYSSFALEELSYYMNRVFKTNIELVEEKEADIFV
FT                   GLVNKEDRKDHVLISLDKGKGRIESNTIVGLLIGIYRMFHEFGVVYTRPGRRHDFVPEL
FT                   RFEDFLDKQLSIDETASYYHRGVCIEGADSFENILDFIDWLPKIGMNSFFIQFENPYSF
FT                   LKRWYEHEFNPYLNKEQFSNELVQELSDRLDKELQKRGLIHHRVGHGWTGEVLGYSSKF
FT                   GWESGLSISEEKKPYVAEINGKRELFNTAPILTSLDFSNPDVADKMVEIIKDYAKKRPD
FT                   VNYLHVWLSDARNNICECENCRQELVSDQYIRILNQLDRALTSEGLDTKICFLLYHELL
FT                   WAPQKEKLDNPERFTMMFAPITRTFEMSYADVDFDNSIPTPKPYLRNKIILPNSLEENL
FT                   SYLFEWQKTFKGDSFVYDYPLGRAHYGDLGYMKISQTIYRDVSYLSNLHLNGYISCQEL
FT                   RAGFPHNFPNYVMGEMLWKKTRSYEELIEEYFSALYGSNWQSVVEYLEKLSSYSSCDYF
FT                   NAIGSRQNDVLANHYYIAYNLADNFLPIIEENISKLLNSQKDEWKQLSYHREYVVKMAK
FT                   ALYLQATGKTRQAQDEWRNVLNYIRGHELLFQSNLDVYRVIEVAKNYAGFHL"
FT   gene            448046..448390
FT                   /locus_tag="SPP_0501"
FT   CDS_pept        448046..448390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0501"
FT                   /product="lactose-specific phosphotransferase enzyme iia
FT                   component (pts system lactose-specific eiia component)
FT                   (eiia-lac) (eiii-lac)"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21189"
FT                   /protein_id="ACO21189.1"
FT                   /translation="MKSKEEINMLGFTIVAYAGDARSDLMDALAFARDGYFEQARELVE
FT                   SANDSIVSAHREQTNLLAEEASGDNFEVSFIMIHGQDTLMTTMLLYDQVKFFIDEYERI
FT                   RKIEEHIGLQ"
FT   gene            448400..449812
FT                   /gene="lacG1"
FT                   /locus_tag="SPP_0502"
FT   CDS_pept        448400..449812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacG1"
FT                   /locus_tag="SPP_0502"
FT                   /product="6-phospho-beta-galactosidase"
FT                   /EC_number="3.2.1.85"
FT                   /note="identified by match to protein family HMM PF00232;
FT                   match to protein family HMM TIGR01233"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20284"
FT                   /protein_id="ACO20284.1"
FT                   /translation="MENLQVKALPKEFLLGAATAAYQVEGATRVDGKGTNMWDVYLQEN
FT                   SPFLPDPASDFYYRYEEDIALAAEHGLQALRLSISWVRIFPDIDGEPNILAVRYYHRVF
FT                   QSCLKHNVIPFVSLHHFDSPQKMLETGDWLNRENIDRFIRYARFCFQEFTEVKHWFTIN
FT                   ELMSLAAGQYIGGQFPPNHHFQLSEAIQANHNMLLAHALAVREFHQLGIEGKIGCIHAL
FT                   KPGYPIDGQKENILAAKRYDVYNNKFLLDGTFLGYYSEDTLFHLNQILEANNSSFIIED
FT                   GDLEIMKRAAALNTMFGMNYYRSEFIREYKGENRQEFNSTGIKGQSSFKLNALGEFVKK
FT                   PGIPTTDWDWNIYPQGLFDMLLRIKEEYPQHPVIYLTENGTALKEVKPEGENDIIDDSK
FT                   RIRYIEQHLHKVLEARDRGVNIQGYFIWSLQDQFSWANGYNKRYGLFFVDYETQKRYIK
FT                   KSALWVKGLKRN"
FT   gene            449882..451561
FT                   /locus_tag="SPP_0503"
FT   CDS_pept        449882..451561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0503"
FT                   /product="pts system lactose-specific eiicb component
FT                   (eiicb-lac) (eii-lac)"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF02302;
FT                   match to protein family HMM PF02378"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22093"
FT                   /protein_id="ACO22093.1"
FT                   /translation="MDKLVAAIEKQQGKFEKISTNNYMMAIKDGFIATMPLIMFSSFLM
FT                   IIIMIPKNFGVELPSPAIAWMRKVYMLTMGVLGIIVSGTVAKSLAGNVNRKMPPGKVIN
FT                   DTSAMLAAICGYLVLTVTLVVDEKTGSTSLSTNYLGSQGLITSFVSAFITVNVYRFCIK
FT                   RDITIHLPKEVPGAISQAFRDIFPFSFVLLISGLLDIVSRFSLDVPFAQVFQQLLTPIF
FT                   KGAESYPAMMLIWFMCALLWFVGIHGPSIVLPAVTALQLSNMEENAQLLANGQFPYHSL
FT                   TPNFGNYIAAIGGTGATFVVPFILIFFMRSKQLKSVGKATITPVLFAVNEPLLFGMPVI
FT                   LNPYLFVPFLMTPPVNVFLGKVFIDFFGMNGFYIQLPWAFPGPLGLLIGTNFQLISFVF
FT                   LSLMLVVDILIYLPFCRAYDRQLLVKEDIASSNDIILEEDTSEIMPCEIDVIKSKELKV
FT                   LVLCAGSGTSAQLANAINEGAQLAEVRVIANSGAYGAHYDIMGVYDLIILAPQVRSYYR
FT                   EMKVDAERLGIQIVATRGMEYIHLTKSPSKALQFVLEHYQAV"
FT   gene            complement(451687..453126)
FT                   /locus_tag="SPP_0504"
FT   CDS_pept        complement(451687..453126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0504"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by match to protein family HMM PF02386"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20383"
FT                   /protein_id="ACO20383.1"
FT                   /translation="MNKSMIRYLLSKLLLIEAVLLLVPVAIAVYYRESSQVFTALFSTI
FT                   GILVLLGGSGSLQKPKNQRIYAKEGVLIVALCWILWSFFGGLPFVFSGQIPSVIDAFFE
FT                   ISSGFTTTGASILNDISVLSRSLLFWRSFTHLIGGMGVLVFALAIMDNAKNSHLEVMKA
FT                   EVPGPVFGKVVSKLKNTAQILYLLYLALFSLFVIIYYLAGMPLYDSFVIAMGTAGTGGF
FT                   TVYNDGIAHYGSSLITYLVSIGVLVFGVNFNLYYYLMLRRIKAFFGDEELRAYLVIVLV
FT                   STGLISLNTLYLYPGFSKSFEMTFFQVSNIITTTGFGYGDITNWPLFSQFILLFLMAIG
FT                   GSAGSTAGGLKIIRGLILSKIAKNQILSILSPHRVLTLHVNKTVIDKDTQHKILKYFVI
FT                   YAMILLALIFIVSLDSNDFLVVTSAVFSCFNNIGPILGTTSSFSIFSPISKILLSFAMI
FT                   AGRLEIYPILLLFMKRTWSKR"
FT   gene            complement(453130..454479)
FT                   /locus_tag="SPP_0505"
FT   CDS_pept        complement(453130..454479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0505"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by match to protein family HMM PF02080;
FT                   match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22044"
FT                   /protein_id="ACO22044.1"
FT                   /translation="MKIILVGGGKVGFALCRSLVAEKHDVLLIEQDEAVLNHIVNRFDI
FT                   IGILGNGADFAILEQASVQDCDIFIALTEHDEVNMIAAVLAKKMGAKETIVRVRNPEYS
FT                   NSYFKEKNILGFSLIVNPELLAARAIANIIDFPNALSVERFAGGRVSLMEFVVKSTSGL
FT                   CQMPISDFRKKFGNVIVCAIERDHQIIIPSGDMTVQDKDRIFVTGNRVDMILFHNYFKS
FT                   RAVKSLLIVGAGRIAYYLLGILKDSRIDTKVIEINPEIASFFSEKFPNLYIVQGDGTAK
FT                   DILLEESAQHYDAVATLTGVDEENLITSMFLDRVGVQKNITKVNRTSLLEIINAPDFSS
FT                   IITPKSIAVDTIMHFIRGRVNAQYSDLQAMHHLANGQIETLQFHIKEANKMTAKPLSQL
FT                   KLKKGVLIAAIIRKGKTIFPTGEDMLEVGDKLLVTTLLPNITKIYDLIAR"
FT   gene            454667..455515
FT                   /locus_tag="SPP_0506"
FT   CDS_pept        454667..455515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0506"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF01887"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22189"
FT                   /protein_id="ACO22189.1"
FT                   /translation="MNNNLLVLQSDFGLVDGAVSAMIGVALEESPTLKIHHLTHDITPY
FT                   NIFEGSYRLFQTVDYWPEGTTFVSVVDPGVGSKRKSVVAKTAKNQYIVTPDNGTLSFIK
FT                   KHVGIVAIREISEVANRRQNTEHSYTFHGRDVYAYTGAKLASGHITFEEVGPELSVEQI
FT                   VELPVVATIIEDHLVKGAIDILDVRFGSLWTSITREEFYKLEPEFGDRFEVTIYHADML
FT                   VYQNQVVYGKSFADVRIGQPILYINSLYRLGLAINQGSFAKAYNVGVGSSWTIEIKKIE
FT                   G"
FT   gene            455530..456078
FT                   /locus_tag="SPP_0507"
FT   CDS_pept        455530..456078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0507"
FT                   /product="protein YdcD"
FT                   /note="identified by match to protein family HMM PF07155"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21407"
FT                   /db_xref="GOA:C1CIX7"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIX7"
FT                   /protein_id="ACO21407.1"
FT                   /translation="MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQA
FT                   LLSIIFGPIIGLLVGLIGHAIKDSLAGYGLWWTWIIASGLFGLVVGLFRKYVRVINGVF
FT                   DWKDILIFNLIQLLANALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGT
FT                   LLLLAYAGTQTRAGSLKKD"
FT   gene            456085..456342
FT                   /locus_tag="SPP_0508"
FT   CDS_pept        456085..456342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20693"
FT                   /protein_id="ACO20693.1"
FT                   /translation="MKIKEQTRKLAAGCSKQCFEIVDRTDEVSSKHGFEVVDETDEVSN
FT                   HTYGKAKLTWFEEIFEEYKMMGKAGQLVFFDVYRLVRQVS"
FT   gene            456444..458126
FT                   /locus_tag="SPP_0509"
FT   CDS_pept        456444..458126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0509"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20987"
FT                   /protein_id="ACO20987.1"
FT                   /translation="MKEAIIEWKDFSFRYETQQEPTLQGIDLTIYKGEKVLIVGPSGSG
FT                   KSTLGQCLNGIIPNIYKGQTYGEFLIKGQVAFDMSIYDKSHLVSTVLQDTDGQFIGLSV
FT                   AEDLAFALENDVTALDEMKGRVYKWAEKLDLLPLLDQRPQDLSGGQKQRVSLAGVLIDE
FT                   SPILLFDEPLANLDPKSGQDIIELIDQIHKEEGTTTLIIEHRLEDVLHRPVDRIVLIND
FT                   GRILFNGSPDQLLATDLLTQNGIREPLYLTTLRQLGVDLVKEEQLADLDNLSISKGQVQ
FT                   LQTELVKETSELQSLFRLEEVSFSYDDRPILKSLHLDIKKGEKIAIVGKNGAGKSTLAK
FT                   AISSFIQTEGRYLWEKQDIKGDSVAERAERVGYVLQNPNQMISTNMIFDEVALGLRLRG
FT                   VDEKEIETRVYETLKICGLYEFRNWPISALSFGQKKRVTIASILVLGAEIILLDEPTAG
FT                   QDQKNYTEIMEFLEELHQKGHTIVMITHDMQLMLDYSDRVLVMVDGELIADTVPASLLS
FT                   DPELLVKANLKETSIFNLAKKLDVDPLDLTAFYKERREGCKLN"
FT   gene            458111..458941
FT                   /locus_tag="SPP_0510"
FT   CDS_pept        458111..458941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0510"
FT                   /product="cobalt transport family protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20516"
FT                   /protein_id="ACO20516.1"
FT                   /translation="MQAKLIGYQHRDTVIHRLSGAGKLLFFILVSLAAMISYDTRMLLL
FT                   IAIFSVFLLYLSEIRFKDVSFVAVFATVFAVLNVLMVYLFSPEYGVGLYGERSVIWQGI
FT                   GVYTLTSQELFYLLNLAIKYLCTIPLAIIFLMTTHPSQFASSLNQIGVPYKIAYSVSLT
FT                   LRYIPDLQEEFFTIKMSQEARGMELSKKASLMQRIKGNLLIITPLIFSSLERIDTIATA
FT                   MELRRFGKEKKRTWYSYQALKKGDYITLLLATLFLVVSLLLILQNQGRFYNPWK"
FT   gene            459134..459637
FT                   /gene="cspR"
FT                   /locus_tag="SPP_0511"
FT   CDS_pept        459134..459637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspR"
FT                   /locus_tag="SPP_0511"
FT                   /product="CspR"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22147"
FT                   /protein_id="ACO22147.1"
FT                   /translation="MTNHIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRKM
FT                   KRAGLDYWDKLEIYFYESLEDFISQMKGKLYLISKFAEKVYSEVDLSTDEDHYFLFGRE
FT                   DKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQNFAGLELVHTYEV
FT                   DKLK"
FT   misc_binding    459813..459925
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element); riboswitch00002"
FT   gene            460090..460653
FT                   /locus_tag="SPP_0512"
FT   CDS_pept        460090..460653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21681"
FT                   /protein_id="ACO21681.1"
FT                   /translation="MTNTRRLSTIAILSAISFVLMYFDFPLLPAASFLKIEFSILPVLV
FT                   GLVVMDLPAALGVLLLRSLLKLLLNSQGVNTYIGLPMNIVALGVFVIVFALIWKKERTT
FT                   LRFLLGSLAGTVGLTLAMLVLNYVYAVPLYAKFANFDIGKILGLSNYLMTMVLPFNLIE
FT                   GVIFSVSFWLLYVLLKPTLKHYER"
FT   gene            460667..461293
FT                   /locus_tag="SPP_0513"
FT   CDS_pept        460667..461293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0513"
FT                   /product="PAP2 family protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20729"
FT                   /protein_id="ACO20729.1"
FT                   /translation="MKGSFALLLFVILGYMVKFYPEMLVNFDQSIQTAIRGDLPDYLTI
FT                   LFRSLTRLIDIPVIITWVVITAFVFYRKRWKIESFFMLGNLALAGLLIVTFKNIYQRPR
FT                   PAILHLVEEKGFSFPSGHSLAVTLMVGTLIVILSQRIKDPVWRKIVQIVLGLYLVSVLV
FT                   SRVYLGVHYPSDVLASLCVGLGVLFIEFPFYDKLRFQWRFKGKQK"
FT   gene            461321..461710
FT                   /locus_tag="SPP_0514"
FT   CDS_pept        461321..461710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0514"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20269"
FT                   /protein_id="ACO20269.1"
FT                   /translation="MKVNIADLHPTQLYLSEKKLQDIQMLYQSAETIQVDPISILAFGD
FT                   CLLITDGHHRAYQALLAGRDTISAEWDRDGGDELYHLYAQACEERKIYSVFDLEDRILA
FT                   QDGYEAKWYNWCDGFNQAATLLLKR"
FT   gene            461715..462164
FT                   /locus_tag="SPP_0515"
FT   CDS_pept        461715..462164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21076"
FT                   /protein_id="ACO21076.1"
FT                   /translation="MCFVPYYKVNYCEEAFAWYQDVNLVYLVDGVKLPYSQATLEAMYS
FT                   YLDRHGELFWIEVKEKGEWFPIGDITLSQDNLPIVIGNSAYQHRGLGKKILSALIELAR
FT                   VKGWKELRVKEIYTYNHASRRCFKSLGFVENGATEKGRSFILELV"
FT   gene            462292..462879
FT                   /gene="rpoE"
FT                   /locus_tag="SPP_0516"
FT   CDS_pept        462292..462879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="SPP_0516"
FT                   /product="DNA-directed RNA polymerase, delta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF05066"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21779"
FT                   /db_xref="GOA:C1CIY6"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIY6"
FT                   /protein_id="ACO21779.1"
FT                   /translation="MELEVFAGQEKSELSMIEVARAILELRGRDHEMHFSDLVNEIQNY
FT                   LGTSNSDIREALPLFYTELNFDGSFISLGDNKWGLRSWYGVDEIDEEIIALEENDDDEV
FT                   APKAKKKRVNAFMDGDSDAIDYNADDPEDEDAYEADPALSYDDENPDDEKNEVEAYDAE
FT                   INEIAPDDLGEDVDLNEDDDEFSDDDAETSEE"
FT   gene            463015..463140
FT                   /locus_tag="SPP_0517"
FT   CDS_pept        463015..463140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0517"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20798"
FT                   /protein_id="ACO20798.1"
FT                   /translation="MKIKEQARKLAVGCSKHCFEVVDKTDKVRNTYLRQGDVDAV"
FT   gene            463269..464876
FT                   /gene="pyrG"
FT                   /locus_tag="SPP_0518"
FT   CDS_pept        463269..464876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SPP_0518"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF06418; match to protein
FT                   family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21243"
FT                   /protein_id="ACO21243.1"
FT                   /translation="MSTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYI
FT                   NIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKER
FT                   RGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMK
FT                   ADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGI
FT                   KNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAPAADMTEWSAM
FT                   VDKVMNLKKQVKISLVGKYVELQDAYISVVEALKHSGYVNDVEVKINWVNANDVTAENV
FT                   AELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGL
FT                   EGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQ
FT                   RRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPN
FT                   RPEELYTAFVTAAVENSN"
FT   gene            complement(465435..467066)
FT                   /locus_tag="SPP_0519"
FT   CDS_pept        complement(465435..467066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0519"
FT                   /product="sodium-dependent phosphate transporter"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM PF02690; match to protein
FT                   family HMM TIGR00704"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22004"
FT                   /protein_id="ACO22004.1"
FT                   /translation="MSINWQEILFHFLGGLGLFLYSIKTMGDGLQQAAGDRLRFYIDKY
FT                   TSNPFFGVLVGIGMTALIQSSSGVTVITVGLVSAGLLTLRQAIGIVMGANIGTTVTSFL
FT                   IGFKLGNYALPMLFIGAVCLFFTKNRTVNNIGRILFGVGGIFFALNLMSGAMAPLKDLQ
FT                   VFKDYMIELSKNPVLGVFVGTGLTLLIQASSATIGILQNLYAGNLIDLQGALPVLFGDN
FT                   IGTTITAIIASLGANIAAKRVAGAHVAFNVIGTVVCVIFLVPFTVLIHWFEATLNLAPE
FT                   MTIAFAHGTFNITNTIVQFPFIGALAYFVTKIIPGEDEVVKYEPLYLDEHFIKQAPSIA
FT                   LGNAKKELLHLGNYAAKAFDLSYKYIIDLDEKVAEKGHKTEEAINTIDEQLTRYLIALS
FT                   SEALSQKESEVLTNILDSSRDLERIGDHTEALLNLTDYLQRKNVEFSDAALKELEEVYR
FT                   QTSDFIKDALDSVENNDIEKARSLVERHEAINKIERVLRKTHIKRLNKGECSTQAGVNF
FT                   IDIISHYTRVSDHAMNLAEKVFAEQI"
FT   gene            467431..472299
FT                   /locus_tag="SPP_0520"
FT   CDS_pept        467431..472299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0520"
FT                   /product="endo-beta-N-acetylglucosaminidase D"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF00754; match to protein
FT                   family HMM PF03644; match to protein family HMM PF07501;
FT                   match to protein family HMM PF07523; match to protein
FT                   family HMM PF07554; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20310"
FT                   /protein_id="ACO20310.1"
FT                   /translation="MIGAVLFVGPALAEETAVPENSGANTELVSGESEHSTNEADKQNE
FT                   GEHTRENKLEKAEGVATASETAEAASAAKPEEKAGEVVAETPSAEAKPKSDKETEAKPE
FT                   ATNQGDESKPAAEANKTEKEVQPDVPKNTEKTLKPKEIKFNSWEELLKWEPGAREDDAI
FT                   NRGSVVLASRRTGHLVNEKASKEAKVQALSNTNSKAKDHASVGGEEFKAYAFDYWQYLD
FT                   SMVFWEGLVPTPDVIDAGHRNGVPVYGTLFFNWSNSIADQERFAEALKQDADGSFPIAR
FT                   KLVDMAKYYGYDGYFINQETTGDLVKPLGEKMRQFMLYSKEYAAKVNHPIKYSWYDAMT
FT                   YNYGRYHQDGLGEYNYQFMQPEGDKVPADNFFANFNWDKAKNDYTIATANWIGRNPYDV
FT                   FAGLELQQGGSYKTKVKWNDILDENGKLRLSLGLFAPDTITSLGKTGEDYHKNEDIFFT
FT                   GYQGDPTGQKPGDKDWYGIANLVADRTPAVGNTFTTSFNTGHGKKWFVDGKVSKDSEWN
FT                   YRSVSGVLPTWRWWQTSTGEKLRAEYDFTDAYNGGNSLKFSGDVAGKTDQDVRLYSTKL
FT                   EVTEKTKLRVAHKGGKGSKVYMAFSTTPDYKFDDADAWKELTLSDNWTNEEFDLSSLAG
FT                   KTIYAVKLFFEHEGAVKDYQFNLGQLTISDNHQEPQSPTSFSVVKQSLKNAQEAEAVVQ
FT                   FKGNKDADFYEVYEKDGDSWKLLTGSSSTTIYLPKVSRSASAQGTTQELKVVAVGKNGV
FT                   RSEAATTTFDWGMTVKDTSLPKPLAENIVPGATVIDSTFPKTEGGEGIEGMLNGTITSL
FT                   SDKWSSAQLSGSVDIRLTKPRTVVRWVMDHAGAGGESVNDGLMNTKDFDLYYKDADGEW
FT                   KLAKEVRGNKAHVTDITLDKPITAQDWRLNVVTSDNGTPWKAIRIYNWKMYEKLDTESV
FT                   NIPMAKAAARSLGNNKVQVGFADVQAGATITVYDNPNSQTPLATLKSEVGGDLASAPLD
FT                   LTNQSGLLYYRTQLPGKEISNVLAVSVPKDDRRIKSVSLETGPKKTSYAEGEDLDLRGG
FT                   VLRVQYEGGTEDELIRLTHAGVSVSGFDTHHKGEQNLTLQYLGQPVNANLSVTVTGQDE
FT                   ASPKTILGIEVSQKPKKDYLVGDSLDLSEGRFAVAYSNDTMEEHSFTDEGVEISGYDAQ
FT                   KTGRQTLTLRYQGHEVNFDVLVSPKAALNDEYLKQKLAEVEAAKNKVVYNFASPEVKEA
FT                   FLKAIEAAEQVLKDHEISTQDQVNDRLNKLTEAHKALNGQEKFKEEKTELDRLTGEVQE
FT                   LLDAKPNHPSGSALAPLLEKNKVLVEKVDLSPEELATAKQSLKDLVALLKEDKPAVFSD
FT                   SKTGVEVHFSNKEKTVIKGLKVERVQASAEEKKYFAGEDAHVFEIEGLDEKGQDVDLSY
FT                   ASIVKIPIEKDKKVKKVFFLPEGKEAVELAFEQTDSHVIFTAPHFTHYAFVYESAEKPQ
FT                   PAKPAPQNKVLPKPTYQPASDQQKAPKLEVQEEKVAFHRQEHENAEMLVGEQRVIIQGR
FT                   DGLLRHVFEVDENGQRRLRSTEVIQEAIPEIVEIGTKVKTVPAVVATQEKPAQNTAVKS
FT                   EEASKQLPNTGTADANEALIAGLASLGLASLALTLRRKREDKD"
FT   gene            472389..473585
FT                   /gene="pgk"
FT                   /locus_tag="SPP_0521"
FT   CDS_pept        472389..473585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SPP_0521"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="identified by match to protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21550"
FT                   /db_xref="GOA:C1CIZ1"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CIZ1"
FT                   /protein_id="ACO21550.1"
FT                   /translation="MAKLTVKDVDLKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIK
FT                   YIIEQGGRAILFSHLGRVKEEADKAGKSLAPVAADLAAKLGQDVVFPGVTRGAELEAAI
FT                   NALEDGQVLLVENTRYEDVDGKKESKNDPELGKYWASLGDGIFVNDAFGTAHRAHASNV
FT                   GISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEKADKV
FT                   LIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKALLEKANGKLILPVDSKEANAFAGYTE
FT                   VRDTEGEAVSEGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAGTIGVMD
FT                   AIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGLAALTEK"
FT   gene            473721..474248
FT                   /locus_tag="SPP_0522"
FT   CDS_pept        473721..474248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22035"
FT                   /protein_id="ACO22035.1"
FT                   /translation="MSYFKKYKFDKSQFKLGMRTFKTGIAVFLVLLIFGFFGWKGLQIG
FT                   ALTAVFSLRESFDESVHFGTSRILGNSIGGLYALVFFLLNTFFHEAFWVTLVVVPICTM
FT                   LTIMTNVAMNNKAGVIGGVAAMLIITLSIPSGETISYVFVRVSETFMGVFVAIIVNYDI
FT                   DRIRLFLEKKEK"
FT   gene            474325..474681
FT                   /locus_tag="SPP_0523"
FT   CDS_pept        474325..474681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0523"
FT                   /product="HTH-type transcriptional regulator GlnR"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20633"
FT                   /protein_id="ACO20633.1"
FT                   /translation="MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQELIKPDRNEG
FT                   NRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRRALHNELLQ
FT                   QGRFASVQSPFGRG"
FT   gene            474718..476064
FT                   /gene="glnA"
FT                   /locus_tag="SPP_0524"
FT   CDS_pept        474718..476064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="SPP_0524"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="identified by match to protein family HMM PF00120;
FT                   match to protein family HMM PF03951; match to protein
FT                   family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21126"
FT                   /protein_id="ACO21126.1"
FT                   /translation="MPITAADIRREVKEKNVTFIRLMFSDILGTMKNVEIPATDEQLDK
FT                   VLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWTVFPWGDENGSVAGLICDVYTTEGEP
FT                   FAGDPRGNLKRALRHMEEVGFKSFNLGPEPEFFLFKLDENGDPTLEVNDKGGYFDLAPT
FT                   DLADNTRREIVNVLTKMGFEVEASHHEVAVGQHEIDFKYDEVLRACDKIQIFKLVVKTI
FT                   ARKHGLYATFMAKPKFGIAGSGMHCNMSLFDAEGNNAFFDPNDPKGMQLSETAYHFLGG
FT                   LIKHAYNYTAIMNPTVNSYKRLVPGYEAPVYIAWAGRNRSPLVRVPASRGMGTRLELRS
FT                   VDPMANPYIAMAVLLEVGLYGIENKIEAPAPIEENIYIMTAEERKEAGITDLPSTLHNA
FT                   LKALTEDEVVKAALGDHIYTSFLEAKRIEWASYATFVSQWEIDNYLDLY"
FT   gene            complement(476507..477853)
FT                   /locus_tag="SPP_0525"
FT   CDS_pept        complement(476507..477853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0525"
FT                   /product="Spn1 transposase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21569"
FT                   /protein_id="ACO21569.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKER
FT                   ISKYLVTNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVRSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGF
FT                   FGDKTDSSSLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVR
FT                   TGRKQLLKLSSLYAYSELFSALYPRIRKVNLNLPVPYEPPRRKASLMMH"
FT   gene            478239..478376
FT                   /locus_tag="SPP_0526"
FT   CDS_pept        478239..478376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20585"
FT                   /protein_id="ACO20585.1"
FT                   /translation="MNPDRAEEYFCRGCQGENPEDIEFYDEQLQAEKVEALNIRLEVKN
FT                   "
FT   misc_feature    478476..487936
FT                   /note="unresolved collapsed repeat"
FT   gene            478547..479827
FT                   /locus_tag="SPP_0527"
FT   CDS_pept        478547..479827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0527"
FT                   /product="type I site-specific deoxyribonuclease chain S"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21172"
FT                   /protein_id="ACO21172.1"
FT                   /translation="MRIKSIYWNFGQNKPEKSFRYIDTSSIDRKKNIINYKNLQYLSPE
FT                   QAPSRARKLVSQNSVLFSTVRPYLKNIAVVRELKEYLIASTAFIVLDTLLNETYLKYYL
FT                   LSDNFINRVNNKSTGTSYPAINDYNFNLLLIALPPLSEQQRIVEAIESALEKVDEYAES
FT                   YNRLEQLDKEFPDKLKKSILQYAMQGKLVEQDPNDESVEVLLEKIRAEKQKLFEEGKIK
FT                   KKDLDISIVSQGDDNSYYEEVPCEIPESWEWVRLNDITSYIQRGKSPKYSNIPIYPVIA
FT                   QKCNQWSGFSIDLARFIDPETVHSYQKERLLRDGDLMWNSTGLGTLGRLAIYHENKNPY
FT                   AWAVADSHVTVIRVLSGVINCHFIYNFLSSPIVQSVIEEKASGSTKQKELLTKTIKEYL
FT                   IPLPPLPEQSRIVDKIEQFFAHIDALI"
FT   gene            479884..480681
FT                   /locus_tag="SPP_0528"
FT   CDS_pept        479884..480681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0528"
FT                   /product="integrase/recombinase, phage integrase family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21487"
FT                   /protein_id="ACO21487.1"
FT                   /translation="MKDFELHLKKAGLAENTVRSYLYGVRFFLENYELKMEDLFEYKGY
FT                   LLDNFKPKTVNLRLQGVNKYLAFIGHDDLKLKFVKVQQKPFLEDVISHADYLFLKRSLK
FT                   KDGILKWHFVVWFLGATGARVSELIKLKVEHVEIGYFDIYSKGGKIRRLYIPKKLRNSC
FT                   LSWLESENRRSGYLFLNKFNEPITARGVAQQLKNYADKYKMNPKVIYPHSFRHLFAKNF
FT                   LAKYNDIALLADLMGHESIETTRIYLRKTATEQQNIVDKIVNW"
FT   gene            480692..481297
FT                   /locus_tag="SPP_0530"
FT   CDS_pept        480692..481297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0530"
FT                   /product="type I restriction-modification system, S
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20897"
FT                   /protein_id="ACO20897.1"
FT                   /translation="MVKLTTCYFCDYGSYYGNIPMNWVVIKIKDIFSMNTGLSYKKGDL
FT                   SINNKGVRIIRGGNIKPLEFSLLDNDYYIDTQFISSEQVYLKHNQLITPVSTSLEHIGK
FT                   FARIDKDYDGVVAGGFIFQLTPFESSEIISKFLLFNLSSPLFYKQLKAITKLSGQALYN
FT                   IPKTTLSELLIPLAPFEEQELITQKVEKLFEKVNQLWK"
FT   gene            complement(481245..482795)
FT                   /locus_tag="SPP_0529"
FT   CDS_pept        complement(481245..482795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0529"
FT                   /product="type I restriction enzyme"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22107"
FT                   /protein_id="ACO22107.1"
FT                   /translation="MTPEQLKASILQRAMEGKLVPQNPNDEPASELLKRIKAEKEKLIS
FT                   EGKIKRDKKETEIFRGDDGKHYGKFADGSTQEIDVPYDIPDTWEWVRIKSIYWNFGQNK
FT                   PEKSFRYIDTSSIDRKKNIINYKNLQYLSPEQAPSRARKLVSQNSVLFSTVRPYLKNIA
FT                   VVRELKEYLIASTAFIVLDTLLNETYLKYYLLSDNFINRVNNKSTGTSYPAINDYNFNL
FT                   LLIALPPLSEQQRIVEAIESALEKVDEYAESYNRLEQLDKEFPDKLKKSILQYAMQGKL
FT                   VEQDPNDESVEVLLEKIRAEKQKLFEEGKIKKKDLDISIVSQGDDNSYYGNKDETTSYP
FT                   IYEIPEAWRYIKFASLVNFRIGKTPPRSEATFWGTEIPWVSISDMPISGYVTNTRESIS
FT                   KLALKSKKIDISPKGTLLMSFKLSIGKVAILDIPATHNEAIISIFPYANKENIIRDYLM
FT                   IFLPLISTLGDSKDAIKGKTLNSTSISELLIPISNHEEMKRIISKVDLLFQKVSQLFE"
FT   gene            complement(482795..484258)
FT                   /locus_tag="SPP_0531"
FT   CDS_pept        complement(482795..484258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0531"
FT                   /product="type I restriction enzyme"
FT                   /EC_number="2.1.1.72"
FT                   /note="identified by match to protein family HMM PF02384;
FT                   match to protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20846"
FT                   /protein_id="ACO20846.1"
FT                   /translation="MSITSFVKRIQDITRNDAGVNGDAQRIEQMSWLLFLKIYDSREMV
FT                   WELEEDEYESIIPEELKWRNWAHAQNGERVLTGDELLDFVNNKLFKELKELEITSNMPI
FT                   RKTIVKSAFEDANNYMKNGVLLRQVINVIDEVDFNSPEDRHSFNDIYEKILKDIQNAGN
FT                   SGEFYTPRAATDFIAEVLDPKLGESMADLACGTGGFLTSTLNRLSSQRKTSEDTKKYNT
FT                   AVFGIEKKAFPHLLAVTNLFLHEIDDPKIVHGNTLEKNVREYTDDEKFDIIMMNPPFGG
FT                   SELETIKNNFPAELRSSETADLFMAVIMYRLKENGRVGVILPDGFLFGEGVKTRLKQKL
FT                   VDEFNLHTIIRLPHSVFAPYTGIHTNILFFDKTKKTEETWFYRLDMPDGYKNFSKTKPM
FT                   KSEHFNPVRDWWENREEILEGKFYKSKSFTPSELAELNYNLDQCGFPKEEEEILNPFEL
FT                   IQNYQAERATLNHKIDNVLADILQLLEDK"
FT   gene            complement(484271..486604)
FT                   /pseudo
FT                   /locus_tag="SPP_0532"
FT                   /note="type I restriction-modification system, R subunit,
FT                   authentic point mutation; this gene contains a premature
FT                   stop which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF00270; match to
FT                   protein family HMM PF04851; match to protein family HMM
FT                   PF08463"
FT   gene            complement(486955..487083)
FT                   /locus_tag="SPP_0534"
FT   CDS_pept        complement(486955..487083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20227"
FT                   /protein_id="ACO20227.1"
FT                   /translation="MKIKNTSQLKELPPVTNFEKNGSRAKKRSKIGSIRIVKIRLA"
FT   gene            487212..487721
FT                   /locus_tag="SPP_0535"
FT   CDS_pept        487212..487721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21176"
FT                   /protein_id="ACO21176.1"
FT                   /translation="MNSRVEFRIFTIVDLDKKEEYLHEMHLKGWRYRTSRFGLFYFDQC
FT                   QPDDVIYRIYDSRFLKKYKHELQDFRDRGWELIGAGSCSILRKSSSDLLPEDQVYMSKG
FT                   LKWEVMRSRLRSCTATFLGGLVVCTSLFREDLSMSFFLIFVLYAFLISYLIHGYFRLKR
FT                   KYRVDE"
FT   gene            487885..488919
FT                   /gene="hrcA"
FT                   /locus_tag="SPP_0536"
FT   CDS_pept        487885..488919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SPP_0536"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="identified by match to protein family HMM PF01628;
FT                   match to protein family HMM PF08220; match to protein
FT                   family HMM TIGR00331"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21229"
FT                   /db_xref="GOA:C1CJ04"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJ04"
FT                   /protein_id="ACO21229.1"
FT                   /translation="MVTERQQDILNLIIDIFTKTHEPVGSKALQESINSSSATIRNDMA
FT                   ELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFHRLAENEVYEIVKAFDQEFFKLEDI
FT                   LQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLI
FT                   PRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVIDLFEHIFK
FT                   EMFNENIVMAGKVNLLNFANLAAYQFFDQPQKVALEIREGLREDQMQNVRIADGQESCL
FT                   ADLAVISSKFLIPYRGVGILAIIGPVNLDYQQLINQINVVNRVLTMKLTDFYRYLSSNH
FT                   YEVH"
FT   gene            488946..489470
FT                   /gene="grpE"
FT                   /locus_tag="SPP_0537"
FT   CDS_pept        488946..489470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SPP_0537"
FT                   /product="co-chaperone GrpE"
FT                   /note="identified by match to protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21885"
FT                   /db_xref="GOA:C1CJ05"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJ05"
FT                   /protein_id="ACO21885.1"
FT                   /translation="MAQDIKNEEVEEVQEEEVVETAEETTPEKSELDLANERADEFENK
FT                   YLRAHAEMQNIQRRANEERQNLQRYRSQDLAKAILPSLDNLERALAVEGLTDDVKKGLG
FT                   MVQESLIHALKEEGIEEIAADGEFDHNYHMAIQTLPADDEHPVDTIAQVFQKGYKLHDR
FT                   ILRPAMVVVYN"
FT   gene            489950..491773
FT                   /gene="dnaK"
FT                   /locus_tag="SPP_0538"
FT   CDS_pept        489950..491773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SPP_0538"
FT                   /product="chaperone protein DnaK"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21214"
FT                   /db_xref="GOA:C1CJ06"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJ06"
FT                   /protein_id="ACO21214.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPDTVISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEDY
FT                   LGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKTDKEEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLSTAGDNKLGGDDFDQKIIDHLVAEFKKENGIDL
FT                   STDKMAMQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAGPLHLEMTLTRAKFDDLTRD
FT                   LVERTKVPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEV
FT                   VAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKA
FT                   KDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRKEEVDLRNEVDQAIFATE
FT                   KTIKETEGKGFDAERDAAQAALDDLKKAQEDNNLDDMKAKLEALNEKAQGLAVKLYEQA
FT                   AAAQQAQEGAEGAQATGNAGDDVVDGEFTEK"
FT   gene            491786..492139
FT                   /locus_tag="SPP_0539"
FT   CDS_pept        491786..492139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21664"
FT                   /protein_id="ACO21664.1"
FT                   /translation="MSVNKNNLSDIADYHEKIKFFEELFNLDYNPTEMLVTVERNGNVI
FT                   YKEFTEVAVGKSKYDYTSVFKDVMIYFSDHICQELHLYKTQDPHYNKFEFDLAKRSLKI
FT                   TTRDNTTIFISNE"
FT   gene            492344..493480
FT                   /gene="dnaJ"
FT                   /locus_tag="SPP_0540"
FT   CDS_pept        492344..493480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SPP_0540"
FT                   /product="chaperone protein DnaJ"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21074"
FT                   /protein_id="ACO21074.1"
FT                   /translation="MNNTEFYDRLGVSKNASADEIKKAYRKLSKKYHPDINKEPGAEDK
FT                   YKEVQEAYETLSDDQKRAAYDQYGAAGANGGFGGAGGFGGFNGAGGFGGFEDIFSSFFG
FT                   GGGSSRNPNAPRQGDDLQYRVNLTFEEAIFGTEKEVKYHREAGCRTCNGSGAKPGTSPV
FT                   TCGRCHGAGVINVDTQTPLGMMRRQVTCDVCHGRGKEIKYPCTTCHGTGHEKQAHSVHV
FT                   KIPAGVETGQQIRLAGQGEAGFNGGPYGDLYVVVSVEASDKFEREGTTIFYNLNLNFVQ
FT                   AALGDTVDIPTVHGDVELVIPEGTQTGKKFRLRSKGAPSLRGGAVGDQYVTVNVVTPTG
FT                   LNDRQKVALKEFATAGDLKVNPKKKGFFDHIKDAFDGE"
FT   gene            complement(493802..494176)
FT                   /locus_tag="SPP_0541"
FT   CDS_pept        complement(493802..494176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0541"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20439"
FT                   /protein_id="ACO20439.1"
FT                   /translation="MHHNLGNSYSIKIKKQTRKLGTDCSKHRFKVVDRTDEVSSKHCFE
FT                   VVDTTDEVSSKHCFEVVDRTDEVSSKHCFEVVDTTDEVSSKHCFEVVDRTDEVSNHTHG
FT                   KPTLTWFEEIFEEYHSPFHN"
FT   gene            complement(494338..494625)
FT                   /locus_tag="SPP_0542"
FT   CDS_pept        complement(494338..494625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21926"
FT                   /protein_id="ACO21926.1"
FT                   /translation="MKLSNLLLFAGAAAGSYLVTKNRQTITDEVLNTTDRVQAIKDDVD
FT                   IIQNSLQIINQQKELIKEYQEDLTYKFKVLEKDIQTRLAVIKEMQGTEDK"
FT   gene            complement(494635..495045)
FT                   /locus_tag="SPP_0543"
FT   CDS_pept        complement(494635..495045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0543"
FT                   /product="histidine triad domain protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21372"
FT                   /protein_id="ACO21372.1"
FT                   /translation="MSDCIFCKIIAGEIPASKVYEDEQVLAFLDISQVTLGHTLVVPKE
FT                   HYRNLLEMDATSASQLFAQVPKVAQKVMKVTKAAGMNIISNCEEVAGQTVFHTHVHLVP
FT                   RYSADDDLKIDFIAHEPDFDKLAQVAETIKNA"
FT   gene            495113..495844
FT                   /locus_tag="SPP_0544"
FT   CDS_pept        495113..495844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0544"
FT                   /product="ABC-type transporter ATP-binding protein EcsA"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20796"
FT                   /protein_id="ACO20796.1"
FT                   /translation="MLEIKNLTGGYVHVPVLKDVSFTVESGQLVGLIGLNGAGKSTTIN
FT                   EIIGLLAPYSGSININGLTLQGDATSYRKQIGYIPETPSLYEELTLREHIETVAMAYGI
FT                   EQKVAFERVEPLLKMFRLEQKLDWFPVHFSKGMKQKVMIICAFVVDPSLFIVDEPFLGL
FT                   DPLAISDLIQLLEVEKQKGKSILMSTHVLDSAEKMCDAFVILHKGEVRAKGNLLQLREA
FT                   FDMPEASLNDIYLALTKEEDL"
FT   gene            495841..496890
FT                   /locus_tag="SPP_0545"
FT   CDS_pept        495841..496890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0545"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF05975"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20168"
FT                   /protein_id="ACO20168.1"
FT                   /translation="MKDLFLKRKQAFRKECLGYLRYVLNDHFVLFLLVLLGFLAYQYSQ
FT                   LLQHFPENHWPILLFVGITSVLLLLWGGIATYMEAPDKLFLLVGEEEIKLHLKRQTGIS
FT                   LVFWLFVQTLFLLLFAPLFLAMGYGLPVFLLYVLLLGVGKYFHFRQKASKFFTETGLDW
FT                   DYLISQESKRKQVLLRFFALFTQVKGISNSVKRRAYLDFILKAVQKVPGKIWQNLYLRS
FT                   YLRNGDLFALSLRLLLLSVLAQVFIEQAWIATAVVVLFNYLLLFQLLALYHAFDYQYLT
FT                   QLFPMDKGQKEKGLQEVVRGLTSFVLLVEVVVGLITFQEKLALLALLGAGLVLLVLYLP
FT                   YQVKRQMQD"
FT   gene            complement(497058..497387)
FT                   /locus_tag="SPP_0546"
FT   CDS_pept        complement(497058..497387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0546"
FT                   /product="BlpT protein, fusion"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21490"
FT                   /protein_id="ACO21490.1"
FT                   /translation="MTDTDPIKRAQTLITDLNKAYQACKQATADDVRFQEQLNSILGFL
FT                   AKAETVDNRFLIELEKFYQTSSLLMGLSALDPDAPTRAAWRAYDRFHFDQVKTKLILNE
FT                   NQRAN"
FT   gene            497664..498002
FT                   /locus_tag="SPP_0547"
FT   CDS_pept        497664..498002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0547"
FT                   /product="regulatory protein"
FT                   /note="identified by match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20351"
FT                   /protein_id="ACO20351.1"
FT                   /translation="MKHMIIQTQKTVYKVNVDDVYYIQTHPTKAHTVKIVTEEASFNMV
FT                   QNLSNLENQYGETLMRCHRNCLVNLDKVKSIDFQERILFLGEEGQYAVKYARRRYREIR
FT                   QKWLKEGE"
FT   gene            498007..498744
FT                   /locus_tag="SPP_0548"
FT   CDS_pept        498007..498744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0548"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21744"
FT                   /protein_id="ACO21744.1"
FT                   /translation="MRIFVLEDDFSQQTRIETTIEKLLKEHHITLSSFEVFGKPDQLLA
FT                   EVHEKGAHQLFFLDIEIRNEEMKGLEVARKIRDRDPYALIVFVTTHSEFMPLSFRYQVS
FT                   ALDYIDKALSAEEFESRIETALLYANGQDSKSLAEDCFYFKSKFAQFQYPFKEVYYLET
FT                   STRPHRVILYTKTDRLEFTASLEEVLKQEPRLLQCHRSFLINPANVVHLDKKEKLLFFP
FT                   NGGSCLIARYKVREVSEAINNLH"
FT   gene            498758..500098
FT                   /locus_tag="SPP_0549"
FT   CDS_pept        498758..500098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0549"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21285"
FT                   /protein_id="ACO21285.1"
FT                   /translation="MNVAWILLYTLVTHGLKIVIFFKVDGISLTFERIFKAFLFKILLA
FT                   VVFGMLGYMVGNVYLSYFMEPLYGIGLSFLLLRELPKKLLLFYGLFPMILVNLFYRGVS
FT                   YFVLPFLGQGQVYDDYSFIWLCIIIFNFFISLAFLKWLDYDFTSLRKGILDKDFQKSLT
FT                   QINWIMGAYYLVIQNLSYFEYEQGIQSTTVRHLILVFYLLFFMGIIKKLDTYLKDKLHE
FT                   RLNQEQDLRYREMERYSRHIEELYKEVRSFRHDYTNLLTSLRLGIEEEDMEQIKEIYDS
FT                   VLKDSSEKLQDNKYDLGRLVNVRDRALKSLLAGKFIKARDKNIVFNVEVPEEIQVEGVS
FT                   LLDFLTVVSILCDNAIEASVEACQPHVSIAFFKNGAQETFIIENSIKEEGIDISEIFSF
FT                   GASSKGEERGVGLYTVMKIVESHPNTSLNTTCQDHVFRQVLTVIHIE"
FT   gene            complement(500142..500297)
FT                   /locus_tag="SPP_0550"
FT   CDS_pept        complement(500142..500297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0550"
FT                   /product="double glycine cleavage site bacteriolysin
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF08128;
FT                   match to protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20802"
FT                   /protein_id="ACO20802.1"
FT                   /translation="MDKKQNLTSFQELTTTELNQIIGGGWWEDFLYRFNIIEQKNTKGF
FT                   YQPIQL"
FT   gene            complement(500354..501715)
FT                   /locus_tag="SPP_0551"
FT   CDS_pept        complement(500354..501715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0551"
FT                   /product="BlpC ABC transporter"
FT                   /note="identified by match to protein family HMM TIGR01000"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20342"
FT                   /protein_id="ACO20342.1"
FT                   /translation="MNPNLFRSVEFYQRRYHNYATVFIIPLSLLFTFILIFSLVATKEI
FT                   TVTSQGEIAPTSVIASIQSTSDNPILANHLVANQVVEKGDLLIKYSETMEESQKTALAT
FT                   QLQRLEKQKEGLGILKQSLEKATDLFSSEDEFGYHNTFMNFTKQSHDIELGISKTNTEV
FT                   SNQANLTNSSSSAIEQEITKVQQQIGEYQELRDAIINNRARLPTGNPHQSILNRYLIAS
FT                   QGQTQGTAEEPFLSQINQSIASLESSIASIKIQQAGIGSVATYDNSLATKIEVLRTQFL
FT                   QTASQQQLTVENQLTELKVQLDQATQRLENNTLTAPSKGIVHLNSEFEGKNRIPTGTEI
FT                   AQIFPVITDTREVLITYYVSSDYLPLLDKGQTVRLKLEKIGNHGTTIIGQLQSIDQTPT
FT                   RTEQGNLFKLTALAKLSNEDSKLIQYGLQGRVTSVTTKKTYFDYFKDKILTHSD"
FT   gene            complement(501726..503879)
FT                   /locus_tag="SPP_0552"
FT   CDS_pept        complement(501726..503879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0552"
FT                   /product="transport/processing ATP-binding protein ComA"
FT                   /EC_number="3.4.22.-"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412; match to protein family HMM TIGR01193"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21512"
FT                   /protein_id="ACO21512.1"
FT                   /translation="MTSYKRTFVPQIDARDCGVAALASIAKFYGSDFSLAHLRELAKTN
FT                   KEGTTALGIVKAADEMGFETRPVQADKTLFDMSDVPYPFIVHVNKEGKLQHYYVVYQTK
FT                   KDYLIIGDPDPSVKITKMSKERFFSEWTGVAIFLAPKPSYQPHKDKKNGLLSFLPLIFK
FT                   QKSLIAYIVLSSLLVTIINIGGSYYLQGILDEYIPNQMKSTLGIISVGLVITYILQQVM
FT                   SFSRDYLLTVLSQRLSIDVILSYIRHIFELPMSFFATRRTGEIISRFTDANSIIDALAS
FT                   TILSLFLDVSILILVGGVLLAQNPNLFLLSLLSIPIYMFIIFSFMKPFEKMNHDVMQSN
FT                   SMVSSAIIEDINGIETIKSLTSEENRYQNIDSEFVDYLEKSFKLSKYSILQTSLKQGTK
FT                   LVLNILILWFGAQLVMSSKISIGQLITFNTLFSYFTTPMENIINLQTKLQSAKVANNRL
FT                   NEVYLVESEFQVQENPVHSHFLMGDIEFDDLSYKYGFGRDTLTDINLTIKQGDKVSLVG
FT                   VSGSGKTTLAKMIVNFFEPYKGHISINYQDIKNIDKKVLRRHINYLPQQAYIFNGSILE
FT                   NLTLGGNHMISQEDILRACELAEIRQDIERMPMGYQTQLSDGAGLSGGQKQRIALARAL
FT                   LTKAPVLILDEATSGLDVLTEKKVIDNLISLTDKTILFVAHRLSIAERTNRVIVLNQGK
FT                   IIEVGSHQELMQAQGFYHHLFNK"
FT   gene            504161..504415
FT                   /locus_tag="SPP_0553"
FT   CDS_pept        504161..504415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0553"
FT                   /product="BlpM"
FT                   /note="identified by match to protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21148"
FT                   /protein_id="ACO21148.1"
FT                   /translation="MNTKMMEQFHEMDIAMLSSIEGGKNNWQTNVFEGGSAAFGGWGLG
FT                   TAICAASGVGAPFMGACGYIGAKFGVALWAGVTGATGGF"
FT   gene            504431..504634
FT                   /locus_tag="SPP_0554"
FT   CDS_pept        504431..504634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0554"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20553"
FT                   /protein_id="ACO20553.1"
FT                   /translation="MNTYCNINETMLSEVYGGNSGGAAVVAALGCAAGGVKYGKILGPW
FT                   GAAIGGIGGAVVCGYLAYTATS"
FT   gene            504878..505027
FT                   /locus_tag="SPP_0555"
FT   CDS_pept        504878..505027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0555"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21813"
FT                   /protein_id="ACO21813.1"
FT                   /translation="MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGC
FT                   ATTV"
FT   gene            505009..505128
FT                   /locus_tag="SPP_0556"
FT   CDS_pept        505009..505128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21202"
FT                   /protein_id="ACO21202.1"
FT                   /translation="MCNNGLTFLLGPFAIGIGVTGAAGGAILGGVAYAATCWW"
FT   gene            505131..505250
FT                   /locus_tag="SPP_0557"
FT   CDS_pept        505131..505250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21195"
FT                   /protein_id="ACO21195.1"
FT                   /translation="MDFKSFIIGLVVGIFGPYMDDLIRKIFSKSSKKDTDSTL"
FT   gene            505363..505479
FT                   /locus_tag="SPP_0558"
FT   CDS_pept        505363..505479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20705"
FT                   /protein_id="ACO20705.1"
FT                   /translation="MVSIQYKEESMFFMLAFLIFTIQEVLMTIYDLSDPRSK"
FT   gene            505547..505708
FT                   /locus_tag="SPP_0559"
FT   CDS_pept        505547..505708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0559"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21263"
FT                   /protein_id="ACO21263.1"
FT                   /translation="MKKKILIIFVLYLIMSIFLYPLRESIWYNLFYTIAYMIAVMIYFS
FT                   LIKKKEKK"
FT   gene            505718..506089
FT                   /pseudo
FT                   /locus_tag="SPP_0560"
FT                   /note="immunity protein BlpL, internal deletion; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts"
FT   gene            506267..506446
FT                   /locus_tag="SPP_0561"
FT   CDS_pept        506267..506446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21665"
FT                   /protein_id="ACO21665.1"
FT                   /translation="MDKKKIVSTIICIVFLVVSVDNFFRDLTPLLFILNIIGLSCFSVL
FT                   TYINIKEILLNISK"
FT   gene            506478..506618
FT                   /locus_tag="SPP_0562"
FT   CDS_pept        506478..506618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0562"
FT                   /product="immunity protein BlpL"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22177"
FT                   /protein_id="ACO22177.1"
FT                   /translation="MFIGLADFMFVICLYRGISETEFYQQLIAYIGVFSACLSRFCSCG
FT                   A"
FT   gene            506718..507101
FT                   /locus_tag="SPP_0563"
FT   CDS_pept        506718..507101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0563"
FT                   /product="immunity protein BlpX"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21034"
FT                   /protein_id="ACO21034.1"
FT                   /translation="MKYRLFFVIFLSSVLDILLGTFLQISIVSIGWLVLYSGLFEAGVF
FT                   LLANKGVAVKIKEVDIRNRFKFIFGKTLWFQILLLIFLIIKLYLGLDARLILFYGHIFI
FT                   VFNALMYLLSSSQVSLKKNKLSS"
FT   gene            507153..507842
FT                   /locus_tag="SPP_0564"
FT   CDS_pept        507153..507842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0564"
FT                   /product="BlpY protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21447"
FT                   /protein_id="ACO21447.1"
FT                   /translation="MKKYQLLFKISAVFSYLFFVFGLSQMTLIIQNYWQFSSQIGNFVW
FT                   IQNFLSLLFSGVMIWILVKTGHGYLFHIPRKKWLWYSILTVLVVVLQISFNVQTAKHVQ
FT                   STAEGWAVLIGYSGTNFAELGIYITLFFLTPLMEELIYRGLLQHAFFKHSRFGLDLLLP
FT                   SILFALPHFSSLPSLLDIFIFATSGIIFASLTRYTKSIYPSYAVHVINNIFATLPFLLT
FT                   FLHRVLG"
FT   gene            507884..508117
FT                   /pseudo
FT                   /locus_tag="SPP_0565"
FT                   /note="BlpZ; this region contains one or more premature
FT                   stops and/or frameshifts"
FT   gene            508268..508879
FT                   /locus_tag="SPP_0566"
FT   CDS_pept        508268..508879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0566"
FT                   /product="ABC transporter ATP binding protein-unknown
FT                   substrate"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20489"
FT                   /protein_id="ACO20489.1"
FT                   /translation="MEFFDKFHALCFGFLVLIIVITVPYTINHGVFFQNESALILVSLL
FT                   VTSLSVAYARKFEMISFGMLSKKQLLLFIAIFLLSVLETLVYIHFFAVSSGSGVQHLAE
FT                   VSRGISLSLILTTSVFGPIQEELIFRGLLQGAVFDNSWLGLVLTSSLFSFMHGPSNVPS
FT                   FIFYLLGGLLLGFAYKKSQNLWVSTLVHMFYNSWPLLYYL"
FT   gene            509040..509834
FT                   /locus_tag="SPP_0567"
FT   CDS_pept        509040..509834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0567"
FT                   /product="phosphotransferase enzyme family"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21307"
FT                   /protein_id="ACO21307.1"
FT                   /translation="MDLGDNELTLTPIPGKSGKAYMGSYPDGKRIFVKMNTSPILPGLA
FT                   REQIAPQLLWSRRLADGRDMCAQEWLTGKILTPYDMNRKQIVNILTRLHRSRPLMTQLS
FT                   RLGYAMETPVDLLQSWQETAPDALRKNHFISEVMADLRQTIPGFREDHATIVHGDVRHS
FT                   NWIETDSGLIYLVDWDSVRLTDRMFDVAHMLCHYISEHQWKEWLTYYGYKYNQTVLSKL
FT                   YWYGQLSYLSQISKYYMNQDLENVNREIHGLRHFRDKYGKRR"
FT   gene            509831..510466
FT                   /gene="trmB"
FT                   /locus_tag="SPP_0568"
FT   CDS_pept        509831..510466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="SPP_0568"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22033"
FT                   /db_xref="GOA:C1CJ34"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJ34"
FT                   /protein_id="ACO22033.1"
FT                   /translation="MRVRNRKGATELLEANPQYVVLNPLEAKAKWRDLFGNDNPIHVEV
FT                   GSGKGAFVSGMAKQNPDINYIGIDIQKSVLSYALDKVLEVGVPNIKLLWVDGSDLTDYF
FT                   EDGEIDRLYLNFSDPWPKKRHEKRRLTYKTFLDTFKRILPENGEIHFKTDNRGLFEYSL
FT                   VSFSQYGMKLNGVWLDLHASDFEGNVMTEYEQKFSNKGQVIYRVEAEF"
FT   gene            510592..511071
FT                   /locus_tag="SPP_0569"
FT   CDS_pept        510592..511071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21790"
FT                   /db_xref="GOA:C1CJ35"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJ35"
FT                   /protein_id="ACO21790.1"
FT                   /translation="MDAIATIVELVREVVEPVIEAPFELVDIEYGKIGSDMILSIFVDK
FT                   PEGITLNDTADLTEMISPVLDTIKPDPFPEQYFLEITSPGLERPLKTKDAVAGAVGKYI
FT                   HVGLYQAIDKQKVFEGTLLAFEEDELTMEYMDKTRKKTVQIPYSLVSKARLAVKL"
FT   gene            511115..512251
FT                   /gene="nusA"
FT                   /locus_tag="SPP_0570"
FT   CDS_pept        511115..512251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="SPP_0570"
FT                   /product="transcription termination factor NusA"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF08529; match to protein
FT                   family HMM TIGR01953"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21329"
FT                   /protein_id="ACO21329.1"
FT                   /translation="MSKEMLEAFRILEEDKGIKKEDIIDAVVESLRSAYRRRYGQSDSV
FT                   AIDFNEKTGDFTVYTVREVVDEVFDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGR
FT                   VAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSK
FT                   QDQIPGEVFASHDRIEVYVYKVEDNPRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEI
FT                   MSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIE
FT                   ENIDVIEWVADPAEFIYNAIAPAEVDQVIFDENDSKRALVVVPDNKLSLAIGRRGQNVR
FT                   LAAHLTGYRIDIKSASEFEAMEDAASVELEVENDTVEE"
FT   gene            512273..512566
FT                   /locus_tag="SPP_0571"
FT   CDS_pept        512273..512566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0571"
FT                   /product="putative chain a, hypothetical cytosolic protein
FT                   coded by gene from nusainfb, ylxr homologue"
FT                   /note="identified by match to protein family HMM PF04296"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20832"
FT                   /protein_id="ACO20832.1"
FT                   /translation="MKTRKIPLRKSVVSNEVIDKRDLLRIVKNKEGQVFIDPTGKANGR
FT                   GAYIKLDNAEALEAKKKKVFNRSFSMEVEESFYDELIAYVDHKVKRRELGLE"
FT   gene            512559..512858
FT                   /locus_tag="SPP_0572"
FT   CDS_pept        512559..512858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0572"
FT                   /product="ribosomal protein HS6-type"
FT                   /note="identified by match to protein family HMM PF01248"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20371"
FT                   /protein_id="ACO20371.1"
FT                   /translation="MNKQKISNLLGLAQRAGRIISGEELVVKAIQDGKAKLVFLAHDAG
FT                   PNLTKKIQDKSHYYQVEIVTVFSTLELSIAVGKSRKVLAVTDAGFTKKMRSLME"
FT   gene            512875..515667
FT                   /locus_tag="SPP_0573"
FT   CDS_pept        512875..515667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0573"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF03144; match to protein family HMM PF04760;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20362"
FT                   /db_xref="GOA:C1CJ39"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJ39"
FT                   /protein_id="ACO20362.1"
FT                   /translation="MSKKRLYEIAKELGKESKEVVARAKELGLDVKSHSSSVEEAVAAK
FT                   IAASFKPAAAPKVEAKPAAPKVSAEKKAEKSEPAKPAVAKEEAKPAEPVAPKTEKVAAK
FT                   PQSRNFKAEREARAKEQAERRKQNKGNNRDQQQNGNRQKNDGRNGGKQGQSNRDNRRFN
FT                   DQAKKQQGQQKRRNERRQQEDKRSNQVAPRIDFKARAAALKAEQNAEYARSSEERFKQY
FT                   QAAKEALAQANKRKEPEEIFEEAAKLAEQAQQVQAVVEVVPEKKEPAVDTRRKKQARPD
FT                   KNRDDYDHEEDGPRKQQKNRSSQNQVRNQKNSNWNNNKKNKKGNNKNNRNQTPKPVTER
FT                   KFHELPTEFEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVD
FT                   YGIEAKQKVEVDNADIERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSR
FT                   VATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDG
FT                   VMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEI
FT                   SAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLN
FT                   VQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSAR
FT                   AAGEERAKRALMKQRQATQRVSLENLFDTLKAGELKSVNVIIKADVQGSVEALSASLQK
FT                   IDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHS
FT                   IIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKV
FT                   RVIRDGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDCYNDIKMDDVIEAYVMEEIKR
FT                   "
FT   gene            515918..516268
FT                   /gene="rbfA"
FT                   /locus_tag="SPP_0574"
FT   CDS_pept        515918..516268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="SPP_0574"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by match to protein family HMM PF02033;
FT                   match to protein family HMM TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21478"
FT                   /db_xref="GOA:C1CJ40"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJ40"
FT                   /protein_id="ACO21478.1"
FT                   /translation="MANHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDL
FT                   SVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGN
FT                   KIDEMLRNLDKN"
FT   gene            516547..517326
FT                   /locus_tag="SPP_0575"
FT   CDS_pept        516547..517326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0575"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21067"
FT                   /protein_id="ACO21067.1"
FT                   /translation="MAEQDLAMQVLQQVVKLPVVKVDRSKFLVDKFSKELGPQDIPTLL
FT                   EQGPTSLLSQEILDRVANACIRDNVLLASGTSVLAGLPGGLAMAITIPADVAQFYGFSL
FT                   KLAQELGYIYGYEDLWASRDELSEDAQNTLLLYLGVMLGVNGTAALLRAGGITIAKQVM
FT                   KTVPNKALTKTLWYPILKKVLRIFGVNLTKGGLAKGMGKFIPILGGIISGGLTFATMKP
FT                   MGESLQKELSKLVNYSEVQYQEDVETIRKEAEIIKGE"
FT   gene            517328..517510
FT                   /locus_tag="SPP_0576"
FT   CDS_pept        517328..517510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20532"
FT                   /protein_id="ACO20532.1"
FT                   /translation="MNPIKAFAKIYGNYFLTVQGVKVMKTIKKDDNAVVGLGKLFIADK
FT                   LMDTARWLIKPEDKK"
FT   gene            complement(517777..517929)
FT                   /locus_tag="SPP_0577"
FT   CDS_pept        complement(517777..517929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0577"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20653"
FT                   /protein_id="ACO20653.1"
FT                   /translation="MKIKEQTRKLAAGCSKQCFEIVDRTDEVSSKHRFEVADRTDEVSN
FT                   IYTAR"
FT   gene            517960..518193
FT                   /locus_tag="SPP_0578"
FT   CDS_pept        517960..518193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08984"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21010"
FT                   /protein_id="ACO21010.1"
FT                   /translation="MDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPLMRNTVGRK
FT                   VSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD"
FT   gene            518193..519527
FT                   /locus_tag="SPP_0579"
FT   CDS_pept        518193..519527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0579"
FT                   /product="hemerythrin HHE cation binding domain subfamily,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01814;
FT                   match to protein family HMM PF04282"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21332"
FT                   /protein_id="ACO21332.1"
FT                   /translation="MADERIHVLRDILLELHNGASPESVQERFDATFAGVSAIEISLME
FT                   HELMNSDSGVTFEDVMELCDVHANLFKNAIKGVEVSDTEHPGHPVRVFKEENLALRAAL
FT                   IRIRRLLDTYESMEDEEMLAEMRKGLVRQMGLVGQFDIHYQRKEELFFPIMERYGHDSP
FT                   PKVMWGVDDQIRELFQTALTTAKSLPEVSISSVKEAFEAFATEFESMIFKEESILLMIL
FT                   LESFTQDDWLQIAEESDAYGYAIIRPSEKWVPERQIFIEEKIAEEPVQLDTAEGQVQQV
FT                   IDTPEGHFTITFTPKEKEAVLDRHSQQAFGNGYLSVEQANLILNHLPMEITFVNKEDIF
FT                   QYYNDNTPADEMIFKRTPSQVGRNVELCHPPKYLDKVKAIMKGLREGTKDKYEMWFKSE
FT                   SRGKFVHITYAAVHDEDGEFQGVLEYVQDIQPYREIDTDYFRGLE"
FT   gene            519537..519791
FT                   /locus_tag="SPP_0580"
FT   CDS_pept        519537..519791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08930"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21518"
FT                   /protein_id="ACO21518.1"
FT                   /translation="MSYEQEFMKEFEAWVNTQIMINDMAHKESQKVYEEDQDERAKDAM
FT                   IRYESRLDAYQFLLGKFENFKVGKGFHDLPEGLFGERNY"
FT   gene            519887..520282
FT                   /locus_tag="SPP_0581"
FT   CDS_pept        519887..520282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22100"
FT                   /protein_id="ACO22100.1"
FT                   /translation="MSKKLNRKKQLRNGLRRAGAFSSTVTKVVDETKKVVKRAEQTASA
FT                   AGKAVSKKVEQAVEATKEQAQKVANSVEDFAANLGGLPLDRAKTFYDEGIKSASHFKNW
FT                   TEKELLDLKGIGPATIKKLKENGIKFK"
FT   gene            520695..521144
FT                   /locus_tag="SPP_0582"
FT   CDS_pept        520695..521144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0582"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20590"
FT                   /protein_id="ACO20590.1"
FT                   /translation="MIGVVARENAAEQIKQYQKFTVNISDETSMLAMEQAGFISHQEKL
FT                   ERLGVHYEISERTQTPILDACPLVLDCRVDRIVEEDGICHIFAKILERLVAPELLDEKG
FT                   HFKNQLFAPTYFMGDGYQRVYRYLDKRVDMKGSFIKKARKKDGKN"
FT   gene            521131..521691
FT                   /locus_tag="SPP_0583"
FT   CDS_pept        521131..521691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0583"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21651"
FT                   /protein_id="ACO21651.1"
FT                   /translation="MARTELPDKIETERLVLRVRTVADAEDIFDYASLPEVAYPAGFPP
FT                   VKTLEDEIYYLEHILPERNQKENLPAGYGIVVKGTDKIVGSIYFNHRHEDDVMEIGYTL
FT                   HSDYWGRGYVPEAARALIDLAFKDLGLHKIELTCFGYNLQSQRVAEKLGFTLEARIRDR
FT                   KDAQGNCCDDLRYALLKSEWGVI"
FT   gene            521691..522269
FT                   /locus_tag="SPP_0584"
FT   CDS_pept        521691..522269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0584"
FT                   /product="shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22203"
FT                   /protein_id="ACO22203.1"
FT                   /translation="MHLFIIGAPASGKMTIGQELSRLTDATLFYNHQAIDFALEIYQDY
FT                   TEEMWEFVRGITFSFLGASARNQRSVILTDVIDFSNQYHLIYLKQIQNLLDDYHQEILF
FT                   VELETSLEECIRRNRTENRLKHKPLKRHIEVSEREILETAETLQLNSQYQPNELHHYFK
FT                   INNTNLSAEEAAKQIQNKINKIEKGHTHV"
FT   gene            522262..524913
FT                   /gene="valS"
FT                   /locus_tag="SPP_0585"
FT   CDS_pept        522262..524913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="SPP_0585"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20234"
FT                   /protein_id="ACO20234.1"
FT                   /translation="MSKELSSKYNPAEVEAGRYQKWLDADVFKPSGDQKAKPYSIVIPP
FT                   PNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGIS
FT                   RYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDL
FT                   YKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPE
FT                   TMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDP
FT                   NDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRV
FT                   HSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMEN
FT                   VHDWVISRQLWWGHQIPAWYNADGEMYVGEEAPEGDGWTQDEDVLDTWFSSALWPFSTM
FT                   GWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEE
FT                   GRKMSKSLGNGIDPMDVIDKYGTDSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWN
FT                   ISRYILMNNEGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGV
FT                   AGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHPIMPFVT
FT                   EEIFGQISEGSIVTAAYPTVNLAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPIT
FT                   ILVKTSDSDLEAFFNSNVNYIKRFTNPEHLEIASTIPAPELAMSSVITGAEIYLPLADL
FT                   LNVEEELARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQADYQAKYDAT
FT                   VARIDEMKKLVK"
FT   gene            524983..525738
FT                   /locus_tag="SPP_0586"
FT   CDS_pept        524983..525738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20824"
FT                   /protein_id="ACO20824.1"
FT                   /translation="MSKHPHYELLNLIGYGLAKFAKLFIKEFQYSSKSEFYRYVVSLGI
FT                   AETTGVVKNRMDLFDPYFDNSRKGWWQKAEVYRFRKDLIDMMFGNEDVHSYVEIVKMLL
FT                   ASEGKQTGITIIEKPIIRTKFKRLQETGMEAENYFILHFDKEEKFQGGQLTDACLYGDG
FT                   YDFQVDIQEHSYLAEVKGIRKPKGRVRLTAYEFEKAKEFQSDFILSLVTNLDDIPKLVL
FT                   VDNPLKHFEFKKNIIKNEIIEYRSVEDLY"
FT   gene            526013..526816
FT                   /locus_tag="SPP_0587"
FT   CDS_pept        526013..526816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0587"
FT                   /product="Fic protein family"
FT                   /note="identified by match to protein family HMM PF02661"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20833"
FT                   /protein_id="ACO20833.1"
FT                   /translation="MQSTYNIDNPNLSYEAKRDLWRIGFGLQKVDNLVPSAYMESLAEK
FT                   QSRGELTYEQVYEDATAYHHTIDASTEEADLVSLRIVELLSRRGFSFSPATLLAIHKEL
FT                   FQDIFEPSIPVGQFRQTNITKNEPVLNGESVVYSDYSMIQMTLDYDFNQEKQVAYATLT
FT                   QADVVKQIQHFISGIWQIHPFREGNTRTVTVFLIQYLREFGFDIDNIPFQQHSKYFRDA
FT                   LVLDNAKILQRRPEFLTAFFENLLLGGQNDLSSEKMYLDLDLDFS"
FT   gene            complement(526932..527273)
FT                   /pseudo
FT                   /locus_tag="SPP_0588"
FT                   /note="transposase OrfB; this region contains one or more
FT                   premature stops and/or frameshifts; identified by match to
FT                   protein family HMM PF00665"
FT   gene            complement(527482..528261)
FT                   /locus_tag="SPP_0589"
FT   CDS_pept        complement(527482..528261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0589"
FT                   /product="transposase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20683"
FT                   /protein_id="ACO20683.1"
FT                   /translation="MNYTPKVRQKKSNFWGVFIMKLSYDDKVQIYELRKQGYSLEKLSN
FT                   KFGINNSNIRYMIKLIDRYGIEFVKKGKNRYYSPDLKQEMINKVLHEGWTKDRVSLEYG
FT                   LPSRTILLNWLAQYRKNGYTIVEKTRGRVPESGECHPKKVKRTPIEGGKRERRKTEIVQ
FT                   ELMTEFSLDLLLKAIKLARWTYYYHLKQLDKPDKDQELKAEIQSIFIEHKGNYAYRCIH
FT                   LELRNRAYLVNHKRVQGLMKVLNLQAKTRQKRKYSSH"
FT   gene            528451..531130
FT                   /pseudo
FT                   /locus_tag="SPP_0590"
FT                   /note="DNA or RNA helicase of superfamily II, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            531431..532270
FT                   /locus_tag="SPP_0592"
FT   CDS_pept        531431..532270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0592"
FT                   /product="transcription antiterminator LicT"
FT                   /note="identified by match to protein family HMM PF00874;
FT                   match to protein family HMM PF03123"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21706"
FT                   /protein_id="ACO21706.1"
FT                   /translation="MIIKRILNHNAVIAQSKKDIDILLFGRGIAFGRKTGDKVNPIDIE
FT                   KSFFLKNRDNMTRFTEMFINVPLELVYITEKIINLGKITLGNNFDEIIYINLTDHISSS
FT                   IERYKEGVIISNPLRWEISKYYKEEFELGKRALQIIKKELGIELPIDEAAFIALHFVNA
FT                   NLENNFQESYKITEIIMGIEKIIQDFYCTEFNQDSIDYYRFITHIKLFAHRLVENTTYC
FT                   DDDDEDLLALMKNKYPREYECGEQVAMFIQTEYNYLLTSSELVYLMAHIRRLTKNLD"
FT   gene            532288..534126
FT                   /locus_tag="SPP_0593"
FT   CDS_pept        532288..534126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0593"
FT                   /product="pts system beta-glucoside-specific eiibca
FT                   component (eiibca-bgl) (eii-bgl)"
FT                   /EC_number="2.7.1.69"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM PF00367; match to protein
FT                   family HMM PF02378; match to protein family HMM TIGR00830;
FT                   match to protein family HMM TIGR01995"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20660"
FT                   /protein_id="ACO20660.1"
FT                   /translation="MSYKDKVQKILDVIGGEKNVNRVTHCVTRLRLELKDENLVNDDDV
FT                   KKIPGVIGIMKKNGQYQIILGNDVANYYKEFVKLGNFESDSVVQGHKGNILERIIEYIA
FT                   GSMTPIIPAMLGGGMLKVLVIILPMLGILQSDSQTIAFLTFFGDAPYYFLPLLLAYSAS
FT                   QKLKVTSTLAMSVAGVLLHPNFVQMVQSGNPLSLFGVPVIPASYGSSVVPILIMVWLMK
FT                   YIEKMIAKLTPAVTKSFLQPTLVLLVSSCIALVVVGPIGVIVGEGLSNLVGQMYDVAGW
FT                   LTLAILGAIMPFIVMTGMHWAFAPIFLAASIATPDVLILPAMLGSNLAQGAASMAVALK
FT                   SKNNNTKQIAFAAGFSALLAGITEPALYGVTLKYKKPLYAAMIGGGLAGLFAGLTSVKA
FT                   YLFAVPSLIALPQFIYSDVPSNIVNALIVAVISVVITFVLAYIFGIDEEESSSNLEVKA
FT                   GVSNKKMIFSPISGEIIPLSDVQDKTFSDKLIGDGVAIIPSEGKVYAPFDGKITNIFPT
FT                   KHAIGLKSDEGVELLIHIGLDTVELKGQGFISHVEEGDRVFKNQLIFEMDLNLIKTKGY
FT                   ETVTPVIVTNTNDFLDVLVLPNNQTIEHSKELLVIL"
FT   gene            534139..535554
FT                   /locus_tag="SPP_0594"
FT   CDS_pept        534139..535554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0594"
FT                   /product="beta-glucosidase (Gentiobiase) (Cellobiase)
FT                   (Beta-D-glucoside glucohydrolase) (Amygdalase)"
FT                   /EC_number="3.2.1.21"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22019"
FT                   /protein_id="ACO22019.1"
FT                   /translation="MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEAT
FT                   ENPTEDNLKLIGIDFYHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKY
FT                   YDELFDELHAHGIEPLVTLSHYETPLYLARKYHGWIDRRMIHFYEKFARTVLERYKDKV
FT                   KYWLTFNEVNSVLELPFTSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEF
FT                   KVGCMVLAMPAYPMTPNPKDVWATHEYENLNYLFSDVHVRGYYPNYAKRYFKENDINIE
FT                   FAAEDAELLKNYTVDFLSFSYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQI
FT                   DPIGLRIILNRYYDRYQIPLFIVENGLGAKDQLIKDEFNNLTVQDDYRIQYMKEHLLQV
FT                   AEALQDGVEIMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGNGTFNRYKKMSFTWY
FT                   KGVIESNGESLFK"
FT   gene            536104..537192
FT                   /gene="pheS"
FT                   /locus_tag="SPP_0595"
FT   CDS_pept        536104..537192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="SPP_0595"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01409;
FT                   match to protein family HMM PF02912; match to protein
FT                   family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21874"
FT                   /protein_id="ACO21874.1"
FT                   /translation="MWFSFYLRETDGGNMSTIEEQLKALREETLTSLKQITAGNEKEMQ
FT                   DLRVSVLGKKGSLTEILKGMKDVSAEMRPIIGKHVNEARDVLTAAFEETAKLLEEKKVA
FT                   AQLASESIDVTLPGRPVATGHRHVLTQTSEEIEDIFIGMGYQVVDGFEVEQDYYNFERM
FT                   NLPKDHPARDMQDTFYITEEILLRTHTSPVQARAMDAHDFSKGPLKMISPGRVFRRDTD
FT                   DATHSHQFHQIEGLVVGKNISMADLQGTLQLIVQKMFGEERQIRLRPSYFPFTEPSVEV
FT                   DVSCFKCGGEGCNVCKKTGWIEIMGAGMVHPRVLEMSGIDATVYSGFAFGLGQERVAML
FT                   RYGINDIRGFYQGDVRFSEQFK"
FT   gene            537192..537701
FT                   /locus_tag="SPP_0596"
FT   CDS_pept        537192..537701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0596"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21405"
FT                   /protein_id="ACO21405.1"
FT                   /translation="MIRKVEMADVEVLAKIAKQAFRETFAYDNTEEQLQEYFEEAYSLK
FT                   TLSTELGNPDSETYFIMHEEEIAGFLKVNWGSAQTERELEDAFEIQRLYVLQKFQGFGL
FT                   GKQLFEFALELATKNSFSWAWLGVWEHNTKAQAFYNRYGFEKFSQHHFMVGQKVDTDWL
FT                   LRKKLR"
FT   gene            537778..540180
FT                   /gene="pheT"
FT                   /locus_tag="SPP_0597"
FT   CDS_pept        537778..540180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="SPP_0597"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM PF03147; match to protein
FT                   family HMM PF03483; match to protein family HMM PF03484;
FT                   match to protein family HMM TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21105"
FT                   /protein_id="ACO21105.1"
FT                   /translation="MLISYKWLKELVDIDVPSQELAEKMSTTGIEVEGVESPAAGLSKI
FT                   VVGEVLSCEDVPETHLHVCQVNVGEEERQIVCGAPNVRAGIKVMVALPGARIADNYKIK
FT                   KGKIRGLESLGMICSLGELGISDSVVPKEFADGIQILPEDAVPGEEVFSYLDLDDEIIE
FT                   LSITPNRADALSMCGVAHEVAAIYDKAVNFKEFTLTETNEAAADALSVSIETDKAPYYA
FT                   ARILDNVTIAPSPQWLQNLLMNEGIRPINNVVDVTNYILLYFGQPMHAFDLDNFEGTDI
FT                   RVREARAGEKLVTLDGEERDLDVNDLVITVADKPVALAGVMGGQATEISEKSSRVVLEA
FT                   AVFNGKSIRKTSGRLNLRSESSSRFEKGINVATVNEALDAAASLIAELAGATVRKGIVS
FT                   AGELDTSDVEVSSTLADVNRVLGTELSYADVEDVFRRLGFGLSGNADSFTVRVPRRRWD
FT                   ITIEADLFEEIARIYGYDRLPTSLPKDDGTAGELTATQKLRRQVRTIAEGAGLTEIITY
FT                   TLTTPEKAVEFTAQPSNLTELMWPMTVDRSVLRQNMISGILDTVAYNVARKNKNLALYE
FT                   IGKVFEQTGNPKEELPNEINSFAFALTGLVAEKDFQTAAVPVDFFYAKGILEALFTRLG
FT                   LQVTYTATSEIASLHPGRTAVISLGDQVLGFLGQVHPVTAKAYDIPETYVAELNLSAIE
FT                   AALQPATPFVEITKFPAVSRDVALLLKAEVTHQEVVDAIQAAGVKRLTDIKLFDVFSGE
FT                   KLGLGMKSMAYSLTFQNPEDSLTDEEVARYMEKIQASLEEKVNAEVR"
FT   gene            complement(540248..541249)
FT                   /locus_tag="SPP_0598"
FT   CDS_pept        complement(540248..541249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0598"
FT                   /product="endonuclease/exonuclease/phosphatase family"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20301"
FT                   /protein_id="ACO20301.1"
FT                   /translation="MIKTFLSALSVILFVIPIITYSFFPSSNLNIWLSTQPILAQIYAF
FT                   PLATATMAAILSFLFFFLSFYKKNKQIRFYSGILLLLSLILLLFGTDKTLSSASNKTKT
FT                   LKLVTWNVANQIEAQHIERIFSHFDADMAIFPELATNIRGEQENQRIKLLFHQVGLSMA
FT                   NYDIFTSPPTNSGIAPVTVIVKKSYGFYTEAKTFHTTRFGTIVLHSRKQNIPDIIALHT
FT                   APPLPGLMEIWKQDLNIIHNQLASKYPKAIIAGDFNATMRHGALAKISSHRDALNVLPP
FT                   FERGTWNSQSPKLFNATIDHILLPKNHYYVKDLDIVSFQNSDHRCIFTEITF"
FT   gene            541405..541707
FT                   /pseudo
FT                   /locus_tag="SPP_0599"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            541727..541855
FT                   /pseudo
FT                   /locus_tag="SPP_0600"
FT                   /note="conserved domain protein; this region contains one
FT                   or more premature stops and/or frameshifts"
FT   gene            541978..542244
FT                   /locus_tag="SPP_0601"
FT   CDS_pept        541978..542244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0601"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21908"
FT                   /protein_id="ACO21908.1"
FT                   /translation="MEGCPSELFSKEEILESDMRVAIMSELIEARNKQGISQKKLEELS
FT                   GVSQPVIARMETGKTSPQLDTVLKVLASLGKILAVVRLEQGKS"
FT   gene            542504..544753
FT                   /gene="metE"
FT                   /locus_tag="SPP_0602"
FT   CDS_pept        542504..544753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="SPP_0602"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="identified by match to protein family HMM PF01717;
FT                   match to protein family HMM PF08267; match to protein
FT                   family HMM TIGR01371"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21448"
FT                   /protein_id="ACO21448.1"
FT                   /translation="MSTTIIGFPRLGEFRELKFTTEKYFRKEISEEELLAAAKDLRAKH
FT                   WNIVKEKGITEIPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLERYFALGRGYQGEK
FT                   GDVRALPMKKWFNTNYHYIVPKFEKDTQVKLAGHKIFDEFQEAKELGLNTRPVLVGPFT
FT                   FLQLSDFEEGVKADDFVDSLVAAYQEVFAKLAELGATRIQLDEAALVKDLTAEEKALFL
FT                   NLYNKLLADKKGLEVLLQTYFGDVRDVYADLVNLPVDAIGLDFVEGKKTLELVKGGFPA
FT                   DKTLYVGIVNGKNIWRNNYEKSLAVLEQIPAENIVLTSSCSLLHVPFTTANEEFEPALL
FT                   NHFAFAVEKLDEIRDLDAIRNGQGSEALAANKELFATERVGENAELRARIAGLTDADYT
FT                   RLPAFAEREAIQEEAFKLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKEYDAFLAET
FT                   IDEWIKWQEDIDFDVLVHGEFERNDMVEYFGQNLSGYFFSKNGWVQSYGMRGVKPPIIW
FT                   GDVTRLNPITVKWSSYAQSRTNKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIK
FT                   DEVLDLEAAGVKIIQIDEAALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVASDTQIHT
FT                   HMCYSEFTDIIPAIDNMDADVISFEASRSNLEILDELKAKNFQTEVGPGVYDIHSPRVP
FT                   NEGEIDNTIEAILAKVPSKKVWINPDCGLKTRGIPETKESLIRLVEAAKAAREKL"
FT   gene            544817..545683
FT                   /gene="metF"
FT                   /locus_tag="SPP_0603"
FT   CDS_pept        544817..545683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="SPP_0603"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="identified by match to protein family HMM PF02219;
FT                   match to protein family HMM TIGR00676"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20960"
FT                   /protein_id="ACO20960.1"
FT                   /translation="MSRQTPSLSFEVFPPNPAVGNGNIISALQDMQELAPHFISVTASN
FT                   NKFNIKETTVRLADFIQNDLAIPTIAHLPAIYLTKDKVAETIVDLDKVGVQKILALRGD
FT                   IIPDVEPQKDFRYATDLIEFIKEQAPHFDIIGACYPEEHPDSPNQISDIQNLKKKVDAG
FT                   CSSLVTQLFFDNERFYDFQDKCILAGIDVPIHAGIMPILNRNQALRLLKTCENIHLPRK
FT                   FKAILDKYEHDPESLRAAGLAYAVDQIVDLVTQDVAGVHLYTMNNADTAKYIHQATHAL
FT                   FNHQSLG"
FT   gene            546242..548455
FT                   /pseudo
FT                   /locus_tag="SPP_0604"
FT                   /note="polyribonucleotide nucleotidyltransferase, authentic
FT                   point mutation; this gene contains a premature stop which
FT                   is not the result of sequencing error; identified by match
FT                   to protein family HMM PF01138; match to protein family HMM
FT                   PF03725"
FT   gene            548471..549088
FT                   /gene="cysE"
FT                   /locus_tag="SPP_0606"
FT   CDS_pept        548471..549088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SPP_0606"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21678"
FT                   /protein_id="ACO21678.1"
FT                   /translation="MGWWRETIDIVKENDPAARTTLEVLLTYPGVKALAAHRLSHFLWK
FT                   HGFKLLARMYSQFWRFWTQIEIHPGAQIDSGVFIDHGSGLVIGETAIVEKGVLLYHGVT
FT                   LGGTGKDCGKRHPTVRKGALISAHAQVIGPVEIGENAKVGAAAVVVADVPSDVTVVGIP
FT                   AKIVRLHGKKDEPVIHEVEEKREYYVNKLEQAKDASHRSSGL"
FT   gene            549100..549984
FT                   /locus_tag="SPP_0607"
FT   CDS_pept        549100..549984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0607"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21610"
FT                   /protein_id="ACO21610.1"
FT                   /translation="MIQARNKLSQEELSEAKKVINCCQNYDGTYRDPYLSNMLNFDPNM
FT                   PAFFLYYEKGELVGLLTVYADDQDVEVTILVHPGHRRQGIARALFTSFEREIASFPIRS
FT                   VTFQTERIFLENHPDFASNWGLIEDEETETWLGKDRRPYPLANVSHLEVLLADSSYQDQ
FT                   ISQLKFQAFSEEHESREVVDRYVAEALKDPESRLYILLKDGQVIGTCTVDLSTNTNYFY
FT                   GLAILEPERGKGYGSYLAKSLVNQLIEQNDKEFQIAVEDSNVGAKRLYEKIGFVKQTQV
FT                   VYLNEKGARDSEV"
FT   gene            550066..551409
FT                   /gene="cysS"
FT                   /locus_tag="SPP_0608"
FT   CDS_pept        550066..551409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SPP_0608"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM PF09190; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21215"
FT                   /protein_id="ACO21215.1"
FT                   /translation="MIKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTV
FT                   AFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALG
FT                   VKPATRHPRVVEFMADIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLE
FT                   LGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDT
FT                   IDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHD
FT                   ALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLKYLKNTYEQPFTGNVDAQELQN
FT                   FKDKFVAAMDEDFNAANGITVVFEMAKWINSGNYDASVKQALADMLEIFGIVFVEEVLD
FT                   AEIEDLIQKRQEARANRDFETADQIRDQLVTQGIKLLDTKDGVRWTRD"
FT   gene            551402..551788
FT                   /locus_tag="SPP_0609"
FT   CDS_pept        551402..551788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0609"
FT                   /product="ribonuclease III family protein"
FT                   /note="identified by match to protein family HMM PF00636"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21112"
FT                   /protein_id="ACO21112.1"
FT                   /translation="MIDVNLINGIALAFEGDAVYSMYIRRHLILKGMTKPNKLHQEATK
FT                   YVSAKAQARLIALMLEEQVLTEKEEEIYKRGRNTNSHTKAKNADVVTYRMSTGFEAVMG
FT                   YLHMTENLERLESLVSWCIQKVEG"
FT   gene            551792..552676
FT                   /locus_tag="SPP_0610"
FT   CDS_pept        551792..552676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0610"
FT                   /product="leucine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20985"
FT                   /protein_id="ACO20985.1"
FT                   /translation="MREKELQDWFPEARISDQPVEKEGYLTLPLASQQWILLEEAGLSE
FT                   REKQLVALLTQQEQARSLNPWYSYLVEGKGQAPQVFKKIQLVYCHLSYFQQENLASWLD
FT                   MMRTLFPNCQTVLQVGSQDYVFVLQQDKYTYVRDILSDTIEAVEYDFGLRLSIMLGQVW
FT                   SQTGHQALSDLIKAERDLFKTWWRQGHQGVHTFSQLYLWSMGERLVDLKPIKECLHQMI
FT                   LDQDQIQEIILSLWENSAVLTKTAQQLYLHRNSLQYKIDKWEELTGLQLKELTDLTLCY
FT                   QLILGSLSTIVGL"
FT   gene            552724..552840
FT                   /locus_tag="SPP_0611"
FT   CDS_pept        552724..552840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0611"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20909"
FT                   /protein_id="ACO20909.1"
FT                   /translation="MQSYSGLMLGKYTVTAKTFLEVALISLIYLCEFYVILL"
FT   gene            553047..553412
FT                   /locus_tag="SPP_0612"
FT   CDS_pept        553047..553412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0612"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20499"
FT                   /protein_id="ACO20499.1"
FT                   /translation="MNNVDNQPATEVPSSGITVKLNAKDNAGNWTSASNKKEVTVKIVS
FT                   AKPTYPDKILVKNPDNIKDTEKNAIIEKLKEANKNHPAGAPTFAKGEGEHANDIVATYS
FT                   DGTTYYVPLNDVTKYAR"
FT   gene            553558..553731
FT                   /locus_tag="SPP_0613"
FT   CDS_pept        553558..553731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0613"
FT                   /product="GBSi1, group II intron, maturase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22162"
FT                   /protein_id="ACO22162.1"
FT                   /translation="MKSIVTNIDERLRTRLRVIIWKQWKKKSRRLWGLLKLGVPKWIAD
FT                   KVSGWGEHYQLY"
FT   gene            553944..554009
FT                   /locus_tag="SPP_2306"
FT   ncRNA           553944..554009
FT                   /locus_tag="SPP_2306"
FT                   /product="group II catalytic intron"
FT                   /ncRNA_class="autocatalytically_spliced_intron"
FT   gene            554081..555358
FT                   /locus_tag="SPP_0614"
FT   CDS_pept        554081..555358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0614"
FT                   /product="ABC transporter membrane-spanning permease-Pep
FT                   export"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20746"
FT                   /protein_id="ACO20746.1"
FT                   /translation="MNPIQRSWAYVSRKRLRSFILFLILLVLLAGISACLTLMKSNKTV
FT                   ESNLYKSLNTSFSIKKIENGQTFKLSDLASVSKIKGLENVSPELETVAKLKDKEAVTGE
FT                   QSVERDDLSAADNNLVSLTALEDSSKDVTFTSSAFNLKEGRHLQKGDSKKILIHEELAK
FT                   KNGLSLHDKIGLDAGQSESGKGQTVEFEIIGIFSGKKQEKFTGLSSDFSENQVFTDYES
FT                   SQTLLGNSEAQVSAARFYVENPKEMDGLMKQVENLALENQGYQVEKENKAFEQIKDSVA
FT                   TFQTFLTIFLYGMLIAGAGALILVLSLWLRERVYEVGILLALGKGKSSIFLQFCLEVVL
FT                   VSLGALLPAFVAGNGITTYLLQTLLASGDQVSLQDTLAKASSLSTSILSFAESYVFLVL
FT                   LSCLSVALCFLFLFRKSPKEILSSIS"
FT   gene            555371..556018
FT                   /locus_tag="SPP_0615"
FT   CDS_pept        555371..556018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0615"
FT                   /product="ABC transporter, ATP-binding protein Vexp2"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20259"
FT                   /protein_id="ACO20259.1"
FT                   /translation="MTLLQLQDVTYRYKNTAEAVLYQINYNFEPGKFYSIIGESGAGKS
FT                   TLLSLLAGLDSPVEGSILFQGEDIRKKGYSYHRMHHISLVFQNYNLIDYLSPLENIQLV
FT                   NKKASKNTLLELGLDESQIKRNVLQLSGGQQQRVAIARSLVSEAPVILADEPTGNLDPK
FT                   TAGDIVELLKSLAQKTGKCVIVVTHSKEVAQASDITLELKDKKLTETRNTSK"
FT   gene            556070..557449
FT                   /locus_tag="SPP_0616"
FT   CDS_pept        556070..557449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0616"
FT                   /product="ABC transporter membrane-spanning permease-Pep
FT                   export"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22137"
FT                   /protein_id="ACO22137.1"
FT                   /translation="MLHNAFAYVTRKFFKSIVIFLIILLMASLSLVGLSIKGATAKASQ
FT                   ETFKNITNSFSMQINRRVNQGTPRGAGNIKGEDIKKITENKAIESYVKRINAIGDLTGY
FT                   DLIETPETKKNLTADRAKRFGSSLMITGVNDSSKEDKFVSGSYKLVEGEHLTNDDKDKI
FT                   LLHKDLAAKHGWKVGDKVKLDSNIYDADNEKGAKETVEVTIKGLFDGHNKSAVTYSQEL
FT                   YENTAITDIHTAAKLYGYTEDTAIYGDATFFVTADKNLDDVMKELNGISGINWKSYTLV
FT                   KSSSNYPALEQSISGMYKMANLLFWGSLSFSVLLLALLLSLWINARRKEVGILLSIGLK
FT                   QASILGQFITESILIAIPALVSAYFLANYTAHAIGNTVLANVTSGVAKQASKAAQASNL
FT                   GGGAEVDGFSKTLSSLDISIQTSDFIIIFVLALVLVVLVMALASSNLLRKQPKELLLDG
FT                   E"
FT   gene            557762..558418
FT                   /locus_tag="SPP_0617"
FT   CDS_pept        557762..558418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0617"
FT                   /product="VncR, response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21692"
FT                   /protein_id="ACO21692.1"
FT                   /translation="MKILIVEDEEMIREGVSDYLTDCGYETIEAADGQEALEQFSSYEV
FT                   ALVLLDIQMPKLNGLEVLAEIRKTSQVPVLMLTAFQDEEYKMSAFASLADGYLEKPFSL
FT                   SLLKVRVDAIFKRYYDTGRIFSYKDTKVDFESYSASLAGQEVPINAKELEILDYLVKNE
FT                   GRALTRSQIIDAVWKATDEVPFDRVIDVYIKELRKKLDLDCILTVRNVGYKLERK"
FT   gene            558415..559743
FT                   /locus_tag="SPP_0618"
FT   CDS_pept        558415..559743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0618"
FT                   /product="VncS, histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20829"
FT                   /protein_id="ACO20829.1"
FT                   /translation="MKRTGLFTKIFIYTFSIFSVLVICLHLAIYFLFPSTYLSHRQETI
FT                   GQKATAIAQSLEGKDRQSIEQVLDLYSQTSDIKGTVKGEMTEDKLEVKDSLPLDTDRQT
FT                   TSLFIEEREVKTQDGGTMILQFLASMDLQKEAEQISLQFLPYTLLASFLISLLVAYIYA
FT                   RTIVAPILEIKRVTRRMMDLDSQVRLRVDSKDEIGNLKEQINSLYQHLLTVIADLHEKN
FT                   EAILQLEKMKVEFLRGASHELKTPLASLKILIENMRENIGRYKNRDQYLGVALGIVDEL
FT                   NHHVLQILSLSSVQELRDDRETIDLLQMTQNLVKDYALLAKERELQIDNSLTHQQAYLN
FT                   PSVMKLILSNLISNAIKHSVPGGLVRIGEREGELFIENSCSSEEQEKLAQSFSDNASRK
FT                   VKGSGMGLFVVKSLLEHEKLAYRFEMEENRLTFFIDFPKVVQD"
FT   gene            559884..560765
FT                   /gene="fba"
FT                   /locus_tag="SPP_0619"
FT   CDS_pept        559884..560765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="SPP_0619"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01859"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20235"
FT                   /protein_id="ACO20235.1"
FT                   /translation="MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPV
FT                   LIQTSMGAAKYMGGYKVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLKLAKEVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMV
FT                   ETGIDFLAAGIGNIHGPYPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAI
FT                   KLGVAKVNVNTECQIAFANATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVE
FT                   ERIDVFGSEGKA"
FT   gene            complement(561086..562275)
FT                   /pseudo
FT                   /locus_tag="SPP_0620"
FT                   /note="oxidoreductase, putative, authentic frameshift; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            complement(562524..563183)
FT                   /locus_tag="SPP_0622"
FT   CDS_pept        complement(562524..563183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0622"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20813"
FT                   /protein_id="ACO20813.1"
FT                   /translation="MESILEILTPDNLVFIFKGFGLTLYISLIAIILSTIIGTVLAVMR
FT                   NGKNPILRIISSIYIEFVRNVPNLLWIFTIFLVFKMKSTPAGITAFTLFTSAALAEIIR
FT                   GGLNAVDKGQYEAGMSQGFTSAQILYYIILPQAIRKMLPAIISQFVTVIKDTSLLYSVI
FT                   ALQELFGASQILMGRYFEPEQVFSLYILIALIYFSFNLAISSLSHMLAKRWQQAAE"
FT   gene            complement(563193..563870)
FT                   /locus_tag="SPP_0623"
FT   CDS_pept        complement(563193..563870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0623"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20398"
FT                   /protein_id="ACO20398.1"
FT                   /translation="MTDLSSWTAYFQDFGQFFNGFLFTLALAIGSFILAMVLGIFFGAM
FT                   STSKRPILRILARIFVEFYQNTPLLVQFVIVFYGLPLISDHIIMIPIYWTAVLCVGLYH
FT                   GAYIAEVIRSGIQSIPSGQMEAALSQGFTYISAMRLIILPQAFRIILPPLTNQIVNLIK
FT                   NTSTVAIISGVDLMFVTKSWSALNGNYIPAFLGAALLYFALCFPVAQFGRKMEQANKKA
FT                   YSL"
FT   gene            complement(563883..564677)
FT                   /locus_tag="SPP_0624"
FT   CDS_pept        complement(563883..564677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0624"
FT                   /product="ABC transporter substrate-binding
FT                   protein-glutamine transport/Major cell binding factor"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20498"
FT                   /protein_id="ACO20498.1"
FT                   /translation="MKKKFFLSALLISLFGLAAAKPVQADTSIADIQKRGELVVGVKQD
FT                   VPNFGYKDPKTGTYSGIETDLAKMVADELKVKIRYVPVTAQTRGPLLDNEQVDMDIATF
FT                   TITDERKKLYNFTSPYYTDASGFLVNKSAKIKKIEDLNGKTIGVAQGSITQRLITELGK
FT                   KKGLKFKFVELGSYPELITSLHAHRIDAFSVDHSILSGYTSKRTALLDDSFKPSDYSIV
FT                   TKKSNTELNDYLDNLVTKWSKDGSLQKLYDRYKLKPSSHTAD"
FT   gene            complement(564688..565446)
FT                   /locus_tag="SPP_0625"
FT   CDS_pept        complement(564688..565446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0625"
FT                   /product="glutamine transport ATP-binding protein GlnQ"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22135"
FT                   /protein_id="ACO22135.1"
FT                   /translation="MALVEFKNVEKYYGDYHALRNINLRFEKGQVVVLLGPSGSGKSTL
FT                   IRTINGLEAVDKGSLLVNGHQVAGASQKDLVPLRKEVGMVFQHFNLYPHKTVLENVTLA
FT                   PIKVLGIDKKEAEKTAQKYLEFVNMWDKKDSYPAILSGGQKQRIAIARGLAMHPELLLF
FT                   DEPTSALDPETIGDVLAVMQKLAHDGMNMIIVTHEMGFAREVADRIIFMADGEVLLDTT
FT                   DVDNFFDNPSKPRAQQFLSKIINHESDKVK"
FT   gene            565711..567945
FT                   /gene="recJ"
FT                   /locus_tag="SPP_0626"
FT   CDS_pept        565711..567945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="SPP_0626"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF01368;
FT                   match to protein family HMM PF02272; match to protein
FT                   family HMM TIGR00644"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21760"
FT                   /protein_id="ACO21760.1"
FT                   /translation="MDVFLITPTYEWQFALQVEDADFTKIAKKAGLGPEVARLLFERGI
FT                   QDQESLKKFLEPSLEDLHDAYLLHDMDKAVERIRQAIEEGENILVYGDYDADGMTSASI
FT                   VKESLEQLGAECRVYLPNRFTDGYGPNASVYKYFIEQEGISLIVTVDNGVAGHEAIALA
FT                   QSMGVDVIVTDHHSMPETLPDAYAIVHPEHPDADYPFKYLAGCGVAFKLACALLEEVQV
FT                   ELLDLVAIGTIADMVSLTDENRILVQYGLEMLGHTQRIGLQEMLDMAGIAANEVTEETV
FT                   GFQIAPRLNALGRLDDPNPAIDLLTGFDDEEAHEIALMIHQKNEERKEIVQSIYEEAKT
FT                   MVDPEKKVQVLAKEGWNPGVLGIVAGRLLEELGQTVIVLNIEDGRAKGSARSVEAVDIF
FT                   EALDPHRDLFIAFGGHAGAAGMTLEVEQLSDLSQVLEDYVREKGADAGGKNKLNLDEEL
FT                   DLEALSLETVKSFERLAPFGMDNQKPIFYIKNFQVESARTMGAGNAHLKLKISKGEASF
FT                   EVVAFGQGRWATEFSQTKNLELAVKLSVNQWNGQTALQLMMVDARVEGVQLFNIRGKNA
FT                   VLPEGVPVLDFPGELPNLAASEAIVVKNIPEDITQLKTIFQEQHFSAVYFKNDIDKAYY
FT                   LTGYGTRDQFAKLYKTIYQFPEFDIRYKLKDLAAYLNIQQILLVKMIQVFEELGFVTIK
FT                   DGVMTVNKEAPKREIGESQIYQNLKQTVKDQEMMALGTVQEIYDFLMEKE"
FT   gene            568120..569781
FT                   /locus_tag="SPP_0627"
FT   CDS_pept        568120..569781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0627"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21328"
FT                   /protein_id="ACO21328.1"
FT                   /translation="MSNISLTTLGGVRENGKNMYIAEIGESIFVLNVGLKYPENEQLGV
FT                   DVVIPNMDYLFENSDRIAGVFLTHGHADAIGALPYLLAEAKVPVFGSELTIELAKLFVK
FT                   GNDAVKKFNDFHVIDENTEIDFGGTVVSFFPTTYSVPESLGIVLKTSEGSIVYTGDFKF
FT                   DQTASESYATDFARLAEIGRDGVLALLSDSANADSNIQVASESEVRDEITQTIADWEGR
FT                   IIVAAVSSNLSRIQQIFDAADKTGRRIVLTGFDIENIVRTAIRLKKLSLANEILLIKPK
FT                   DMSRFEDHELIILETGRMGEPINGLRKMSIGRHRYVEIKDGDLVYIATAPSIAKEAFVA
FT                   RVENMIYQAGGVVKLITQSLHVSGHGNVRDLQLMINLLQPKYLFPVQGEYRELDAHAKA
FT                   AMAVGMLPEHIFIPKKGTTMAYENGDFVPAGSVSAGDILIDGNAIGDVGNVVLRDRKVL
FT                   SEDGIFIVAITVNRREKKIVARARVHTRGFVYLKKSRDILHESSELINQTVEEYLQGDD
FT                   FDWADLKGKVRDNLTKYLFDQTKRRPAILPVVMEAK"
FT   gene            569850..570629
FT                   /locus_tag="SPP_0628"
FT   CDS_pept        569850..570629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0628"
FT                   /product="tributyrin esterase"
FT                   /note="identified by match to protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21133"
FT                   /protein_id="ACO21133.1"
FT                   /translation="MAVMKIEYYSQVLDMEWGVNVLYPDANRVEEPECEDIPVLYLLHG
FT                   MSGNHNSWLKRTNVERLLRGTNLIVVMPNTSNGWYTDTQYGFDYYTALAEELPQVLKRF
FT                   FPNMTSKREKTFIAGLSMGGYGCFKLALATNRFSHAASFSGALSFQNFSPESQNLGSPA
FT                   YWRGVFGEIKDWTTSPYSLESLAKKSDKKTKLWAWCGEQDFLYEANNLAVKNLKKLGFD
FT                   VTYSHSAGTHEWYYWEKQLEVFLTTLPIDFKLEERLT"
FT   gene            570741..571961
FT                   /locus_tag="SPP_0629"
FT   CDS_pept        570741..571961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0629"
FT                   /product="serine/alanine-adding enzyme MurM"
FT                   /note="identified by match to protein family HMM PF02388"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21606"
FT                   /protein_id="ACO21606.1"
FT                   /translation="MYRYQIGIPTLEYDQFVKEHELANVLQSSAWEEVKSNWQHEKFGV
FT                   YREEKLLATASILIRTLPLGYKMFYIPRGPILDYGDKELLNFVIQSIKSYARSKRAVFV
FT                   TFDPSICLSQSLINQEKTEFPENLAIIDSLQQMGVRWSGKTEEMGDTIQPRIQAKIYKE
FT                   NFEEDKLSKSTKQAIRTARNKGLEIQYGGLELLDSFSELMKKTEKRKEIHLRNEAYYKK
FT                   LLDNFKDKAYITLATLDVSKRSQELEEQLAKNRALEETFTESTRISKVEAQKKEKERLL
FT                   EELTFLQEYIDVGQARVPLAATLSLEFGTTSVNIYAGMDDDFKRYNAPILTWYETARYA
FT                   FERGMVWQNLGGVENSLNGGLYHFKEKFNPTIEEYLGEFTMPTHPLYPLLRLALDFRKT
FT                   LRKKHRK"
FT   gene            571966..573198
FT                   /locus_tag="SPP_0630"
FT   CDS_pept        571966..573198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0630"
FT                   /product="alanine adding enzyme"
FT                   /note="identified by match to protein family HMM PF02388"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20671"
FT                   /protein_id="ACO20671.1"
FT                   /translation="MALTTLTKEEFQTYSDQVSSRSFMQSVQMGDLLEKRGARIVYLAL
FT                   KQEGEIQVAALVYSLPMLGGLHMELNSGPIYTQQDALPVFYAELKEYAKQNGVLELLVK
FT                   PYETYQTFDSQGNPIDAEKKSIIQGLTDLGYQFDGLTTGYPGGEPDWLYYKDLTELTEK
FT                   SLLKSFSKKGKPLVKKAETFGIRLKKLKREELSIFKNITKETSERREYSDKSLEYYEHF
FT                   YDTFGEQAEFLIASLNFSDYMSKLQGEQSKLEENLDKLRLDLSKNPHSEKKQNQLREYS
FT                   SQFETFEVRKAEARDLIEKYGEEDIVLAGSLFVYMPQETTYLFSGSYTEFNKFYAPALL
FT                   QKYVMLESIKRGIPKYNFLGIQGIFDGSDGVLRFKQNFNGYIVRKAGTFRYHPSPLKYK
FT                   AIQLLKKIVGR"
FT   gene            573277..573978
FT                   /locus_tag="SPP_0631"
FT   CDS_pept        573277..573978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0631"
FT                   /product="matrixin family"
FT                   /note="identified by match to protein family HMM PF00413"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21012"
FT                   /protein_id="ACO21012.1"
FT                   /translation="MRWLFRLIGAFFSFVWRLFWRLVWIVVLLCVLAFGLLWYLNGDFQ
FT                   GALKQAERSVKIGQQSIDQWEKTGQLPKLSQTDSHQHSEGRWAQASARIYLDPQMDSRF
FT                   QEAYLEAIQNWNQTGAFNFELVTESSKADITATEMNDGGTPVAGEAESQTNLLTGQFLS
FT                   VTVRLNHYYLSNPYYGYSYERLVHTAEHELGHAIGLDHTDEKSVMQPAGSFYGIQEEDV
FT                   ANLRKIYETSE"
FT   gene            574018..575862
FT                   /gene="uvrC"
FT                   /locus_tag="SPP_0632"
FT   CDS_pept        574018..575862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="SPP_0632"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="identified by match to protein family HMM PF01541;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF08459; match to protein family HMM TIGR00194"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21480"
FT                   /db_xref="GOA:C1CJ89"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJ89"
FT                   /protein_id="ACO21480.1"
FT                   /translation="MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF
FT                   RGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKI
FT                   TNERYPRLIITRQVKKDGGLYFGPYPDVGAANEIKRLLDRIFPFRKCTNPPSKVCFYYH
FT                   IGQCMAHTICKKDEAYFKSMAQEVSDFLKGQDDKIIDDLKSKMAVAAQSMEFERAAEYR
FT                   DLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFN
FT                   DPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDSKILKPQRGEKKQLVNLA
FT                   IKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMV
FT                   VFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQ
FT                   VNIAKQVIQEELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDE
FT                   VHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMRHFKSLTKIKEASVDEIVEVGV
FT                   PRVVAEAVQRKLNPQGEALPQVAEERVDYQTEGNHNEP"
FT   gene            575852..576649
FT                   /locus_tag="SPP_0633"
FT   CDS_pept        575852..576649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0633"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21920"
FT                   /protein_id="ACO21920.1"
FT                   /translation="MNHKIAILSDVHGNATALEAVIADAKNQGASEYWLLGDIFLPGPG
FT                   ANDLVALLKDLPITASVRGNWDDRVLEALDGQYGLEDPQEVQLLRMTQYLMERMDPATI
FT                   VWLRSLPLLEKKEIDGLRFSISHNLPDKNYGGDLLDAETDVAVYGHVHKQLLRYGSQGQ
FT                   QIINPGSIGMPYFNWEALKNHRAQYAVIEVEDGELLNIQFRKVAYDYEAELELAKSKGL
FT                   PFIEMYEELRRDDNYQGHNLELLASLIEKHGYVEDVKNFFDFL"
FT   gene            complement(576831..577631)
FT                   /locus_tag="SPP_0634"
FT   CDS_pept        complement(576831..577631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0634"
FT                   /product="ABC transporter substrate-binding
FT                   protein-glutamine transport/Major cell binding factor"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21762"
FT                   /protein_id="ACO21762.1"
FT                   /translation="MKKFSLLLAILPFLVACGNQATPKETSAQKTIVLATAGDVPPFDY
FT                   EDKGNLTGFDIEVLKAVDEKLSDYEIQFQRTAWESIFPGLDSGHYQAAANNLSYTKERA
FT                   EKYLYSLPISNNPLVLVSNKKNPLTSLDQIAGKTTQEDTGTSNAQFINNWNQKHTDNPA
FT                   TINFSGEDIGKRILDLANGEFDFLVFDKVSVQKIIKDRGLDLSVVDLPSADSPSNYIIF
FT                   SSDQKEFKEQFDKALKELYQDGTLEKLSNTYLGGSYLPDQSQLQ"
FT   gene            577675..577815
FT                   /locus_tag="SPP_0635"
FT   CDS_pept        577675..577815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20265"
FT                   /protein_id="ACO20265.1"
FT                   /translation="MFLINQYISFMSVIEKLNHEKSLQALSNYGRMEAVELEKEIDYEI
FT                   S"
FT   gene            577802..578407
FT                   /locus_tag="SPP_0636"
FT   CDS_pept        577802..578407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0636"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20544"
FT                   /protein_id="ACO20544.1"
FT                   /translation="MKFLELNKKRHATKHFTDKPVDPKDVRTAIEIATLAPSAHNSQPW
FT                   KFVVVREKNAELAKLAYGSNFEQVSSAPVTIALFTDTDLAKRARKIARVGGANNFSEEQ
FT                   LQYFMKNLPAEFARYNEQQVSDYLALNAGLVAMNLVLALTDQGIGSNIILGFDKSKVNE
FT                   VLEIEDRFRPELLITVGYTDDKLEPSYRLPVDEIIEKR"
FT   gene            578420..579820
FT                   /gene="pepV"
FT                   /locus_tag="SPP_0637"
FT   CDS_pept        578420..579820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepV"
FT                   /locus_tag="SPP_0637"
FT                   /product="dipeptidase PepV"
FT                   /EC_number="3.4.13.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM TIGR01886; match to protein
FT                   family HMM TIGR01887"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21193"
FT                   /protein_id="ACO21193.1"
FT                   /translation="MTAIDFTAEVEKRKEDLLADLFSLLEINSERDDSKADAQHPFGPG
FT                   PVKALEKFLEIADRDGYPTKNVDNYAGHFEFGDGEEVLGIFAHMDVVPAGSGWDTDPYT
FT                   PTIKDGRLYARGASDDKGPTTACYYGLKIIKELGLPTSKKVRFIVGTDEESGWADMDYY
FT                   FEHVGLAKPDFGFSPDAEFPIINGEKGNITEYLHFAGENTGAARLHSFTGGLRENMVPE
FT                   SATAVVSGDLADLQAKLDAFVAEHKLRGELQEEAGKYKVTIIGKSAHGAMPASGVNGAT
FT                   YLALFLSQFGFAGPAKDYLDIAGKILLNDHEGENLKIAHVDEKMGALSMNAGVFRFDET
FT                   SADNTIALNIRYPKGTSPEQIKSILENLPVVSVSLSEHGHTPHYVPMEDPLVQTLLNIY
FT                   EKQTGLKGHEQVIGGGTFGRLLERGVAYGAMFPDSIDTMHQANEFIALDDLFRAAAIYA
FT                   EAIYELIK"
FT   gene            579874..580452
FT                   /locus_tag="SPP_0638"
FT   CDS_pept        579874..580452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0638"
FT                   /product="uracil DNA glycosylase family protein"
FT                   /note="identified by match to protein family HMM PF03167"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22127"
FT                   /protein_id="ACO22127.1"
FT                   /translation="MSQIERIKQAIMADSQNASYTERGIEPLFAAPKTARINIIGQAPG
FT                   LKTQEAGLYWKDKSGDRLRDWLGVDEDTFYNSGYFAVLPMDFYFPGHGKSGDLPPRTGF
FT                   AEKWHPQLLQELPDIQLTLLIGQYAQAYYLQEKISGKVTERVKHYKDYLPAYFPLVHPS
FT                   PRNQIWMAKNPWFEAEVVPDLKKRIKTIL"
FT   gene            580612..580764
FT                   /locus_tag="SPP_0639"
FT   CDS_pept        580612..580764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0639"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20488"
FT                   /protein_id="ACO20488.1"
FT                   /translation="MKEIAFDAFYQLYQNDQLSLVDVREVDEFAALHLECAHNLPLSQL
FT                   ADSYD"
FT   gene            580780..580899
FT                   /locus_tag="SPP_0640"
FT   CDS_pept        580780..580899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0640"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21783"
FT                   /protein_id="ACO21783.1"
FT                   /translation="MHYIICKSGMRSARACQFLLEQGYNVINVQGGMLAFEEL"
FT   gene            581070..582395
FT                   /gene="brnQ"
FT                   /locus_tag="SPP_0641"
FT   CDS_pept        581070..582395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="SPP_0641"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20404"
FT                   /protein_id="ACO20404.1"
FT                   /translation="MAKKGTLTGLLLFGIFFGAGNLIFPPSLGALSGEHFLPAIAGFVF
FT                   SGVGIAVLTLIIGTLNPKGYIYEISTKIAPWFATLYLSVLYLSIGPFFATPRTATTAYE
FT                   VGISPLLSDANKGLGLIVFTVLYFAAAYLISLNPSKILDRIGRILTPVFAILIVILVVL
FT                   GAIKYGGTSPQAASAAYQASAFGTGFLEGYNTLDALASVAFSVIAVQTLKQLGFSSKKE
FT                   YISTIWVIGIVVALAFSALYIGLGFLGNHFPVPAEAMKGGTPGVYILSQATQEIFGSTA
FT                   QLFLAAMVTVTCFTTTVGLIVSTAEFFNERFPQISYKVYATAFTLIGFAIANLGLDAII
FT                   KYSIPVLVILYPITIAIVMIVIVNKFVALSKPGMQLTIAVVTVIAIASVLGSSFKVEFL
FT                   ANLVSVLPFAKASLPWLVPAIVGILLSLVLPNKQESDVFEME"
FT   gene            582493..583530
FT                   /locus_tag="SPP_0642"
FT   CDS_pept        582493..583530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0642"
FT                   /product="peptidase, M42"
FT                   /note="identified by match to protein family HMM PF05343"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20890"
FT                   /protein_id="ACO20890.1"
FT                   /translation="MNQTVEYIKELTAIASPTGLTREISNYLVKTLEGFGYQPVRTAKG
FT                   GVNVTIKGQNDEQHRYVTAHVDTLGAIVRAVKPDGRLKLDRIGGFPWNMIEGENCTVHV
FT                   ASTGQKVSGTILIHQTSCHVYKDAGTAERTQDNMEVRLDVKVSNEKETRALGIEVGDFI
FT                   SFDPRTVVTDTGFIKSRHLDDKVSAAILLNLLRIYKKEKIELPVTTHFAFSVFEEVGHG
FT                   ANSNIPAQVVEYLAVDMGAMGDDQQTDEYTVSICVKDASGPYHYDFRQHLVALAKEQDI
FT                   PFKLDIYPFYGSDASAAMSAGAEVKHALLGAGIESSHSYERTHIDSVVATERMVDAYLR
FT                   SNLVD"
FT   gene            583532..583972
FT                   /locus_tag="SPP_0643"
FT   CDS_pept        583532..583972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0643"
FT                   /product="HIT family protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21216"
FT                   /protein_id="ACO21216.1"
FT                   /translation="MCLICQRIELIKKGENPYFVKELETGYLVIGDHQYFAGYSLFLAK
FT                   EHVTELHHLKKETRLRFLEEMSVVQEAVAKAFAAEKMNIELLGNGDAHLHWHLFPRRTG
FT                   DMNGHGLNGRGPVWWVPFEEMTAETRQAKPDEIRLPAKQNMV"
FT   gene            583980..584378
FT                   /locus_tag="SPP_0644"
FT   CDS_pept        583980..584378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0644"
FT                   /product="mobile genetic element"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20517"
FT                   /protein_id="ACO20517.1"
FT                   /translation="MNDEASKQLTDARFKRLVGVQRTTFEEMLAVLKTAYQLKHAKGGR
FT                   KPKLSLEDLLMATLQYVREYRTYEEIAADFGIHESNLLRRSQWVEVTLVQSGFTISRTP
FT                   LSSEDTVMIDATEVKINRPKKRISELFW"
FT   gene            584395..584784
FT                   /locus_tag="SPP_0645"
FT   CDS_pept        584395..584784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0645"
FT                   /product="transposase (IS4 family)"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20861"
FT                   /protein_id="ACO20861.1"
FT                   /translation="MKAQAIVTSQGRIVSLDITVNYCHDMKLFKMSRRNIGQAGKILAD
FT                   SDYQGLMKIYPQAQIPRKSSKLKPLIAEDKAYNHALSKDRSKVENILAKVKTFKMFSTT
FT                   YRNHRKRFGLRMNLIAGIINHELGF"
FT   gene            584865..585581
FT                   /locus_tag="SPP_0646"
FT   CDS_pept        584865..585581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0646"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="identified by match to protein family HMM PF02557"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21462"
FT                   /protein_id="ACO21462.1"
FT                   /translation="MKKRYLVVTALLALSLAACSQEKAKNEDGTAKTEQTAKADGTVGS
FT                   KSQGAAQKKAEVVNKGDYYSIQGKYDEIIVANKHYPLSKDYNPGENPTAKAELVKLIKA
FT                   MQEAGFPISDHYSGFRSYETQTKLYQDYVNQDGKAAADRYSARPGYSEHQTGLAFDVIG
FT                   TDGDLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKEAKEIAASG
FT                   LSLEEYYGFEGGDYVD"
FT   gene            complement(585621..585758)
FT                   /locus_tag="SPP_0647"
FT   CDS_pept        complement(585621..585758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0647"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22158"
FT                   /protein_id="ACO22158.1"
FT                   /translation="MKIKEQTRKLAVGCSKYSFEIADKTDEVSSKHCFEVVNRTDAVSR
FT                   "
FT   gene            585890..586315
FT                   /gene="rplK"
FT                   /locus_tag="SPP_0648"
FT   CDS_pept        585890..586315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="SPP_0648"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21152"
FT                   /db_xref="GOA:C1CJA5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJA5"
FT                   /protein_id="ACO21152.1"
FT                   /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQAGMIIPVVISVYEDKSFTFVTKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTRAQ
FT                   VQEIAETKMPDLNAANVESAMRMIEGTARSMGFTVVD"
FT   gene            586523..587212
FT                   /gene="rplA"
FT                   /locus_tag="SPP_0649"
FT   CDS_pept        586523..587212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="SPP_0649"
FT                   /product="ribosomal protein L1"
FT                   /note="identified by match to protein family HMM PF00687;
FT                   match to protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21735"
FT                   /db_xref="GOA:C1CJA6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJA6"
FT                   /protein_id="ACO21735.1"
FT                   /translation="MAKKSKQLRAALEKIDSTKAYSVEEAVALAKETNFAKFDATVEVA
FT                   YNLNIDVKKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NDGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADRAGNVQAIIGKVSFEAEKLVENFKAFNETIQKAKPATAKGTYVTNLTITTTQGVGI
FT                   KVDVNSL"
FT   gene            587748..587813
FT                   /locus_tag="SPP_2307"
FT   ncRNA           587748..587813
FT                   /locus_tag="SPP_2307"
FT                   /product="group II catalytic intron"
FT                   /ncRNA_class="autocatalytically_spliced_intron"
FT   gene            complement(587858..588049)
FT                   /locus_tag="SPP_0650"
FT   CDS_pept        complement(587858..588049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0650"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20333"
FT                   /protein_id="ACO20333.1"
FT                   /translation="MKTKEQTRKLASGCSKHCFEVVDGTDVVSSKHCFEVVDRTDEVSN
FT                   HTHGKATLTWFEEIFEEY"
FT   gene            589469..590461
FT                   /locus_tag="SPP_0651"
FT   CDS_pept        589469..590461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0651"
FT                   /product="ABC transporter ATP-binding protein-role in
FT                   polysaccharide efflux"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21863"
FT                   /protein_id="ACO21863.1"
FT                   /translation="MAMIEVEHLQKNFVKTVKEPGLKGALRSFIHPEKQTFEAVKDLTF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGFCRINGKIPQNNRQDYVKDIGVVFG
FT                   QRTQLWWDLALQETYTVLKEIYDVPNSLFHKRMDFLNEVLDLKDFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINKEEETTILLTTHDLSDIEQ
FT                   LCDRIFMIDKGQEIFDGTVSQLKETFGKMKTLSFELLPGQSHLVSHYEGLSDMTIDRQG
FT                   NSLNIEFDSSRYQSADIIKQTLSDFEIRDLKMVDTDIEDIIRRFYRKEL"
FT   gene            590463..591281
FT                   /locus_tag="SPP_0652"
FT   CDS_pept        590463..591281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0652"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21622"
FT                   /protein_id="ACO21622.1"
FT                   /translation="MIKLWRRYKPFINAGVQELITYRVNFILYRIGDVMGAFVAFYLWK
FT                   AVFDSSQESLIQGFSMADITLYIIMSFVTNLLTRSDSSFMIGEEVKDGSIIMRLLRPVH
FT                   FAASYLFTELGSKWLIFISVGLPFLSVIVLMKIISGQGIVEVLGLTVLYLFSLTLAYLI
FT                   NFFFNICFGFSAFVFKNLWGSNLLKTSIVAFMSGSLIPLAFFPKVVSDILSFLPFSSLI
FT                   YTPVMIIVGKYDASQILQALLLQFFWLLVMVGLSQLIWKRVQSFITIQGG"
FT   gene            591283..592068
FT                   /locus_tag="SPP_0653"
FT   CDS_pept        591283..592068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0653"
FT                   /product="ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20949"
FT                   /protein_id="ACO20949.1"
FT                   /translation="MKKYQRMHLIFIRQYIKQIMEYKVDFVVGVLGVFLAQGLNLLFLN
FT                   VIFQHIPFLEGWTFQEIAFIYGFSLIPKGMDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   NPLFHILVETFQIDALGELLVGGILLGTTVTSIVWTLPKFLLFLVCIPFATLIYTSLKI
FT                   ATASIAFWTKQSGAMIYIFYMFNDFAKYPISIYNSLLRWLISFIVPFAFTAYYPASYFL
FT                   QEKDVFFNVGGLMLISLVFFVISLKLWDKGLDSYESAGS"
FT   gene            592107..592567
FT                   /pseudo
FT                   /locus_tag="SPP_0654"
FT                   /note="acetyltransferase, gnat family, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            complement(592885..593067)
FT                   /locus_tag="SPP_0656"
FT   CDS_pept        complement(592885..593067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0656"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20912"
FT                   /protein_id="ACO20912.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVVDGTDVVSSKHCFEVVDRTDVVSN
FT                   HTHGKATLTWFEEIF"
FT   gene            593300..599731
FT                   /locus_tag="SPP_0657"
FT   CDS_pept        593300..599731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0657"
FT                   /product="serine protease"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF02225; match to protein family HMM PF06280;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20330"
FT                   /protein_id="ACO20330.1"
FT                   /translation="MKKSTVLSLTTAAVILAAYAPNEVVLADTSSSEDALSISDKEKVV
FT                   VDKETENKEKHKDIHNAIETSKDTEEKKTTIIEEKEVVSKNPVIDTKTSNEEARIKEDS
FT                   NQSQGDNAHSSANKGTENPKKEDRLVYIAEFKDKESGEKAIKGLSNLKNTKVLYTYDRI
FT                   FNGSAIETTPDNLDKIKQIEGISSVERAQKVQPMMNHARKEIGVEEAIDYLKSINAPFG
FT                   KNFDGRGMVISNIDTGTDYRHKAMRIDDDAKASMRFKKEDLKGTDKNYWLSDKIPHAFN
FT                   YYNGGKITVEKYDDGRDYFDPHGMHIAGILAGNDTEQDIKNFNGIDGIAPNAQIFSYKM
FT                   YSDAGSGFAGDETMFHAIEDSIKHNVDVVSVSSGFTGTGLVGEKYWQAIRALRKAGIPM
FT                   VVATGNYATSASSSSWDLVANNHLKMTDTGNVTRTAAHEDAIAVASAKNQTVEFDKVNI
FT                   GGESFKYRNIGAFFDKNKITTNEDGTKAPSKLKFVYIGKGQDQDLIGLDLRGKIAVMDR
FT                   IYTKDLKNAFKKAMDKGARAIMVVNTVNYYNRDNWTELPAMGYEADEGTKSQVFSISGD
FT                   DGVKLWNMINPNKKTEVKRNNKEDFKDKLEQYYPIDMESFNSNKPNVGDEKEIDFKFAP
FT                   DTDKELYKEDIIVPAGSTSWGPRIDLLLKPDVSAPGKNIKSTLNVINGKSTYGYMSGTS
FT                   MATPIVAASTVLIRPKLKEMLERPVLKNLKGDDKIDLTSLTKIALQNTARPMMDATSWK
FT                   EKSQYFASPRQQGAGLINVANALRNEVVATFKNTDSKGLVNSYGSISLKEIKGDKKYFT
FT                   IKLHNTSNRPLTFKVSASAITTDSLTDRLKLDETYKDEKSPDGKQIVPEIHPEKVKGAN
FT                   ITFEHDTFTIGANSSFDLNAVINVGEAKNKNKFVESFIHFESVEEMEALNSNGKKINFQ
FT                   PSLSMPLMGFAGNWNHEPILDKWAWEEGSRSKTLGGYDDDGKPKIPGTLNKGIGGEHGI
FT                   DKFNPAGVIQNRKDKNTTSLDQNPELFAFNNQGINAPSSSGSKIANIYPLDSNGNPQDA
FT                   QLERGLTPSPLVLRSAEEGLISIVNTNKEGENQRDLKVISREHFIRGILNSKSNDAKGI
FT                   KSSKLKVWGDLKWDGLIYNPRGREENAPESKDNQDPATKIRGQFEPIAEGQYFYKFKYR
FT                   LTKDYPWQVSYIPVKIDNTAPKIVSVDFSNPEKIKLITKDTYHKVKDQYKNETLFARDQ
FT                   KEHPEKFDEIANEVWYAGAALVNEDGEVEKNLEVTYAGEGQGRNRKLDKDGNTIYEIKG
FT                   AGDLRGKIIEVIALDGSSNFTKIHRIKFANQADEKGMISYYLVDPDQDSSKYQKLGEIA
FT                   ESKFKNLGNGKEGSLKKDTTGVEHHHQENEESIKEKSSFTIDRNISTIRDFENKDLKKL
FT                   IKKKYKEEDDFVTGGKRTVELDYKYDDKGNITAYEDESALEYETEKFDEIKSKIYGVLS
FT                   PSKDGHFEILGKISNVSKNAKVYYGNNYKFIEIKATKYDSHSKTMIFDLYANINDIVDG
FT                   LAFAGDMRLFVKDDNQIKAETKIRMPEKNKETKAEYPYVSSYGNVIELGEGDLSKNKPD
FT                   NLTKMESGKIYSDSEKQQYLLKDNIILRKGYALKVTTYNPGKTDMLEGNGVYSKEDIAK
FT                   IQKANPNLRVLSETTIYADSRNVEDGRSTQAVLMSALDGFNIIRYQVFTFKMNDKGEAI
FT                   DKDGNLVTDSSKLVLFGKDDKEYTGEDKSNVEAIKEDGSMLFIDTKPVNLSMDKNYFNP
FT                   SKSNKIYVRNPEFYLRGKISDKGGFNWELRVNESVVDNYLIYGDLHIDNTRDFNIKLNV
FT                   KDGDIMDWGMKDYKANGFPDKVTDMDGNVYLQTGYSDLNAKAVGVHYQFLYDNVKPEVN
FT                   IDPKGNTSIEYADGKSVVFNINDKRNNGFDGEIQEQHIYVNGKEYTSFDDIKQITDKTL
FT                   NIKIVVKDFARNTTVKEFILNKDTGEVSELKPHRVTVTIQNGKEMSSTIVSEEDFILPV
FT                   YKGELEKGYQFDGWEISGFEGKKDAGYVINLSKDTFIKPVFKKIEEKKEEENKPTFDVS
FT                   KKKDNPQVNHSQLNESHRKEDLQREDHSQKSDSTKDVTATVLDKNNISSKSTTNNPNKL
FT                   PKTGTASGAQTLLAAGIMFIVGIFLGLKKKNQD"
FT   gene            complement(600465..600611)
FT                   /pseudo
FT                   /locus_tag="SPP_0658"
FT                   /note="conserved domain protein; this region contains one
FT                   or more premature stops and/or frameshifts"
FT   gene            600696..600908
FT                   /pseudo
FT                   /locus_tag="SPP_0659"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            600981..601430
FT                   /pseudo
FT                   /locus_tag="SPP_0660"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            602119..602595
FT                   /locus_tag="SPP_0661"
FT   CDS_pept        602119..602595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0661"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21749"
FT                   /protein_id="ACO21749.1"
FT                   /translation="MVLDYFFDKNLVFCLEADNQEHLFDQVATLLEEREIVTPTYREAL
FT                   ITREKSFPTGLDMEFLGKNLPNVAIPHTDIVHNLAEKVVVVRLEKPVTFHNMIAPDKEV
FT                   EVSLLFFIINNSSSSQTNILAQLMDFFTGNGHLEDLSKISEPEKLYAYIAEATA"
FT   gene            602633..602938
FT                   /locus_tag="SPP_0662"
FT   CDS_pept        602633..602938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0662"
FT                   /product="PTS system, galactose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21166"
FT                   /protein_id="ACO21166.1"
FT                   /translation="MIKILAACGAGVNSSHQIKSALEEELSNRGYDVHCDAVMVKDVNE
FT                   DLMKGYDIFTPIAATDLGFEPGIPVIEAGPILFRIPAMSAPVFDNIEAAIKEHGLS"
FT   gene            602986..604461
FT                   /locus_tag="SPP_0663"
FT   CDS_pept        602986..604461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0663"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="identified by match to protein family HMM PF03611"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20574"
FT                   /protein_id="ACO20574.1"
FT                   /translation="MDAIFDLIGKVFNPILEMGGPVIMLIILTVLALLFGVKFSKALEG
FT                   GIKLAIALTGIGAIIGMLNGAFSASLAKFVENTGIQLSITDVGWAPLATITWGSAWTLY
FT                   FLLIMLIVNVVMLAMKKTDTLDVDIFDIWHLSITGLLIKWYADNNGVSQGVSLFIATAA
FT                   IVLVGVLKIINSDLMKPTFDDLLNAPSSSPMTSTHMNYMMNPVIMVLDKIFEKFFPGLD
FT                   KYDFDAAKLNKKIGFWGSKFFIGFILGIVIGIMGTPHPIAGVADADKWRLVIKGWLSLG
FT                   LTAGVSLELFSLIGSWFIAAVEPLSQGITNVATKRLQGRKFNIGLDWPFIAGRAEIWAC
FT                   ANVLAPIMLIEAVLLSKVGNGILPLAGIIAMGVTPALLVVTRGKLLRMIIFGTLLLPLF
FT                   LLSGTLIAPFATELAKGVGAFPEGVSQTQLITHSTLEGPIEKLLGWTIGNTTTGDIKAI
FT                   LGAVAFLVFYIGIFAWYRKQMIKRNEEYAAKAK"
FT   gene            604487..604633
FT                   /locus_tag="SPP_0664"
FT   CDS_pept        604487..604633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0664"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21115"
FT                   /protein_id="ACO21115.1"
FT                   /translation="MKIKEQTRKLATGCSKHSFEVVDETDEVSNHIYGKATLTKFELDF
FT                   RRV"
FT   gene            604721..611422
FT                   /locus_tag="SPP_0665"
FT   CDS_pept        604721..611422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0665"
FT                   /product="beta-galactosidase"
FT                   /note="identified by match to protein family HMM PF00703;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF02836; match to protein family HMM PF02837;
FT                   match to protein family HMM PF04650; match to protein
FT                   family HMM PF07501; match to protein family HMM PF07532;
FT                   match to protein family HMM TIGR01167; match to protein
FT                   family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20620"
FT                   /protein_id="ACO20620.1"
FT                   /translation="MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYA
FT                   DETLITHTAEKPKEEKMIVEEKADKALETKNVVERTEQSEPSSTEAIASEKKEDEAVTP
FT                   KEEKVSAKLEEKAPRIESQASSQEKPLKEDAKAVTNEEMNQMIEDRKVDFNQNWYFKLN
FT                   ANSKEAIKPDVDVSTWKKLDLPYDWSIFNDFDHESPAQNEGGQLNGGEAWYRKTFKLDE
FT                   KDLKKNVRLTFDGVYMDSQVYVNGQLVGHYPNGYNQFSYDITKYLHKDGRENVIAVHAV
FT                   NKQPSSRWYSGSGIYRDVTLQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIANT
FT                   DDKDHELVAEYQIVERGGHAVTGLVRTASRTLKAHESTSLDAILEVERPKLWTVLNDKP
FT                   ALYELITRVYRDGQLVDAKKDLFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGA
FT                   EENYKAEYRRLKQMKEMGVNSIRTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPY
FT                   DYGRFFEKDATHPEARKGEKWSDFDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLV
FT                   TVKRLVKVIKDVDKTRYVTMGADKFRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAK
FT                   HPKWLIYGSETSSATRTRGSYYRPERELKHSNGPERNYEQSDYGNDRVGWGKTATASWT
FT                   FDRDNAGYAGQFIWTGTDYIGEPTPWHNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQW
FT                   VSVKKKPMVHLLPHWNWENKELASKVADSEGKIPVRAYSNASSVELFLNGKSLGLKTFN
FT                   KKQTSDGRTYQEGANANELYLEWKVAYQPGTLEAIARDESGKEIARDKITTAGKPAAVR
FT                   LIKEDHAIAADGKDLTYIYYEIVDSQGNVVPTANNLVRFQLHGQGQLVGVDNGEQASRE
FT                   RYKAQADGSWIRKAFNGKGVAIVKSTEQAGKFTLTAHSDLLKSNQVTVFTGKKEGQEKT
FT                   VLVTEVPKVQTIIGEAPEMPTTVPFVYSDGSRAERPVTWSSVDVSKPGIVTVKGMADGR
FT                   EVEARVEVIALKSELPVVKRIAPNTDLNSVDKSVSYVLTDGSVQEYEVDKWEIAEEDKA
FT                   KLAIPGSRIQATGYLEGQPIHATLVVEEGNPAAPAVPTVTVGGEAVTGLTSQKPMQYRT
FT                   LAYGAKLPEVTASAKNAAVTVLQASAANGMRASIFIQPKDGGPLQTYAIQFLEEAPKIA
FT                   HLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLPADKVTFSTSGEGEVAIRKGMLELH
FT                   KPGAVTLKAEYEGAKGQVDLTIQANTEKKIAQSIRPVNVVTDLHQEPTLPSTVTVEYDK
FT                   GFPKAHKVTWQAIPKEKLDSYQTFEVLGKVEGIDLEARARVSVEGIVSVEEVSVTTPIA
FT                   EAPQLPESVRTYDSNGHVSSAKVAWDAIRIEQYAKEGVFTVNGRLEGTQLTTKLHVRVS
FT                   AQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKLISYNNQPANRWTNWNRSNPE
FT                   ASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGAPKSYVIEYYVGKTVPTAPKNPSFVGN
FT                   EDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAVRIRMVKADNKRGTSITEV
FT                   QIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGKVTAVTASVSNNGLATVV
FT                   PSVREGEPVRVIAKAENGDILGEYRLHFTKDKSLLSHKPVAAVKQARLLQVGQALELPT
FT                   KVPVYFTGKDGYETKDLTVEWEEVPAENLTKAGQFTVRGRVLGSNLVAEITVRVTDKLG
FT                   ETLSDNPNYDENSNQAFASATNDIDKNSHDRVDYLNDGDHSENRRWTNWSPTPSSNPEV
FT                   SAGVIFRENGKIVERTVAQGKVQFFADSGTDAPSKLVLERYVGPEFEVPTYYSNYQAYD
FT                   ADHPFNNPENWEAVPYRADKDIAAGDEINVTFKDIKAKAMRWRMERKADKSGVAMIEMT
FT                   FLAPSELPQESTQSKILVDGKELADFAENRQDYQITYKGQRPKVSVEENNQVASTVVDS
FT                   GEDSLPVLVRLVSESGKQVKEYRIHLTKEKPVSEKTVAAVQEDLPKLEFVEKDLAYKTV
FT                   EKKDSTLYLGETRVEQEGKTGKERIFTAINPDGSKEEKLREVVEAPTDRIVLVGTKPVA
FT                   QEAKKPQVSEKADTKPIDSSEASQTNKAQLPNTGSASSQAAVAAGLALLGLSAGLVVTK
FT                   GKKED"
FT   gene            complement(611670..612293)
FT                   /locus_tag="SPP_0666"
FT   CDS_pept        complement(611670..612293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0666"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21991"
FT                   /protein_id="ACO21991.1"
FT                   /translation="MEELVTLDCLFIDGTKIEANANKYSFVWKKKTEKFSAKLQEQIQV
FT                   YFQEEITPLLIKYAMFDKKQKRGYKQSAKNLANWHYNDKEDSYIHPDGWCYRFHHIKYQ
FT                   KTQTDFQQEIKVYYADEPESAPQKGLYMNERYQNLKAKECQALLSPQDRQIFAQRKIDV
FT                   EPVFGQIKACLGYKRCNLRGKRQVRIDMGLVLMANNLLKHSEIK"
FT   gene            complement(612281..612526)
FT                   /locus_tag="SPP_0667"
FT   CDS_pept        complement(612281..612526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0667"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21551"
FT                   /protein_id="ACO21551.1"
FT                   /translation="MHIHYNTNQTTLPLEISSFLPQDHLVFTIEKVVNTLEDCHFHAFY
FT                   HAFDRPSYHLKMLVSTLLFAYSQGIFSGRKIEKWKS"
FT   gene            complement(612737..613096)
FT                   /locus_tag="SPP_0668"
FT   CDS_pept        complement(612737..613096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0668"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21719"
FT                   /protein_id="ACO21719.1"
FT                   /translation="MGMILMKLASILLLILTLVICIILTKLFRLKKLGRNFADLAFPVL
FT                   VFEYYLITAKTFTHNFLPRLGLTLSILAIILVFFFLLKKRSFYYPKFIKFFWRAGFLLT
FT                   LIMYVEMIVELFLMK"
FT   gene            613188..614144
FT                   /pseudo
FT                   /locus_tag="SPP_0669"
FT                   /note="radical SAM superfamily enzyme, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts"
FT   gene            614122..614684
FT                   /pseudo
FT                   /locus_tag="SPP_0672"
FT                   /note="SAM-dependent methyltransferase, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            614677..614931
FT                   /locus_tag="SPP_0674"
FT   CDS_pept        614677..614931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0674"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21093"
FT                   /protein_id="ACO21093.1"
FT                   /translation="MDKQYLHEKLDAMRQNFVESTHHERAVGVLDQAHMSKKMLKIKKK
FT                   LVALEMERCQRKIEHKDCSKIDQKIKEQKEIFESCCKKD"
FT   gene            614943..616997
FT                   /locus_tag="SPP_0675"
FT   CDS_pept        614943..616997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0675"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21528"
FT                   /protein_id="ACO21528.1"
FT                   /translation="MELLIYLILFLLVLIVSSTTNKLLPFLPLPLVQILLGIVIGLFLP
FT                   NTDFHLNTELFLALVIGPLLFREAEEADVTAILKHWRIIVYLIFPVIFISTLSLGGLAH
FT                   LLWFSLPLAACLAVGAALGPTDLVAFASLSERFSFPKRVSNILKGEGLLNDASGLVAFQ
FT                   VALTAWTTGAFSLGQASSSLIFSILGGFLIGFLTAMTNRFLHTFLLSVRATDIASELLL
FT                   ELSLPLVTFFLAEEVHVSGIIAVVVAGILKASRFKKITLLEAQVDTVTETVWHTVTFML
FT                   NGSVFVILGMELEMIAEPILTNPIYNPLLLLLSLIALTFVLFVIRFIMIYGYYAYRTRR
FT                   LKKKLNKYMKDMFLLTFSGVKGTVSIATILLIPSNLEQEYPLLLFLVAGVTLVSFLTGL
FT                   LVLPHLSDEEEKSKDYLMHIAILNEVTLELEKELEDTRNKLPLYAAIDNYHGRIENLIL
FT                   SQENQDDQEDWAALKLLILSIESDGLEQAYEEGNISNRAYRVYQRYLKNIEQGINRKLA
FT                   SRLTYYFLVSLRILRFLLHEVFTLGKTFRSWKDKEQSRLRALDYDQIAELYLANTEMII
FT                   ESLENLKGVYRRSLISFMQESRLRETAIISSGAFVERVINRVKPNNIDEMLRGYYLERK
FT                   LIFEYEEKRLITTKYAKKLRQNVNNLENYSLKEAANTLPYDMVELVRRN"
FT   gene            complement(617030..617143)
FT                   /locus_tag="SPP_0676"
FT   CDS_pept        complement(617030..617143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0676"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21221"
FT                   /protein_id="ACO21221.1"
FT                   /translation="MKIKEQTRKLAAGCSKPCFEVVDETDEVSHIYNPRRR"
FT   gene            617176..618036
FT                   /locus_tag="SPP_0677"
FT   CDS_pept        617176..618036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0677"
FT                   /product="ribonuclease BN"
FT                   /note="identified by match to protein family HMM PF03631"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20628"
FT                   /protein_id="ACO20628.1"
FT                   /translation="MKKWWKELIDKPLLKAFLHYYQASDSELTSVAVAYYWLISIFPLL
FT                   LVVVNILPYFQIPVGEFLCFMKDVLPPSLYEGVEKIAREVLTQPSTGLLSFSVLSALWS
FT                   FSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQLLFAFALFLILFGQMILALL
FT                   AHYWTKDGIIYQALQGLAGPLIYALLFAILVMLYYFLPNISNRKISYTLPGSAFVLLVI
FT                   LGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVILGAVINASMQSLKDP
FT                   VFKKD"
FT   gene            618255..618965
FT                   /locus_tag="SPP_0678"
FT   CDS_pept        618255..618965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0678"
FT                   /product="cytoChrome c-type biogenesis protein"
FT                   /note="identified by match to protein family HMM PF02683"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20867"
FT                   /protein_id="ACO20867.1"
FT                   /translation="MGHIFFFLSVFLAGILSFFSPCILPLLPVYTGVLLDDKDGAQASS
FT                   GKFSISVTSLLRTLAFIAGISFIFILLGYGAGFLGDLLYASWFQYLTGAIIILLGLHQM
FT                   EILHFKGLYKEKRLQLQGQGQNGKGYSQAFLLGLTFSFAWTPCVGPVLGSVLALAASGG
FT                   SGAWQGAGLMLVYTLGLALPFLLLALTSSYVLKHFRKLHPYLGILKKVGGFLIIVMGLL
FT                   VLFGNASILSQLFE"
FT   gene            618985..619551
FT                   /locus_tag="SPP_0679"
FT   CDS_pept        618985..619551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0679"
FT                   /product="thioredoxin family protein"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21432"
FT                   /protein_id="ACO21432.1"
FT                   /translation="MKKWQTCVLGAGSLLWLTACSGKSVTSEHQTKDEMKTEQTASKTS
FT                   AAKGKEVADFELMGVDGKTYRLSDYKGKKVYLKFWASWCSICLASLPDTDEIAKEAGDD
FT                   YVVLTVVSPGHKGEQSEADFKNWYKGLDYKNLPVLVDPSGKLLETYGVRSYPTQAFIDK
FT                   EGKLVKTHPGFMEKDAILQTLKELA"
FT   gene            619562..620674
FT                   /locus_tag="SPP_0680"
FT   CDS_pept        619562..620674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0680"
FT                   /product="peptide methionine sulfoxide reductase MsrA/msrB"
FT                   /EC_number="1.8.4.11"
FT                   /EC_number="1.8.4.12"
FT                   /note="identified by match to protein family HMM PF01625;
FT                   match to protein family HMM PF01641; match to protein
FT                   family HMM TIGR00357; match to protein family HMM
FT                   TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20157"
FT                   /protein_id="ACO20157.1"
FT                   /translation="MNDKLKIFLLLGVFFLAITGFYVLLIRNAGQTDASQIEKAAVSQG
FT                   GKAVKKTEISKDADLHEIYLAGGCFWGVEEYFSRVPGVTDAVSGYANGRGETTKYELIN
FT                   QTGHAETVHVTYDAKQISLKEILLHYFRIINPTSKNKQGNDVGTQYRTGVYYTDDKDLE
FT                   VINQVFDEVAKKYDQPLAVEKENLKNFVVAEDYHQDYLKKNPNGYCHINVNQAAYPVID
FT                   ASKYPKPSDEELKKTLSPEEYAVTQENQTERAFSNRYWDKFESGIYVDIATGEPLFSSK
FT                   DKFESGCGWPSFTQPISPDVVTYKEDKSYNMTRMEVRSRVGDSHLGHVFTDGPQDKGGL
FT                   RYCINSLSIRFIPKDQMEEKGYAYLLDYVD"
FT   gene            620987..621724
FT                   /locus_tag="SPP_0681"
FT   CDS_pept        620987..621724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0681"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20872"
FT                   /protein_id="ACO20872.1"
FT                   /translation="MTYTILIVEDEYLVRQGLTKLVNVAAYDMEIIGQAENGRQAWELI
FT                   QKQVPDIILTDINMPHLNGIQLASLVRETYPQVHLVFLTGYDDFDYALSAVKLGVDDYL
FT                   LKPFSRQDIEEMLGKIKQKLDKEEKEEQLQDLLTNRFEGNMAQKIQSHLADSQFSLKSL
FT                   ASDLGFSPTYLSSLIKKELGLPFQDYLVRERVKQAKLLLLTTDLKIYEIAEKVGFEDMN
FT                   YFTQRFKQIAGVTPRQFKKGEDR"
FT   gene            621721..623412
FT                   /locus_tag="SPP_0682"
FT   CDS_pept        621721..623412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0682"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF00672;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF02743; match to protein family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21698"
FT                   /protein_id="ACO21698.1"
FT                   /translation="MKRSSLLVRMVISIFLVFLILLALVGTFYYQSSSSAIEATIEGNS
FT                   QTTISQTSHFIQSYIKKLETTSTGLTQQTDVLAYAENPSQDKVEGIRDLFLTILKSDKD
FT                   LKTVVLVTKSGQVISTDDSVQMKTSSDMMAEDWYQKAIHQGAMPVLTPARKSDSQWVIS
FT                   VTQELVDAKGANLGVLRLDISYETLEAYLNQLQLGQQGFAFIINENHEFVYHPQHTVYS
FT                   SSSKMEAMKPYIETGQGYTPGHKSYVSQEKIAGTDWTVLGVSSLEKLDQVRSQLLWTLL
FT                   GASVTSLLVCLCLVWFSLKRWIAPLKDLRETMLEIASGAQNLRAKEVGAYELREVTRQF
FT                   NAMLDQIDQLMVAIRSQEETTRQYQLQALSSQINPHFLYNTLDTIIWMAEFHDSQRVVQ
FT                   VTKSLATYFRLALNQGKDLICLSDEINHVRQYLFIQKQRYGDKLEYEINENVAFDNLVL
FT                   PKLVLQPLVENALYHGIKEKEGQGHIKLSVQKQDSGLVIRIEDDGVGFQDAGDSSQSQL
FT                   KRGGVGLQNVDQRLKLHFGANYQMKIDSRPQKGTKVEIYINRIETS"
FT   gene            623528..624091
FT                   /locus_tag="SPP_0683"
FT   CDS_pept        623528..624091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0683"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04260;
FT                   match to protein family HMM TIGR01440"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21812"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJD0"
FT                   /protein_id="ACO21812.1"
FT                   /translation="MNETQIQRETRQVVEDVLEKTNLKQGVLFVLGLSSSEVLGGQIGK
FT                   ESSQEIGELIVETILGILGSRGIHLAVQGCEHVNRALVVERQVAEQFDLEIVSVHPTLH
FT                   AGGSGQLAAFKFMQDPVEVEFIKAHAGLDIGDTAIGMHVKHVQVPIRPILREIGHAHVT
FT                   ALASRPKLIGGARAHYPQDAIRKS"
FT   gene            624113..629755
FT                   /gene="zmpB1"
FT                   /locus_tag="SPP_0684"
FT   CDS_pept        624113..629755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmpB1"
FT                   /locus_tag="SPP_0684"
FT                   /product="zinc metalloprotease ZmpB"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF05342; match to protein
FT                   family HMM PF07501; match to protein family HMM PF07580;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20994"
FT                   /protein_id="ACO20994.1"
FT                   /translation="MFKKDRFSIRKIKGVVGSVFLGSLLMAPSVVDAATYHYVNKEIIS
FT                   QEAKDLIQTGKPDRNEVVYGLVYQKDQFPQTGTEASVLTAFGLLTVGSLLLIYKRKKIA
FT                   SVFLVGAMGLVVLPSAGAVDPVATLALASREGVVEMDGYRYVGYLSGDILKTLGLDTVL
FT                   EETSAKPGEVTVVEVETPQSTTNQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEV
FT                   KPTDDTLPKVEEGKEDSAEPAPVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEPP
FT                   VEQAKVPEQPVQPTQAEQPSTPKESSQQENPKEDRGAEETPKQEDEQPAEAPEIKVEEP
FT                   VESKEETKTAKGTQEKGHVGEALAQEQLPEYKVTEGTLVETSTTDLDYKTETTEDPTKY
FT                   TDEETVLRTGEKGSQVTKTTYKTVEGVKTDQVLSTSTEVTKEPVNQQVIRGTKPIEGTL
FT                   IEESLEKIPFKEVVKEDDQLKKGLEVVAQEGKEGQKKITKTFNTIKGVKTEDAPKVTEE
FT                   ILEEPQDKILKRGTKSFEKPVLTITEIESKDLKRTSDVKYSLENPSKAAIKSITLTLKK
FT                   GDEIVKTLNVSPEDLTTTLTDLQYYKDYKLETKMVYDRGEGDEEEVLKEEPLRIDLKKV
FT                   EIKDIIRTDLIKYENQVETDETRLTSVPTDLSNYYLKVTSNDHKTNLLAVQKIEESTID
FT                   GKQVYKVIAVADNLVQRNVDNRFEETYTYYIEKPKASQAGIFYDFEELIQAIQTNPAGE
FT                   FKLGQSMSARNVVPKGKSYITSEFTGKLLSDGDKRYAIHNLEHPLFDKIKAGTVKNINF
FT                   ENIDIDLSNQDNIAAIANEISGTTRIENIKAIGTITARNNVAGFVNNIKEDATLENVAF
FT                   IGSINSAGNNSTVGGIAGSNYMGFVNRAYVDATITANNANASMLVPFVQYKAHSWLSGT
FT                   KGKLTNSVAKGILDVKNTKYVGGITSKTWPYGAVQDNVTYAKVIKGQEIFGSNDVNDGD
FT                   ANPFVSNLFGVIGYSSSEDGTGKDNKNKNKLKHLSKSEADAKVASFNITAAKFVSEPYE
FT                   LNKLNNVSSREAAYESIQDYNADYKLAYKNIEKLQPFYNKDFIVNQANKLDKNNKLNTK
FT                   EILSVTPMNNNNFVTDLGDANKIIVHYADGTKDYFNLSSSDEGLSNVREYTITDLGIKY
FT                   TPNIVQKDHSALINGIVNILSPIELQSNPIYQKLGRTGSNRVNAIKDLYLEESFDHVKA
FT                   NLNILVTKLVENEDHQLNNSSAAQQMILDKVEKNKAALLLGLTYLNRYYGVKFGDVNIK
FT                   ELMLFKPDFYGKNVSVLDRLIEIGSREDNIKGHRTYDAFSEIISKTTLSENLVNFLNYN
FT                   RRLFTADVNIYDWFKKATEGNVYIAERASEVDEIKAAKYKVWDNLQSATHRKMILPLLN
FT                   LNKSHVYLISNYSAMAVGTAEKLGHSSFDGIKNQIEKAADSYRNYFDFWYRLSLDKVKN
FT                   MLVKNTVTPLWEGYQAPGGWPDKYGKRNNKEDYAPLRELFGPIGKYYGNNGTGAYAVIW
FT                   DNPLDTRTEVNYIALSMIDEFGISVYTHETTHVNDRAIYLGGYGRRSGTHAEAYAQGML
FT                   QTPVPSTWFDEYGALGINMTFYRPNDGNQWYITDPKTLKTREDIDNYMKGYIDTLSLLD
FT                   YVEGDAVISKHDDKLNQLWFKKVDPIERTVGSKDQYDKVRNMSSDDWKGITLNSVNDLV
FT                   DNNLMTNRMMNNNIYKPEVFDPGIAYVGIKMMNSIYAGNTSEGAPGAVTFKNNAFRLWG
FT                   YYGYDKGFLGYASDKLKSQANKEGKQFGDQYIIQKISDGRFQSFADFKKEYYKELLEKA
FT                   NAGFTPFTIDGETIHNYDELKSLFAKALEEDMVTNKVNGKLVQVKEKVYKKLLQQTNSF
FT                   KTSIFK"
FT   gene            629816..631537
FT                   /locus_tag="SPP_0685"
FT   CDS_pept        629816..631537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0685"
FT                   /product="chorismate binding enzyme"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM TIGR00553"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21717"
FT                   /protein_id="ACO21717.1"
FT                   /translation="MHRKTVIDFRILGERYTFTQPIKEIKTRNVAEVADLLAQVESYQE
FT                   QGYYVVGYVSYEAAPAFEEKLAVHKDPLLGEYLLYFTVHDRVETSPIPLTYEDIDLPSN
FT                   WQEVTSAADYEKAIAQIHHHLRQGDTYQVNYTVQLKQKLSANPFAIYNRMVVEQEAGYN
FT                   AYVEHDEMAVISMSPELFFEQNDRELTTRPMKGTTQRGVTDQEDLEQASWLEQDPKNRS
FT                   ENMMIVDLLRNDMNRISEVGSEHVERLCQVEQYSTVWQMTSTIKSQLREDVDLVEIFRS
FT                   LFPCGSITGAPKIATMEIIKDLEPQPRGVYCGTIGLLLPNGRRIFNVAIRTIQLHKGQA
FT                   IYGVGGGITWDSTWESEYREVHQKAAVLYRKQARFQLITTGEISQKNLLFEDQHLERLR
FT                   KASRYFAFPFDAEDLGHKIEEECQDCEANQDYRLRISLSKSGEIEVNRQVLTPLSTSFC
FT                   QAQVCLQEAALNQSFTYFKTTHRPHLSLGEQEKIYHNKSGKLLETSIGNLVLKIAGKLY
FT                   TPPIRLGILPGIYRQYLLETGQVEEKVLTLADLAQAEAIYGCNAVRGLYELSLEEN"
FT   gene            631538..632155
FT                   /locus_tag="SPP_0686"
FT   CDS_pept        631538..632155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0686"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21431"
FT                   /protein_id="ACO21431.1"
FT                   /translation="MKLIFLHGLGQSAESWKEVRNLLTDYPSEAIELFPSGVSNYQQAK
FT                   ERVYQHLAQETEPFVLIGLSLGAALALELSSYDLPNLRALILSGCPLKLAGNILFYLQL
FT                   LIFKLLPKRVFEKQGADKALMVGVSEELKTLDLTDIAGTCPYPTLLICGIKDKPNLSSM
FT                   RSLHKLISESQFQIIPDGPHVLNKAKPKEFVEKTRSFLELLK"
FT   gene            632205..633202
FT                   /pseudo
FT                   /locus_tag="SPP_0688"
FT                   /note="lysozyme, authentic frameshift; this gene contains a
FT                   frame shift which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF01473; match to
FT                   protein family HMM PF07553"
FT   gene            633329..634288
FT                   /locus_tag="SPP_0689"
FT   CDS_pept        633329..634288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0689"
FT                   /product="glucokinase (Glucose kinase)"
FT                   /EC_number="2.7.1.2"
FT                   /note="identified by match to protein family HMM PF00480;
FT                   match to protein family HMM TIGR00744"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20546"
FT                   /protein_id="ACO20546.1"
FT                   /translation="MSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVD
FT                   DMIESIQHRLDLLGLAAADFQGIGMGSPGVVDREKGTVIGAYNLNWKTLQPIKQKIEKA
FT                   LGIPFFIDNDANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGE
FT                   LGHITVDFDQPISCTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVT
FT                   AKTVFDLAKEGDDLALIVYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGV
FT                   QKVYDENSFPQVRTSTKLALATLGNDAGVIGAASLVLQ"
FT   gene            634385..635224
FT                   /gene="thyA"
FT                   /locus_tag="SPP_0690"
FT   CDS_pept        634385..635224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="SPP_0690"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="identified by match to protein family HMM PF00303;
FT                   match to protein family HMM TIGR03284"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22050"
FT                   /db_xref="GOA:C1CJD5"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJD5"
FT                   /protein_id="ACO22050.1"
FT                   /translation="MTKADTIFKENIERILKEGVFSEQARPKYKDGTVANSKYVTGAFS
FT                   EYDLSKGEFPITTLRPIAIKSAIKEVLWIYQDQSNSLEVLNDKYNVHYWNDWEVGDTGT
FT                   IGERYGAVVKKHDIINKLLKQLETNPWNRRNIISLWDYQAFEETDGLLPCAFQTMFDVR
FT                   RVDGEIYLDATLTQRSNDMLVAHHINAMQYVALQMMIAKHFGWKVGKFFYFINNLHIYD
FT                   NQFEQAQELLRREPSNCQPRLVLNVPDGTNFFDIKAEDFELVDYDPVKPQLKFDLAI"
FT   gene            complement(635272..635442)
FT                   /locus_tag="SPP_0691"
FT   CDS_pept        complement(635272..635442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21337"
FT                   /protein_id="ACO21337.1"
FT                   /translation="MAKGFAKGLVTGVAGTVAAVAGAVYAFKKKVIEPEEQKAAFIEEN
FT                   RKKAARRRVSR"
FT   gene            635563..636447
FT                   /gene="miaA"
FT                   /locus_tag="SPP_0692"
FT   CDS_pept        635563..636447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="SPP_0692"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="identified by match to protein family HMM PF01715;
FT                   match to protein family HMM TIGR00174"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20902"
FT                   /db_xref="GOA:C1CJD7"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJD7"
FT                   /protein_id="ACO20902.1"
FT                   /translation="MKTKIIVIVGPTAVGKTALAIEVAKCFNGEVVSGDSQQVYRGLDI
FT                   GTAKASPEEQAAVPHHLIDVREITESYSAFDFVSEAKMTIEDIHSRGKLAIIAGGTGLY
FT                   IQSLLEGYHLGGETPHEEILAYRASLEPYSDEELAHLVEQAGLEIPQFNRRRAMRALEI
FT                   AHFGQDLENQEILYEPLIICLDDERSQLYERINHRVDLMFEAGLLDEAKWLFDHSPNVQ
FT                   AAKGIGYKELFPYFRGEQTFEEARESLKQATRRFAKRQLTWFRNRMQVTFYQIGESGVQ
FT                   DRILSQIEEFLDD"
FT   gene            636440..637678
FT                   /gene="hflX"
FT                   /locus_tag="SPP_0693"
FT   CDS_pept        636440..637678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="SPP_0693"
FT                   /product="GTP-binding proten HflX"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR03156"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20161"
FT                   /protein_id="ACO20161.1"
FT                   /translation="MIETEKKEERVLLIGVELQGMDSFDLSMEELASLAKTAGAVVVDS
FT                   YRQKREKYDSKTFVGSGKLEEIALMVDAEEITTVIVNNRLTPRQNVNLEEVLGVKVIDR
FT                   MQLILDIFAMRARSHEGKLQVHLAQLKYLLPRLVGQGIMLSRQAGGIGSRGPGESQLEL
FT                   NRRSVRNQITDIERQLKVVEKNRATVREKRLESSTFKIGLIGYTNAGKSTIMNILTSKT
FT                   QYEADELFATLDATTKSIHLGGNLQVTLTDTVGFIQDLPTELVSSFKSTLEESKHVDLL
FT                   VHVIDASNPYHEEHEKTVLSIMKDLDMEDIPHLTLYNKADLVEDFTPTQTPYTLISAKS
FT                   EDSRENLQALLLDKIKEIFEAFTLRVPFSKSYKIHDLESVAILEERDYQEDGEVITGYI
FT                   SEKNKWRLEEFYD"
FT   gene            637671..638294
FT                   /locus_tag="SPP_0694"
FT   CDS_pept        637671..638294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0694"
FT                   /product="cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21323"
FT                   /protein_id="ACO21323.1"
FT                   /translation="MTDIKTLALKYGGYTSLDKVYLDQLLAGKTEQEQLTLITPPPSVV
FT                   NAYFAELYQKKSPQAATDYFAELSQELNLYNTEPSFTLENKPFIRLNLSGKSFGFCYES
FT                   DGLGRIFSENEEKISDDLLFEIAQIFSHQLVFEESGKIYMKPVKDEEVVSLESLTALTD
FT                   LERLADGRKRLKGYSQEDLLQEAAAFSGKRYFRSENRTAMLYID"
FT   gene            638309..639238
FT                   /gene="rnz"
FT                   /locus_tag="SPP_0695"
FT   CDS_pept        638309..639238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnz"
FT                   /locus_tag="SPP_0695"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM TIGR02651"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21712"
FT                   /db_xref="GOA:C1CJE0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJE0"
FT                   /protein_id="ACO21712.1"
FT                   /translation="MDIQFLGTGAGQPSKARNVSSLALKLLDEINEVWLFDCGEGTQNR
FT                   ILETTIRPRKVSKIFITHLHGDHIFGLPGFLSSRAFQANEEQTDLEIYGPQGIKSFVLT
FT                   SLRVSGSRLPYRIHFHEFDQDSLGKILETDKFTVYAEELDHTIFCVGYRVMQKDLEGTL
FT                   DAEKLKAAGVPFGPLFGKIKNGQDLVLEDGTEIKAADYISAPRPGKIITILGDTRKTDA
FT                   SVRLAVNADVLVHESTYGKGDEKIARNHGHSTNMQAAQVAVEAGAKRLLLNHISARFLS
FT                   KDISKLKKDAATIFENVHVVKDLEEVEI"
FT   gene            639259..640014
FT                   /locus_tag="SPP_0696"
FT   CDS_pept        639259..640014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0696"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20995"
FT                   /protein_id="ACO20995.1"
FT                   /translation="MPTILITGASGGLAQEMVKLLPNDQLILLGRNKEKLAQLYGNYSH
FT                   AELIEIDITDDSALEALVTDLYLRYGKIDVLINNAGYGIFEGFDQIADKDIHQMFEVNT
FT                   FALMNLSRHLAARMKESSKGHIINIVSMAGLIATGKSSLYSATKFAAIGFSNALRLELM
FT                   PYGVYVTTVNPGPIRTGFFDQADPDGTYLKSVDRFLLEADAVAKKIVKIIGKNKRELNL
FT                   PILLNLAHKFYTLFPKLADKLAGETFNYK"
FT   gene            complement(640068..641036)
FT                   /locus_tag="SPP_0697"
FT   CDS_pept        complement(640068..641036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0697"
FT                   /product="regulatory function on capsule expression"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20504"
FT                   /protein_id="ACO20504.1"
FT                   /translation="MLLIFLSSLAILRQVWYNKNMRIQQLHYIIKIVETGSMNEAAKQL
FT                   FITQPSLSNAVRDLENEMGIEIFIRNPKGITLTRDGMEFLSYARQVVEQTQLLEERYKN
FT                   PVAHRELFSVSSQHYAFVVNAFVSLLKKSDMEKYELFLRETRTWEIIDDVKNFRSEVGV
FT                   LFLNSYNRDVLTKMLDDNHLLAHHLFTAQPHIFVSKTNPLAKKDKVKLSDLENFPYLSY
FT                   DQGTHNSFYFSEEILSQEHHKKSIVVSDRATLFNLLIGLDGYTIATGILNSNLNGDNIV
FT                   SIPLDIDDPIELVYIQHEKTSLSKMGERFIDYLLEEVQFDS"
FT   gene            641040..641309
FT                   /locus_tag="SPP_0698"
FT   CDS_pept        641040..641309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0698"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06014"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20586"
FT                   /protein_id="ACO20586.1"
FT                   /translation="MSLFLKKTQNFARMSLMKTFYDVQQFLKRFGIIVYMGKRLYDIEL
FT                   MKLELSRIYDAGLMDKLDYLEAEAVLRREHKVELDYIEKNGEKN"
FT   gene            641309..641689
FT                   /locus_tag="SPP_0699"
FT   CDS_pept        641309..641689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0699"
FT                   /product="rhodanese family protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22108"
FT                   /protein_id="ACO22108.1"
FT                   /translation="MVTWILWALILAMLAWMGFNYLRIRRAAKIVDNEEFEALIRTGQL
FT                   IDLRDPAEFHRKHILGARNIPSSQLKTSLAALRKDKPVLLYENQRAQRVTNAALYLKKQ
FT                   GFSEIYILSYGLDSWKGKVKTS"
FT   gene            641778..642005
FT                   /locus_tag="SPP_0700"
FT   CDS_pept        641778..642005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22041"
FT                   /protein_id="ACO22041.1"
FT                   /translation="MKEKKKNPLFVGILSIILGLLFPIVGLILGIIGLVLAISYQKESQ
FT                   LDYKIEKILNILGIVISVVNWIVAIALIFR"
FT   gene            complement(642045..642770)
FT                   /locus_tag="SPP_0701"
FT   CDS_pept        complement(642045..642770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0701"
FT                   /product="ribosomal small subunit pseudouridine synthase A,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21594"
FT                   /protein_id="ACO21594.1"
FT                   /translation="MRLDNLLAQEKVSRKAMKQALLRGEILVDGCPARSLAQNIDTGLQ
FT                   ELLFQDRIIQGYEHTYLMLHKPAGVVTANKDKELPTVMDLLPSDIQSDKLYAVGRLDRD
FT                   TTGLLLLTDNGPLGFQLLHPQYHVDKTYQVEVNGLLTPDHIQTFQKGIVFLDGTICKPA
FT                   RLEILSASPSLSQASITISEGKFHQIKKMFLSVGVKVTNLKRIQFGDFTLNPDLAEGNY
FT                   HPLNQKELQIIKNYLEMSR"
FT   gene            642911..644773
FT                   /gene="typA"
FT                   /locus_tag="SPP_0702"
FT   CDS_pept        642911..644773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="SPP_0702"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20304"
FT                   /protein_id="ACO20304.1"
FT                   /translation="MNIIEEIMTKLREDIRNIAIIAHVDHGKTTLVDELLKQSETLDAR
FT                   TELAERAMDSNDIEKERGITILAKNTAVAYNGTRINIMDTPGHADFGGEVERIMKMVDG
FT                   VVLVVDAYEGTMPQTRFVLKKALEQDLVPIVVVNKIDKPSARPAEVVDEVLELFIELGA
FT                   DDDQLDFPVVYASAINGTSSLSDDPADQEATMAPIFDTIIDHIPAPVDNSDEPLQFQVS
FT                   LLDYNDFVGRIGIGRVFRGTVKVGDQVTLSKLDGTTKNFRVTKLFGFFGLERREIQEAK
FT                   AGDLIAVSGMEDIFVGETITPTDAVEALPILHIDEPTLQMTFLVNNSPFAGKEGKWVTS
FT                   RKVEERLQAELQTDVSLRVDPTDSPDKWTVSGRGELHLSILIETMRREGYELQVSRPEV
FT                   IVKEIDGVKCEPFERVQIDTPEEYQGSVIQSLSERKGEMLDMISTGNGQTRLVFLVPAR
FT                   GLIGYSTEFLSMTRGYGIMNHTFDQYLPLIPGEIGGRHRGALVSIDAGKATTYSIMSIE
FT                   ERGTIFVNPGTEVYEGMIIGENSRENDLTVNITKAKQMTNVRSATKDQTAVIKTPRILT
FT                   LEESLEFLNDDEYMEVTPESIRLRKQILNKAEREKANKKKKSAE"
FT   gene            644793..645047
FT                   /locus_tag="SPP_0703"
FT   CDS_pept        644793..645047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21939"
FT                   /protein_id="ACO21939.1"
FT                   /translation="MVYLVLGILLLLLYVFATPESIKGTVNIVAMVCILVALLILLVLS
FT                   FLKIFQLPTEIFLAIAMLILAYFSVRDITLMPVKKSKRR"
FT   gene            645413..645712
FT                   /locus_tag="SPP_0704"
FT   CDS_pept        645413..645712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0704"
FT                   /product="bacteriocin, lactococcin 972 family"
FT                   /note="identified by match to protein family HMM TIGR01653"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20708"
FT                   /protein_id="ACO20708.1"
FT                   /translation="MKTKKHRLLALALISSFTLLGAASAAVQYPDGGVWTYGEGSGGGW
FT                   AFSNYYHGKKYHYSSLVSRWNSHSDKGEASAGKTSYAWIWTKWGEQVAFYCDYD"
FT   gene            645950..647803
FT                   /locus_tag="SPP_0705"
FT   CDS_pept        645950..647803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0705"
FT                   /product="bacteriocin-associated integral membrane protein"
FT                   /note="identified by match to protein family HMM PF07242;
FT                   match to protein family HMM TIGR01654"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20646"
FT                   /protein_id="ACO20646.1"
FT                   /translation="MENFANSEQSLIARRIVEPSKDGTTHFTYATYGQGTLPKEFQEAS
FT                   QESRERSDPLNSYLLLSGSLTKEKLADKLGDLGYKASADRKIPPYFLAFRILLNPLILI
FT                   SLAIFGLSFFALVIITRIKEMRAAGIKLFSGQTLLSIMGHSLSTDIKWLLLSALLSFLG
FT                   GGVVLFSQGLFYPILLATYGFGISFYLLFLLAISILLMLLYLMSLSYKALVPVIKGRLP
FT                   LKRLMILTLLCQLVAVFTVGYAVKTGLMSYQRLKELEISKQAWQDRADYYQISFGLGDR
FT                   GKDTENQSKWYAFAKEAIEEEQALYVKDNLLHFANPQGKNEQGETLDTYSPDANTLYVS
FT                   PSYLDKEKVVVDAETKQKLAHLQKGEFILLLPEHLRSREAELKKVFEERLSYYGKSGEE
FT                   ASAPLDYEMKAHVSYLSMGEKRFVYNNGENPVSTQYLTDPILVVFTPTSTGDSFISLSS
FT                   WSINAGKQLFIKGYESGLELLKKAGIYEQVSYLKEGRSVYLTRYNEVQTETATLILGAI
FT                   VGIASSLLLFYSVNLLYFEQFRRDILIKRISGLRFFETHAQYMVSQFASFVFGASLFIL
FT                   SSRDLVIGLLTLLVFLASAVLTLYRQAQKESRVSMTIMKGK"
FT   gene            647805..648446
FT                   /locus_tag="SPP_0706"
FT   CDS_pept        647805..648446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0706"
FT                   /product="ABC transporter ATP-binding protein-sodium
FT                   transport"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22058"
FT                   /protein_id="ACO22058.1"
FT                   /translation="MIELKNISKKFGSRQLFSDTNLHFEGGKIYALIGTSGCGKTTFLN
FT                   MIGRLEPYDKGQIIYDGTSLKDIKPSVFFRDYLGYLFQDFGLIESQTVKENLNLGLVGK
FT                   KLKEKEKISLMKQALNCVNLSYLDLKQPIFELSGGEAQRVALAKIILKDPPLILADEPT
FT                   TSLDPKNSEELLSILESLKNPNRTIIIATHNPLIWEQVDQVIRVTDLSHR"
FT   gene            648550..649902
FT                   /gene="murD"
FT                   /locus_tag="SPP_0707"
FT   CDS_pept        648550..649902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SPP_0707"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01087"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21455"
FT                   /db_xref="GOA:C1CJF2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJF2"
FT                   /protein_id="ACO21455.1"
FT                   /translation="MKVIDQFKNKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFED
FT                   NPAAQSLLEEGIKVITGGHPLELLDEEFALMVKNPGIPYNNPMIEKALAKGIPVLTEVE
FT                   LAYLISEAPIIGITGSNGKTTTTTMIGEVLTAAGQHGLLSGNIGYPASQVAQIASDKDT
FT                   LVMELSSFQLMGVQEFHPEIAVITNLMPTHIDYHGSFSEYVAAKWNIQNKMTAADFLVL
FT                   NFNQDLAKDLTSKTEATVVPFSTLEKVDGAYLEDGQLYFRGEVVMAANEIGVPGSHNVE
FT                   NALATIAVAKLRGVDNQTIKETLSAFGGVKHRLQFVDDIKGVKFYNDSKSTNILATQKA
FT                   LSGFDNSKVVLIAGGLDRGNEFDELVPDITGLKKMVILGQSAERVKRAADKAGVAYVEA
FT                   TDIADATRKAYELATQGDVVLLSPANASWDMYANFEVRGDLFIDTVAELKE"
FT   gene            649904..650962
FT                   /locus_tag="SPP_0708"
FT   CDS_pept        649904..650962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0708"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="identified by match to protein family HMM PF03033;
FT                   match to protein family HMM PF04101"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22012"
FT                   /db_xref="GOA:C1CJF3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJF3"
FT                   /protein_id="ACO22012.1"
FT                   /translation="MKKIVFTGGGTVGHVTLNLLLMPKFIEDGWEVHYIGDKRGIEHQE
FT                   ILKSGLDVTFHSIATGKLRRYFSWQNMLDVFKVCWGIVQSLFIMLRLRPQTLFSKGGFV
FT                   SVPPVIAARVSGVPVFIHESDLSMGLANKIAYKFATKMYSTFEQASSLSKVEHVGAVTK
FT                   VSDQKNPEPDELVDIQSHFNHKLPTVLFVGGSAGARVFNQLVTDHKKELTERYNIINLT
FT                   GDSSLNELSQNLFRVDYVTDLYQPLMELADIVVTRGGANTIFELLAIAKLHVIVPLGRE
FT                   ASRGDQLENAAYFVKKGYAEDLQESDLTLDSLEEKLSHLLSHKEDYQAKMKASKELKSL
FT                   ADFYQLLKKDLS"
FT   gene            650972..652171
FT                   /locus_tag="SPP_0709"
FT   CDS_pept        650972..652171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0709"
FT                   /product="cell division protein DivIB"
FT                   /note="identified by match to protein family HMM PF03799;
FT                   match to protein family HMM PF08478"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20668"
FT                   /protein_id="ACO20668.1"
FT                   /translation="MSKDKKNEDKEILEELKELSEWQKRNQEYLKKKAEEEAALAEEKE
FT                   KERQARMGEESEKSEDKQDQESETDQEDSESAKEESEEKVASSEADKEKEEKEEPESKE
FT                   KEEQDKKLSKKATKEKPAKAKIPGIHILRAFTILFPSLLLLIVSAYLLSPYATMKDIRV
FT                   EGTVQTTADDIRQASGIQDSDYTINLLLDKAKYEKQIKSNYWVESAQLVYQFPTKFTIK
FT                   VKEYDIVAYYISGENHYPILSSGQLETSSVSLNSLPETYLSVLFNDSEQIKVFVSELAQ
FT                   ISPELKAAIQKVELAPSKVTSDLIRLTMNDSDEVLVPLSEMSKKLPYYSKIKPQLSEPS
FT                   VVDMEAGIYSYTVADKLIMEAEEKAKQEAKEAEKKQEEEQKKQEEESNRNQTTQRSSRR
FT                   "
FT   gene            652404..653105
FT                   /gene="pyrF"
FT                   /locus_tag="SPP_0710"
FT   CDS_pept        652404..653105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="SPP_0710"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="identified by match to protein family HMM PF00215;
FT                   match to protein family HMM TIGR01740"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21097"
FT                   /db_xref="GOA:C1CJF5"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJF5"
FT                   /protein_id="ACO21097.1"
FT                   /translation="MREHRPIIALDFPSFEAVKEFLALFPAEESLYLKVGMELYYAAGP
FT                   EIVSYLKGLGHSVFLDLKLHDIPNTVKSAMKVLSQLGVDMTNVHAAGGVEMMKAAREGL
FT                   GSQAKLIAVTQLTSTSEAQMQEFQNIQTSLQESVIHYAKKTAEAGLDGVVCSAQEVQVI
FT                   KQATNPDFICLTPGIRPAGVAVGDQKRVMTPADAYQIGSDYIVVGRPITQAEDPVAAYH
FT                   AIKDEWTQDWN"
FT   gene            653139..653771
FT                   /gene="pyrE"
FT                   /locus_tag="SPP_0711"
FT   CDS_pept        653139..653771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="SPP_0711"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21262"
FT                   /protein_id="ACO21262.1"
FT                   /translation="MTLAKDIASHLLKIQAVYLKPEEPFTWASGIKSPIYTDNRVTLAY
FT                   PETRTLIENGFVEAIKEAFPEVEVIAGTATAGIPHGAIIADKMDLPFAYIRSKPKDHGA
FT                   GNQIEGRVAQGQKMVVVEDLISTGGSVLEAVAAAKREGADVLGVVAIFSYQLPKADKNF
FT                   ADAGVKLVTLSNYSELIHLAQEEGYITPEGLDLLKRFKEDQENWQEG"
FT   gene            654232..654354
FT                   /locus_tag="SPP_0712"
FT   CDS_pept        654232..654354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0712"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21952"
FT                   /protein_id="ACO21952.1"
FT                   /translation="MYYNGGGDNYIGSGTRLAMAPQFGNYVRIHTSGSWSPDSY"
FT   gene            654450..655214
FT                   /locus_tag="SPP_0713"
FT   CDS_pept        654450..655214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0713"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20368"
FT                   /protein_id="ACO20368.1"
FT                   /translation="MEFFICNLVRVVQSPRFYMSLFLTLLCMSLGNFLAFNGIYKIEGL
FT                   SIFFAASSIRGFSPISLVAALICTLPYSSQIIEDAESHFLTAQLCRISKKRYLAIVGST
FT                   AIISSFLVFFLPYLLLLGINLLVTPYQEIYIGDYSGALKELFDSNQFLYSLVTTLWYGV
FT                   WGAVFSIFGLASALLVKKKLGAIFIPVAYMMVGGILWAILGLSYLEPVTTLALGYQKDI
FT                   SLSLVSGHLAFILFVSCLVVYGTFFLHSEDYV"
FT   gene            655214..655966
FT                   /locus_tag="SPP_0714"
FT   CDS_pept        655214..655966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0714"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20502"
FT                   /protein_id="ACO20502.1"
FT                   /translation="MKQFVQFYKKDFLAVLVYFILLLSCVLSSTVYLLRCRQYSIHPNV
FT                   LEWILVLLQDMTTGVYCFPFTYILFFFYLMNNYFNRLECRIRLKSIKHFTSFSFKLAAL
FT                   STGIWTATLFLLIFLIAFSNGFSFSLEIKEVDFLREFYGISIANNASFFIGFFFSYIAY
FT                   YFFLSLLTISSFSWFKKSNMSLVFLFTFLFVESLFWIYQLDNGIIGLLPIFQYMVNSNP
FT                   YALIYWLTLLSIIIPLTVFSVHRNWRRV"
FT   gene            655970..656674
FT                   /locus_tag="SPP_0715"
FT   CDS_pept        655970..656674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0715"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22047"
FT                   /protein_id="ACO22047.1"
FT                   /translation="MEMGKLSSHMWRLNQIIYTKYFWGYVLFWILICLGLWYWLEGNDR
FT                   LVIEILKGPNLSQNSFLVLSIWLLHWFIIHTFFLAVVYRRRASDFFMEVIRFSSIKLWI
FT                   RYQIWTCFLYGLILIMVKVLVIQFMLQLPNWDIGVLFIVDSLNACVLVLFCFMLYVLGA
FT                   NEQMNFSCVSFFLLMIVFGGLFVGNRTNYLFYILNRGNGDIGRDLFLQLLFLVFLFKSI
FT                   FYFTRQKRRFIE"
FT   gene            656671..657318
FT                   /locus_tag="SPP_0716"
FT   CDS_pept        656671..657318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0716"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21693"
FT                   /protein_id="ACO21693.1"
FT                   /translation="MNEIITLKNIQLELKKTCVFQNLNFSCKQGEIIGITGANGSGKSV
FT                   LFKLIAGLYSPSYGEVLINGENIVPERKIPANLGALIEEPGFINYYSGFKNLQYLASIR
FT                   GVVGNQEINDTLKIVGLYEQKDQKVKTYSLGMRKKLGIAQAIMENPSILLLDEPMNALD
FT                   KSSVENMRTLFRKLSSEKGTTILIASHSEEDIRILCDKVYAIEDKVCTLCSD"
FT   gene            complement(657405..658271)
FT                   /locus_tag="SPP_0717"
FT   CDS_pept        complement(657405..658271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0717"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   system, periplasmic component/domain protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22140"
FT                   /protein_id="ACO22140.1"
FT                   /translation="MKLFKPLLTVLALAFALIFITACSSGGNAGSSSGKTTAKARTIDE
FT                   IKKSGELRIAVFGDKKPFGYVDNDGSYQGYDIELGNQLAQDLGVKVKYISVDAANRAEY
FT                   LISNKVDITLANFTVTDERKKQVDFALPYMKVSLGVVSPKTGLITDVKQLEGKTLIVTK
FT                   GTTAETYFEKNHPEIKLQKYDQYSDSYQALLDGRGDAFSTDNTEVLAWALENKGFEVGI
FT                   TSLGDPDTIAAAVQKGNQELLDFINKDIEKLGKENFFHKAYEKTLHLTYGDAAKADDLV
FT                   VEGGKVD"
FT   gene            complement(658283..659051)
FT                   /pseudo
FT                   /locus_tag="SPP_0718"
FT                   /note="glutamine transport ATP-binding protein GlnQ,
FT                   internal insertion; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            complement(659052..659729)
FT                   /pseudo
FT                   /locus_tag="SPP_0720"
FT                   /note="ABC transporter membrane-spanning permease -
FT                   glutamine transport, authentic point mutation; this gene
FT                   contains a premature stop which is not the result of
FT                   sequencing error"
FT   gene            complement(659689..660309)
FT                   /locus_tag="SPP_0722"
FT   CDS_pept        complement(659689..660309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0722"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20272"
FT                   /protein_id="ACO20272.1"
FT                   /translation="MHIAVWGILGSFLLGLIVSIIRHYRIPVLAQVATAYIELSRNTPL
FT                   LIQLFFLYFGLPLIGIVLSSEVCATLGLVFLGSSYMAESFRSGLEAISQTQQEIGLAIG
FT                   LTPLQVFRYVVLPQATAVVLPSFSANVIFLIKKTSVFSAVALADLMYVAKDLIGLYYET
FT                   DIALAMLVVAYLIMLLPISLVFSWIERRTCHAGFGNPSTLSRK"
FT   gene            660584..660730
FT                   /locus_tag="SPP_0723"
FT   CDS_pept        660584..660730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0723"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21656"
FT                   /protein_id="ACO21656.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFT
FT                   SFQ"
FT   gene            660858..662348
FT                   /gene="lysS"
FT                   /locus_tag="SPP_0724"
FT   CDS_pept        660858..662348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SPP_0724"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20951"
FT                   /protein_id="ACO20951.1"
FT                   /translation="MSTEHMEELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELK
FT                   DKYANLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENY
FT                   EIFKKADLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRK
FT                   RYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHN
FT                   AQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADF
FT                   QDIMDLTEGIIQHAAKSVKGDGPVNYQGTEIKINEPFKRVHMVDAIREITGVDFWQDMT
FT                   LKEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNP
FT                   EDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEA
FT                   LEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK"
FT   gene            662973..664109
FT                   /gene="lctO"
FT                   /locus_tag="SPP_0725"
FT   CDS_pept        662973..664109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctO"
FT                   /locus_tag="SPP_0725"
FT                   /product="L-lactate oxidase"
FT                   /EC_number="1.1.3.-"
FT                   /note="identified by match to protein family HMM PF01070;
FT                   match to protein family HMM TIGR02708"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20472"
FT                   /protein_id="ACO20472.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFT
FT                   LRENIRAFNHKLIVPHTLCDVENPSTEIEFAGEKLSSPIIMAPVAAHKLANEQGEVATA
FT                   RGVHEFGSLYTTSSYSTVDLPEISEALQGTPHWFQFYFSKDDGINRHIMDRVKAEGYKA
FT                   IVLTADATVGGNREVDKRNGFVFPVGMPIVEEYLPEGAGKSMDFVYKSAKQRLSPRDVE
FT                   FIAEYSGLPVYVKGPQCREDVERSLAAGASGIWVTNHGGRQIDGGPAAFDSLQEVAEAV
FT                   DRRVPIVFDSGVRRGQHVFKALASGADLVAIGRPVIYGLALGGSVGVRQVFEHLNAELK
FT                   TVMQLSGAQTIEDVKHFKLRHNPYNPTFPVDPRDLKLY"
FT   misc_binding    664363..664451
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); riboswitch00005"
FT   gene            664666..665334
FT                   /pseudo
FT                   /locus_tag="SPP_0726"
FT                   /note="transcriptional activator, TenA family, authentic
FT                   point mutation; this gene contains a premature stop which
FT                   is not the result of sequencing error"
FT   gene            complement(665389..665520)
FT                   /locus_tag="SPP_0727"
FT   CDS_pept        complement(665389..665520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0727"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21362"
FT                   /protein_id="ACO21362.1"
FT                   /translation="MKIKEQTRRLTAGCSKHCFEPVDKTDEVSSKHCFEVVDRTDVV"
FT   gene            665616..666398
FT                   /gene="thiM"
FT                   /locus_tag="SPP_0728"
FT   CDS_pept        665616..666398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="SPP_0728"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="identified by match to protein family HMM PF02110;
FT                   match to protein family HMM TIGR00694"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20231"
FT                   /db_xref="GOA:C1CJG8"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJG8"
FT                   /protein_id="ACO20231.1"
FT                   /translation="MTSLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPAD
FT                   LEDLLKYAGGLLINIGTLTDENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADD
FT                   LINNYKLAAIRGNAGEIASLVGIDVASKGVDSAGVDNIDEIALAANEKFNIPIVVTGEV
FT                   DAIAVNGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLEKGQELKSLETAMLVYNIAG
FT                   EMAEKRPNGHLPGTFKVEFINALYEITDEDVKKFKRVK"
FT   gene            666400..667029
FT                   /gene="thiE1"
FT                   /locus_tag="SPP_0729"
FT   CDS_pept        666400..667029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE1"
FT                   /locus_tag="SPP_0729"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20903"
FT                   /protein_id="ACO20903.1"
FT                   /translation="MFHKELLKLYFICGTTTCQGKNLYTVVEEALKGGITLFQFREKGE
FT                   GALEGLEKLELAIQIKELCKKYNVPFIVNDDIDLAMEIDADGVHVGQDDIGVDEIRKLM
FT                   PDKIIGLSIKNEEEFQQSKVEYVDYVGVGPVFDTQSKDDAGGAIGYEGLELMRKLLPQM
FT                   PLVAIGGIQTKHIKDIIKTNVDGVSIISAISYAKNIEKTVREMSEQ"
FT   misc_binding    667238..667326
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); riboswitch00004"
FT   gene            667588..668148
FT                   /locus_tag="SPP_0730"
FT   CDS_pept        667588..668148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0730"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22218"
FT                   /protein_id="ACO22218.1"
FT                   /translation="MLKKWQLKDVILLAFLSIFFGGVFVGSGYVYNILSLLLTPLGLQA
FT                   FANEILFGLWCMAAPIAAIFVPRVGSATIGEVLAALAEVLYGSQFGLGALLSGLVQGLG
FT                   SEFGFIVTKNRYESWLSLTANSIGITLVSFVYEYIKLGYYAFSLPFVLSLLVVRFISVY
FT                   FFCTILVRAIVKLYHQFATGGKA"
FT   gene            668149..669534
FT                   /locus_tag="SPP_0731"
FT   CDS_pept        668149..669534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0731"
FT                   /product="ABC transporter ATP-binding protein-cobalt or
FT                   other cation transport"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21791"
FT                   /protein_id="ACO21791.1"
FT                   /translation="MGLELRAIQSPIFSEPFDFTFHAQAFTLLVGSSGSGKSSLFQMIA
FT                   QVSSLPYSGQVLIDGSEVSQLSIIARVQKVGILLQNPNHQFTMENLFEELIFTLENIGY
FT                   HLQEIDSKIAEVVQQCRCEAILHRPIHHLSGGEKQKAALAVLFAMNPRVYLLDEPFASI
FT                   DRKSRIEILEILKELALDGKTVILCDHDLSDYKAYIDHMVELRDGKLREINQIPSYEMT
FT                   QVASKEVASSPELFHMNRVTGELGNRPLFSIADFTFYQGISCILGDNGVGKSTLFRSIL
FT                   QFQKYKGRIAWKGTVLKKKKSLYRDLTGVVQEAEKQFIRVSLREELQLDGPDSERNQRI
FT                   FQALRYFDLEQAVDKSPYQLSGGQQKILQLLTILTSKASVILLDEPFAGLDDRACHYFC
FT                   KWIVEERNQGRSFLLISHRLDPLISVVDYWIEMTSQGLRHVKEVTITKPLTSQSSNTQG
FT                   EVR"
FT   gene            669536..670186
FT                   /locus_tag="SPP_0732"
FT   CDS_pept        669536..670186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0732"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21930"
FT                   /protein_id="ACO21930.1"
FT                   /translation="MVKVATQTPIISLFLLILSLETSFIPSIALNLSVVAFCILFMLYY
FT                   RRFKMLAWMIILAILPSFANYWAVQLHGDASQAVMLGTRAFVTVCIGLVFVSSISLKEL
FT                   LLYLAQKGLSRSWSYALIVVFNSFPLIQQEIKSLKEACLLRGQKLHFWSPLIYSKVLMT
FT                   VFRWRHLYLRALSAHGYDEHAQLKNSYRTFYIPKKTKLIYLLFFLLLQTSLFL"
FT   gene            670197..670889
FT                   /locus_tag="SPP_0733"
FT   CDS_pept        670197..670889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0733"
FT                   /product="tena/thi-4 family"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21344"
FT                   /protein_id="ACO21344.1"
FT                   /translation="MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDA
FT                   YYLKAFSEIYHLLADKTSNQEMKRLLKQNAQGLVEGELFIRQQFFKELEINDQEMEQHP
FT                   IAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYHDIGKSLNLKPSPNPLYQQWIETY
FT                   ITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWEMAYQHQTWKSDL
FT                   QSLEKGEE"
FT   gene            670894..671418
FT                   /gene="thiW"
FT                   /locus_tag="SPP_0734"
FT   CDS_pept        670894..671418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiW"
FT                   /locus_tag="SPP_0734"
FT                   /product="ThiW protein"
FT                   /note="identified by match to protein family HMM TIGR02359"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21044"
FT                   /protein_id="ACO21044.1"
FT                   /translation="MRKHQLQVHKLTILSMMIALDVVLTPIFRIEGMAPMSSVVNILAG
FT                   IMMGPVYALAMATVTAFIRMTTQGIPPLALTGATFGALLAGLFYKYGRKFYFSALGEIV
FT                   GTGIIGSIVSYPVMVLFTGSAAKLSWFIYTPRFFGATLIGTAISFIAFRFLIKQEFFKK
FT                   VQGYFFAERIE"
FT   gene            671418..672221
FT                   /locus_tag="SPP_0735"
FT   CDS_pept        671418..672221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0735"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /note="identified by match to protein family HMM PF02110"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20450"
FT                   /db_xref="GOA:C1CJH5"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJH5"
FT                   /protein_id="ACO20450.1"
FT                   /translation="MQALTNPFPIGSSSLIHCMTNEISCEMLANGILALGCKPVMADDP
FT                   REVLDFTKQSQALFINLGHLSAEKEKAIRMAASYANQSSLPMVVDAVGVTTSSIRKSLV
FT                   KDLLDYRPTVLKGNMSEIRSLVGLKHHGVGVDASAKDQETEDLLQVLKDWCQTYPGMSF
FT                   LVTGPKDLIVSENQVAVLENGCTELDWITGTGDLVGALTAVFLSQGKTGFEASCLAVSY
FT                   LNIAAEKIVVQGMGLEEFRYQVLNQLSLLRRDENWLDTIKGEVYE"
FT   gene            672214..672846
FT                   /gene="thiE2"
FT                   /locus_tag="SPP_0736"
FT   CDS_pept        672214..672846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE2"
FT                   /locus_tag="SPP_0736"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20599"
FT                   /protein_id="ACO20599.1"
FT                   /translation="MNREALRLYLVTNRYQDSVESFLAKVETACRSGVTIVQLREKNLT
FT                   TNQYYQLAKQVKEITDAYQVPLIIDDRLDVCLAVDAAGLHIGDDELPVSVARKVLGPEK
FT                   ILGVTAKTVKRALEAEKSGADYLGTGAIFPTTTKENAPITLISTLKTICQTVAIPVVAI
FT                   GGLTSENIDQLMGTGIAGVAVVRDLMQAEDIEAKTQAFLTKLHDILS"
FT   gene            complement(673055..673846)
FT                   /gene="thiD"
FT                   /locus_tag="SPP_0737"
FT   CDS_pept        complement(673055..673846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SPP_0737"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM PF08543;
FT                   match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22056"
FT                   /protein_id="ACO22056.1"
FT                   /translation="MTYLPVALTIAGTDPSGGAGIMADLKSFQARDVYGMAVVTSLVAQ
FT                   NTRGVQLIEHVSPQMLKAQLESVFSDIPPQAVKTGMLATTEIMEIIQPYLKKLDCPYVL
FT                   DPVMVATSGDALIDSSARDYLKTNLLPLATIITPNLPEAEEIVGFSIHDPEGMQRAGRL
FT                   ILKEFGPQSVVIKGGHLKGGAKDFLFTKNEQFVWESPRIQTCHTHGTGCTFAAVITAEL
FT                   AKGKSLYQAVDKAKAFITKAIQDAPQLGHGSGPVNHTTFKD"
FT   misc_binding    complement(673930..674028)
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); riboswitch00007"
FT   gene            674212..674607
FT                   /locus_tag="SPP_0738"
FT   CDS_pept        674212..674607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0738"
FT                   /product="copper transport repressor, CopY/TcrY family"
FT                   /note="identified by match to protein family HMM PF03965;
FT                   match to protein family HMM TIGR02698"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20308"
FT                   /protein_id="ACO20308.1"
FT                   /translation="MQISDAEWQVMKIIWMQGEQTSTDLIRVLAERFDWSKSTIQTLLA
FT                   RLVEKECLTRKKEGKSFVYSALLTLDQSRDLLVQDIKDKVCSRRIRNLLADLIVECEFT
FT                   QTDLEDLEAVISEKKSSAVTEVRCNCM"
FT   gene            674618..674989
FT                   /locus_tag="SPP_0739"
FT   CDS_pept        674618..674989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0739"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21801"
FT                   /protein_id="ACO21801.1"
FT                   /translation="MLNSIVTIICIALIAFILFWFFKKPEKSGQKAQQKNGYQEIRVEV
FT                   MGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQV
FT                   GEFGFACGMNMMHGKMIVE"
FT   gene            674999..677242
FT                   /locus_tag="SPP_0740"
FT   CDS_pept        674999..677242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0740"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01511; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22072"
FT                   /protein_id="ACO22072.1"
FT                   /translation="MTEIVKASLENGIQKIRIRAEKGYHPAHIQLQKGIPAEITFHRAT
FT                   PSNCYKEILFEEEGILEPIGVDEEKVIRFTPQELGRHEFSCGMKMQKGSYIVVEKTRKS
FT                   LSLLQRFWITSIFTVPLVILMIGMLTGSISHQVMHWGTFLATTPIMLVAGKPYIQSAWA
FT                   SFKKHNANMDTLVALGTLVAYFYSLVALFAGLPVYFESAGFILFFVLLGAVFEEKMRKN
FT                   TSQAVEKLLDLQAKTAEVLSDDSYVQVPLEQVKVGDLIRVRPGEKIAVDGVVVEGVSSI
FT                   DESMVTGESLPVDKTVGDTVIGSTINHSGTLVFRAEKVGSETVLAQIVDFVKKAQTSHA
FT                   PIQDLTDKISGIFVPVVVILGIMTFWVWFVLLRDSVVVLGASFVSSLLYGVAVLIIACP
FT                   CALGLATPTALMVGTGRSAKMGVLLKNGTVLQEIQKVQTLVFDKTGTLTEGKPVVTDII
FT                   GDEVEVFGLAASLEDASQHPLAEAIVKRASEAGLEFQTVENFQALHGKGVSGRINGKQV
FT                   LLGNAKMLDGMDISNTYQDKLEELEKEAKTVVFLAVDNEIKGLLALQDIPKENAKLVIS
FT                   QLKKRGLRTVMLTGDNAGVARAIADQIGIEEVIAGVLPEEKAHEIHKLQQSGKVAFVGD
FT                   GINDAPALSVADVGIAMGAGTDIAIESADLVLTTNNLLGVVRAFDMSKKTFHRILLNLF
FT                   WAFIYNVVGIPIAAGVFSGVGLALNPELAGLAMAFSSVSVLTSSLLLNFSKID"
FT   gene            677449..679224
FT                   /gene="spxB"
FT                   /locus_tag="SPP_0741"
FT   CDS_pept        677449..679224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spxB"
FT                   /locus_tag="SPP_0741"
FT                   /product="pyruvate oxidase"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR02720"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21470"
FT                   /protein_id="ACO21470.1"
FT                   /translation="MTQGKITASAAMLNVLKTWGVDTIYGIPSGTLSSLMDALAEDKDI
FT                   RFLQVRHEETGALAAVMQAKFGGSIGVAVGSGGPGATHLINGVYDAAMDNTPFLAILGS
FT                   RPVNELNMDAFQELNQNPMYNGIAVYNKRVAYAEQLPKVIDEACRAAVSKKGPAVVEIP
FT                   VNFGFQEIDENSYYGSGSYERSFIAPALNEVEIDKAVEILNNAERPVIYAGFGGVKAGE
FT                   VITELSRKIKAPIITTGKNFEAFEWNYEGLTGSAYRVGWKPANEVVFEADTVLFLGSNF
FT                   PFAEVYEAFKNTEKFIQVDIDPYKLGKRHALDASILGDAGQAAKAILDKVNPVESTPWW
FT                   RANVKNNQNWRDYMNKLEGKTEGELQLYQVYNAINKHADQDAIYSIDVGNTTQTSTRHL
FT                   HMTPKNMWRTSPLFATMGIALPGGIAAKKDNPDRQVWNIMGDGAFNMCYPDVITNVQYD
FT                   LPVINLVFSNAEYGFIKNKYEDTNKHLFGVDFTNADYAKIAEAQGAVGFTVDRIEDIDA
FT                   VVAEAVKLNKEGKTVVIDARITQHRPLPVEVLELDPKLHSEEAIKAFKEKYEAEELVPF
FT                   RLFLEEEGLQSRAIK"
FT   gene            679335..679682
FT                   /locus_tag="SPP_0742"
FT   CDS_pept        679335..679682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0742"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20336"
FT                   /protein_id="ACO20336.1"
FT                   /translation="MNLNQLDIIVSNVPQVCADLEHILDKKADYADDGFAQFTIGSHCL
FT                   MLSQNHLVPLENFQSGIIIHIEVEDVDQNYKRLNELGIKVLHGPTVTDWGTESLLVQGP
FT                   AGLVLDFYRMK"
FT   gene            complement(679799..679960)
FT                   /locus_tag="SPP_0743"
FT   CDS_pept        complement(679799..679960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0743"
FT                   /product="transposase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22121"
FT                   /protein_id="ACO22121.1"
FT                   /translation="MLKEIRKRGFKNKAFRTLEDVMNQLQDVIQGLEKEVIKSIVNRRW
FT                   TRMLFESR"
FT   gene            complement(679954..680388)
FT                   /locus_tag="SPP_0744"
FT   CDS_pept        complement(679954..680388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0744"
FT                   /product="transposase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20679"
FT                   /protein_id="ACO20679.1"
FT                   /translation="MRLKIKSQFKKTRKRFKYSRRFHKVRLMYQDEAGFGRISKLGSCW
FT                   SPIGVGPHVHSHYIREFRYYYGAVDAYTGESFFLRAGGCNTEWMNVFLEELSQAYPDDY
FT                   FLLVMDNAIWHKSSTLKIPTNIGFAFIPPYTPEMNPLNKC"
FT   gene            complement(680339..680845)
FT                   /locus_tag="SPP_0745"
FT   CDS_pept        complement(680339..680845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0745"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20264"
FT                   /protein_id="ACO20264.1"
FT                   /translation="MKSIKEDIQTIKTLLKDSRTAKYHKRLQIVLFRLMGKSYKEIIEL
FT                   LDCNQTTIWRNVKKYEEFGLDSLLQETRGGRNHAYMTVEEEKAFLARHLKATEAGEFVT
FT                   IDALFQAYKKELGHSYTRDAFYQLLKRHGWRNITPRPEHPKKADAQTIVASKNKISIQE
FT                   DKKAF"
FT   gene            680910..681191
FT                   /locus_tag="SPP_0746"
FT   CDS_pept        680910..681191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0746"
FT                   /product="6-phospho-beta-glucosidase AscB, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21897"
FT                   /protein_id="ACO21897.1"
FT                   /translation="MDTPDENGYVADDYRITYLEAHIKAMRDAIYQDGIDLLGYTTWSC
FT                   IDPVSAGTGEMNKRYGFIYVDRDNVGNGTLKRSKKKSFYWYMSFIAMV"
FT   gene            681323..682267
FT                   /gene="manA"
FT                   /locus_tag="SPP_0748"
FT   CDS_pept        681323..682267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="SPP_0748"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="identified by match to protein family HMM PF01238;
FT                   match to protein family HMM TIGR00218"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20449"
FT                   /protein_id="ACO20449.1"
FT                   /translation="MSEPLFLQSVMQEKIWGGTKLRDEFGYDIPSEKVGEYWAISAHLN
FT                   GVSKVANGRYEGTDLATLYAEHRELFGNRPEPVFPLLTKILDANDWLSVQVHPDDAYGL
FT                   EHEGELGKTECWYIIAADEGSEIIYGHNAKSKEELRQQIEDKNWDALLTKVPVKAGDFF
FT                   YVPSGTMHAIGAGILILETQQSSDTTYRVYDFDRKDDKGNLRELHLEKSIDVLNIGEPA
FT                   NSRPVTIKADDLRSTLLVSNDFFAVYKWEITGKVNFEKTADYSLLSVLAGQGQLTVDGK
FT                   NYPIQKGRHFILPSDVEAWTLEGQDLELIVSHP"
FT   gene            complement(682258..683762)
FT                   /pseudo
FT                   /locus_tag="SPP_0747"
FT                   /note="sodium-dependent transporter, unverified frameshift;
FT                   an automated process has identified a potential problem
FT                   with this gene model; the current end5 and/or the end3 may
FT                   need to extended or the current gene model may need to be
FT                   merged with a neighboring gene model; the current gene
FT                   model (or a revised gene model) may contain a frame shift;
FT                   identified by match to protein family HMM PF00209"
FT   gene            683867..684607
FT                   /locus_tag="SPP_0750"
FT   CDS_pept        683867..684607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0750"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF07739; match to protein
FT                   family HMM PF09278"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20757"
FT                   /protein_id="ACO20757.1"
FT                   /translation="MYHIKEAAQLSGVSVKTLHHYDKIGLLVPLKSENGYRTYSQEDLE
FT                   RLQVILYYKYLGFSLEKIAELLKEERTDLLPHLTRQLDYLTRERQHLDTLISTLQKTIQ
FT                   EQKGERKMTIEEKFTGFSYQDNQKYHQEAVEKYGQEVMGQALERQKGHEDEATAAFNQV
FT                   FQTLAQNLQVGLPATATENQEQAAKLLQAIRTYGFDCSIEVFGHIGKGYVYNPEFKENI
FT                   DKFGSETAQYTSDAIAAYVQTNAE"
FT   gene            complement(684636..685058)
FT                   /locus_tag="SPP_0751"
FT   CDS_pept        complement(684636..685058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0751"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20699"
FT                   /protein_id="ACO20699.1"
FT                   /translation="MCMIKNGDKVLVQDRVSPDWSGITFPGGHVERGESFVDAVIREVK
FT                   EETGLIISKPQLCGIKNWYDDKDYRYVVLFYKTEHFTGELQSSDEGKVWWEDFENLSHL
FT                   KLATDDMSDMLRVFLEEDLSEFFYYKNGDDWLYDLK"
FT   gene            complement(685111..686286)
FT                   /locus_tag="SPP_0752"
FT   CDS_pept        complement(685111..686286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0752"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03486;
FT                   match to protein family HMM TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21759"
FT                   /protein_id="ACO21759.1"
FT                   /translation="MKHFDTIVIGGGPAGMMATISSSFYGQKTLLIEKNRKLGKKLAGT
FT                   GGGRCNVTNNGSLDNLLAGIPGNGRFLYSVFSQFDNHDIINFFTENGVKLKVEDHGRVF
FT                   PASDKSRTIIEALEKKITELGGQVATQIEIVSVKKVDNQFVLKSADQTFTCEKLIVTTG
FT                   GKSYPSTGSTGFGHEIARHFKHTITDLEAAESPLLTDFPHKALQGISLDEVTLSYGKHV
FT                   ITHDLLFTHFGLSGPAALRMSSFVKGGEVLSLDVLPQLSEKDLVTFLEENREKSLKNAL
FT                   KTLLPERLAEFFVQGYPEKVKQLTEKEREQLVQSIKELKIPVTGKMSLAKSFVTKGGVS
FT                   LKEINPKTLESKLVPGLHFAGEVMDINAHTGGFNITSALCTGWVAGSLHYD"
FT   gene            complement(686345..687190)
FT                   /locus_tag="SPP_0753"
FT   CDS_pept        complement(686345..687190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0753"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21284"
FT                   /protein_id="ACO21284.1"
FT                   /translation="MTWKIIADSGCDYRQLPTPAINTTFVSVPLTIQVADQVFVDDASL
FT                   DIDQMMETMYATAEASKSACPSPDDYLRAFEGAKNIFLVTITGTLSGSHNSAQLAKNIY
FT                   LEDHPDTKIHVIDSLSAGGEVDLLVEKLNDLIDQGLSFEEVVEAITAYQEKTKLLFVLA
FT                   KVDNLVKNGRLSKLIGTVVGLLNIRMVGKASETGTLELLQKARGSKKSVQAAYDELVKA
FT                   GYAGGRIVMAQRNNEKCCQQLSERIRETFPQADIKILPTSGLCSFYAEEGGLLMGYEID
FT                   "
FT   gene            687315..687872
FT                   /locus_tag="SPP_0754"
FT   CDS_pept        687315..687872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0754"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21627"
FT                   /protein_id="ACO21627.1"
FT                   /translation="MSERRISEKSLENLRKSNQESNLLTREAIETALLQLLEKKELTKI
FT                   SISELVKRAGVSRAAFYRNYDSKEEILESVFKRTVHNIMEQLHHYDLKTDLYLVWVHLF
FT                   REARKEARVIQLALDYHLEKIFVQAMQEFLEKYHGKSKGVSSYLHSFWSSAIVSVLLKW
FT                   IKDGMKVPAEKIADLGLPFFKK"
FT   gene            687891..688358
FT                   /locus_tag="SPP_0755"
FT   CDS_pept        687891..688358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0755"
FT                   /product="ComE operon protein 2"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21179"
FT                   /protein_id="ACO21179.1"
FT                   /translation="MTEKRLAWDEYFAAQALLIANRSTCKRAKVGAILVKDNKVISTGY
FT                   NGSVSGTEHCIDHECLVIEGHCVRTLHAEVNAILQGAERGVPKGFTAYVTHFPCLNCTK
FT                   QLLQVGCKRVVYINQYRMDDYAQYLYQEKGTELTHLPLETVQTALKEADLM"
FT   gene            688424..689074
FT                   /gene="upp"
FT                   /locus_tag="SPP_0756"
FT   CDS_pept        688424..689074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="SPP_0756"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01091"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21056"
FT                   /protein_id="ACO21056.1"
FT                   /translation="MKEGIPKMGKIEVINHPLIQHKLSILRRIDTSTKAFRELVDEIAM
FT                   LMGYEVLRDLPLEDVEIETPITKTVQKQLAGKKLAIVPILRAGIGMVDGLLSLVPAAKV
FT                   GHIGMYRDEETLQPVEYLVKLPEDIDQRQIFVVDPMLATGGSAILAVDSLKKRGASNIK
FT                   FVCLVSAPEGVKALQEAHPDVEIFTAALDERLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            689248..689838
FT                   /gene="clpP"
FT                   /locus_tag="SPP_0757"
FT   CDS_pept        689248..689838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SPP_0757"
FT                   /product="Clp protease"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by match to protein family HMM PF00574"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20312"
FT                   /db_xref="GOA:C1CJJ5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJJ5"
FT                   /protein_id="ACO20312.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNTLEKILAENSGQSME
FT                   KVHADAERDNWMSAHETLEYGFIDEIMANNSLN"
FT   gene            689917..690165
FT                   /locus_tag="SPP_0758"
FT   CDS_pept        689917..690165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0758"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21970"
FT                   /db_xref="GOA:C1CJJ6"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJJ6"
FT                   /protein_id="ACO21970.1"
FT                   /translation="MFEKVNRSGLIIYLYYNRDAKKLQDYGDITYHSKKHRYLQLYVPT
FT                   QEVEQLVGRLSKEKFIKKVRVCHIQELETPFVGNLYR"
FT   gene            690266..691426
FT                   /locus_tag="SPP_0759"
FT   CDS_pept        690266..691426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0759"
FT                   /product="ABC transporter substrate-binding
FT                   protein-branched chain amino acid transport"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21392"
FT                   /protein_id="ACO21392.1"
FT                   /translation="MKKKFALSFVALASVALLAACGEVKSGAVNTAGNSVEEKTIKIGF
FT                   NFEESGSLAAYGTAEQKGAQLAVDEINAAGGIDGKQIEVVDKDNKSETAEAASVTTNLV
FT                   TQSKVSAVVGPATSGATAAAVANATKAGVPLISPSATQDGLTKGQDYLFIGTFQDSFQG
FT                   KIISNYVSEKLNAKKVVLYTDNASDYAKGIAKSFRESYKGEIVADETFVAGDTDFQAAL
FT                   TKMKGKDFDAIVVPGYYNEAGKIVNQARGMGIDKPIVGGDGFNGEEFVQQATAEKASNI
FT                   YFISGFSTTVEVSAKAKAFLDAYRAKYNEEPSTFAALAYDSVHLVANAAKGAKNSGEIK
FT                   DNLAKTKDFEGVTGQTSFDADHNTVKTAYMMTMNNGKVEVAEVVKP"
FT   gene            complement(691513..691626)
FT                   /locus_tag="SPP_0760"
FT   CDS_pept        complement(691513..691626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0760"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21444"
FT                   /protein_id="ACO21444.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVVDKTDEVSHIYNPRRR"
FT   gene            691694..692563
FT                   /locus_tag="SPP_0761"
FT   CDS_pept        691694..692563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0761"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system permeaseprotein LivH (LIV-I protein H)"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20719"
FT                   /protein_id="ACO20719.1"
FT                   /translation="MLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAF
FT                   IGYFLINSFQMNFFVALIVAMLATAILGVVIEFLAYRPLRHSTRIAVLITAIGVSFLLE
FT                   YGMVYLVGANTRAFPQAIQTVRYDLGPISLTNVQLMILGISLILMILLQVIVQKTKMGK
FT                   AMRAVSVDSDAAQLMGINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTPGLK
FT                   SFVAAVLGGIGIIPGAALGGFVIGLLETFATAFGMSDFRDAIVYGILLLILIVRPAGIL
FT                   GKNVKEKV"
FT   gene            692567..693523
FT                   /locus_tag="SPP_0762"
FT   CDS_pept        692567..693523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0762"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-branched chain amino acid transport"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20565"
FT                   /protein_id="ACO20565.1"
FT                   /translation="MKENLKVNILWLLLLLAGYSLISVLVSVGVLNLFYVQILQQIGIN
FT                   IILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAIIGSKSPTYGAFFGAMLVGALLSGAV
FT                   ALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAGILGIPNFTTWQMVYFF
FT                   VVITTIATLNFLRSPIGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSLQ
FT                   AGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQDVASVRMII
FT                   YALALVLVMIFRPGGLLGTWELSLSRFFKKSKKEEQN"
FT   gene            693523..694287
FT                   /locus_tag="SPP_0763"
FT   CDS_pept        693523..694287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0763"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   ATP-binding proteinlivG (LIV-I protein G)"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21831"
FT                   /protein_id="ACO21831.1"
FT                   /translation="MALLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTL
FT                   FNLLTGVYEPSEGTVTLDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFG
FT                   NHHKQHVFTSFLRLPAFYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIV
FT                   RALATEPKILFLDEPAAGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERI
FT                   YVLEYGRLIAQGTPDEIKTNKRVIEAYLGGEA"
FT   gene            694287..694997
FT                   /locus_tag="SPP_0764"
FT   CDS_pept        694287..694997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0764"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   ATP-binding proteinlivF (LIV-I protein F)"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21156"
FT                   /protein_id="ACO21156.1"
FT                   /translation="MSMLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTI
FT                   LRTLSGLVRPSSGKIEFLGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAF
FT                   LKKNREENQANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEP
FT                   SMGLAPIFIQEIFDIIQDIQKQETTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKE
FT                   LASSEEVRKAYLGG"
FT   gene            695305..695961
FT                   /locus_tag="SPP_0765"
FT   CDS_pept        695305..695961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0765"
FT                   /product="AcuB family protein"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20573"
FT                   /protein_id="ACO20573.1"
FT                   /translation="MAVKDFMTRKVVYISPDTTVSHAADLMREQGLHRLPVIENDQLVG
FT                   LVTEGTIAQASPSKATSLSIYEMNYLLNKTKVKDVMIRDVVTVSGYASLEDATYLMLKN
FT                   KISILPVVDNHQVYGVITDRDVFQAFLEIAGYGEEGIRVRFVTEDEVGVLGKIVSLIVE
FT                   ENLNISHTVNIPRKDGKVIIEVQIDGSIDLPALKEKFEANGIQVEEIARTSAKVL"
FT   gene            696175..697164
FT                   /gene="prfB"
FT                   /locus_tag="SPP_0766"
FT   CDS_pept        696175..697164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="SPP_0766"
FT                   /product="peptide chain release factor 2"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM PF03462; match to protein
FT                   family HMM TIGR00020"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22089"
FT                   /protein_id="ACO22089.1"
FT                   /translation="MENKMTEPDFWNDNIAAQKTSQELNELKNTYNTFHKMEELQDEVE
FT                   ILLDFLAEDESVHDELVAQLAELDKIMTSYEMTLLLSEPYDHNNAILEIHPGSGGTEAQ
FT                   DWGDMLLRMYTRYGNAKGFKVEVLDYQAGDEAGIKSVTLSFEGPNAYGLLKSEMGVHRL
FT                   VRISPFDSAKRRHTSFTSVEVMPELDDTIEVEIREDDIKMDTFRSGGAGGQNVNKVSTG
FT                   VRLTHIPTGIVVQSTVDRTQYGNRDRAMKMLQAKLYQMEQDKKAAEVDSLKGEKKEITW
FT                   GSQIRSYVFTPYTMVKDHRTSFEVAQVDKVMDGDLDGFIDAYLKWRIS"
FT   gene            697182..697874
FT                   /gene="ftsE"
FT                   /locus_tag="SPP_0767"
FT   CDS_pept        697182..697874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="SPP_0767"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR02673"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21489"
FT                   /protein_id="ACO21489.1"
FT                   /translation="MSIIEMRDVVKKYDNGTTALRGVSVSVQPGEFAYIVGPSGAGKST
FT                   FIRSLYREVKIDKGSLSVAGFNLVKIKKKDVPLLRRSVGVVFQDYKLLPKKTVYENIAY
FT                   AMEVIGENRRNIKRRVMEVLDLVGLKHKVRSFPNELSGGEQQRIAIARAIVNNPKVLIA
FT                   DEPTGNLDPDNSWEIMNLLERINLQGTTILMATHNSQIVNTLRHRVIAIENGRVVRDES
FT                   KGEYGYDD"
FT   gene            697867..698793
FT                   /locus_tag="SPP_0768"
FT   CDS_pept        697867..698793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0768"
FT                   /product="cell division ABC transporter, permease protein
FT                   FtsX"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20329"
FT                   /protein_id="ACO20329.1"
FT                   /translation="MISRFFRHLFEALKSLKRNGWMTVAAVSSVMITLTLVAIFASVIF
FT                   NTAKLATDIENNVRVVVYIRKDVEDNSQTIEKEGQTVTNNDYHKVYDSLKNMSTVKSVT
FT                   FSSKEEQYEKLTEIMGDNWKIFEGDANPLYDAYIVEANTPNDVKTIAEDAKKIEGVSEV
FT                   QDGGANTERLFKLASFIRVWGLGIAALLIFIAVFLISNTIRITIISRSREIQIMRLVGA
FT                   KNSYIRGPFLLEGAFIGLLGAIAPSVLVFIVYQIVYQSVNKSLVGQNLSMISPDLFSPL
FT                   MIALLFVIGVFIGSLGSGISMRRFLKI"
FT   gene            699079..701259
FT                   /locus_tag="SPP_0769"
FT   CDS_pept        699079..701259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0769"
FT                   /product="pts system, iibc component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM PF00367; match to protein
FT                   family HMM PF02378; match to protein family HMM TIGR00826;
FT                   match to protein family HMM TIGR00830; match to protein
FT                   family HMM TIGR02003"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20893"
FT                   /protein_id="ACO20893.1"
FT                   /translation="MMKDTFKNVLSFEFWQKFGKALMVVIAVMPAAGLMISIGKSIVMI
FT                   NPTFTPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRIT
FT                   GTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAY
FT                   NKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQ
FT                   ETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGAAKGTQVFGQDPLW
FT                   LAWVTDLVNLKGTDTSQYQHLLDTVHPARFKVGQMIGSFGILMGVIVAIYRNVDADKKH
FT                   KYKGMMIATALATFLTGVTEPIEYMFMFIATPMYLVYSLVQGAAFAMADVVNLRMHSFG
FT                   SIEFLTRTPIAISAGIGMDIVNFVWVTVLFAVIMYFIANFMIQKFNYATPGRNGNYETA
FT                   EGSEETSSEVKVAAGSQAVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKA
FT                   EGAMGLVMKGQGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKNL
FT                   TEEVYSVADGQVVGLEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAF
FT                   GIVTEAGLEVLVHIGLDTVSLEGKPFTVHVAEGQKVAAGDLLVTADLDAIRAAGRETST
FT                   VVVFTNGDAIKSVKLEKTGSLAAKTAVAKVEL"
FT   gene            701311..702126
FT                   /locus_tag="SPP_0770"
FT   CDS_pept        701311..702126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0770"
FT                   /product="metal-dependent hydrolase"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21198"
FT                   /protein_id="ACO21198.1"
FT                   /translation="MKFLTLNTYSWMEKEAEEKFQILLEDILEKDYDLICFQEINQEMT
FT                   SSEVEVNDLYQALPAAEPIHQDHYVRLLVEKLLEQGKNYYWTWAYNHIGYDRYHEGVAI
FT                   LSKTPIEAREILVSDVDDPTDYHTRRVALAETVVDGKELAVASVHLSWWDKGFQEEWAR
FT                   FEAVLKKLNKPLLLAGDFNNPAGQEGYQAILASPLGLQDAFEVAQEKSGSYTVPPEIDG
FT                   WKGNTEPLRIDYVFTTKELAVENLHVVFDGNKSPQVSDHYGLNAILNWK"
FT   gene            702266..703609
FT                   /locus_tag="SPP_0771"
FT   CDS_pept        702266..703609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0771"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21800"
FT                   /protein_id="ACO21800.1"
FT                   /translation="MSFTKFQFKNYIREALKELKFTTPTEVQDKLIPIVLAGRDLVGES
FT                   KTGSGKTHTFLLPIFQQLDEASDSVQAVITAPSRELATQIYQVARQISAHSDVEVRVVN
FT                   YVGGTDKARQIEKLASNQPHIVIGTPGRIYDLVKSGDLAIHKAKTFVVDEADMTLDMGF
FT                   LETVDKIADSLPKDLQFMVFSATIPQKLQPFLKKYLSNPVMEKIKTKTVISDTIDNWLI
FT                   STKGHDKNAQIYQLTQSMQPYLAMIFVNTKTRADELHSYLTAQGLKVAKIHGDIAPRER
FT                   KRIMNQVQNLDFEYIVATDLAARGIDIEGVSHVINDAIPQDLSFFVHRVGRTGRNGLPG
FT                   TAITLYQPSDDSDIRELEKLGIKFSPKMVKDGEFQDTYDRDRRANREKKQDKLDIEMIG
FT                   LVKKKKKKVKPGYKKKIQWAVDEKRRKTKRAENRARGRAERKAKRQTF"
FT   gene            703986..705176
FT                   /gene="metK"
FT                   /locus_tag="SPP_0772"
FT   CDS_pept        703986..705176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="SPP_0772"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21467"
FT                   /db_xref="GOA:C1CJL0"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJL0"
FT                   /protein_id="ACO21467.1"
FT                   /translation="MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAET
FT                   AVYTGSVHVFGEISTNAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDI
FT                   AQGVNEALEVRGNADQDPLDLIGAGDQGLMFGFAVDETEELMPLPIALSHKLVRRLAEL
FT                   RKSGEISYLRPDAKSQVTVEYDENDRPVRVDTVVISTQHDPEATNEQIHQDVIDKVIKE
FT                   VIPSSYLDDKAKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDAT
FT                   KVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVAQPVSVRIDTFGTGTVAESQLEK
FT                   AARQIFDLRPAGIIQMLDLKRPIYRQTSAYGHMGRTDIDLPWERLDKVDALKEAVK"
FT   gene            705729..706664
FT                   /locus_tag="SPP_0773"
FT   CDS_pept        705729..706664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0773"
FT                   /product="dihydroorotate dehydrogenase (dihydroorotate
FT                   oxidase)(dhodehase) (dhodase) (dhod)"
FT                   /EC_number="1.3.98.1"
FT                   /note="identified by match to protein family HMM PF01180;
FT                   match to protein family HMM TIGR01037"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22015"
FT                   /protein_id="ACO22015.1"
FT                   /translation="MVSTKTQIAGFEFDNCLMNAAGVACMTIEELEEVKNSAAGTFVTK
FT                   TATLDFRQGNPEPRYQDVPLGSINSMGLPNNGLDYYLDYLLDLQEKESNRTFFLSLVGM
FT                   SPEETHTILKKVQESDFRGLTELNLSCPNVPGKPQIAYDFETTDRILAEVFAYFTKPLG
FT                   IKLPPYFDIVHFDQAAAIFNKYPLKFVNCVNSIGNGLYIEDESVVIRPKNGFGGIGGEY
FT                   IKPTALANVHAFYQRLNPQIQIIGTGGVLTGRDAFEHILCGASMVQVGTTLHKEGVSAF
FT                   DRITNELKAIMVEKGYESLEDFRGKLRYID"
FT   gene            706698..707735
FT                   /gene="holA"
FT                   /locus_tag="SPP_0774"
FT   CDS_pept        706698..707735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="SPP_0774"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF06144;
FT                   match to protein family HMM TIGR01128"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20323"
FT                   /protein_id="ACO20323.1"
FT                   /translation="MLAIEESQKLTLSNLPSLSLFTGTDQGQFEVMKSQMLKQIGYDSA
FT                   DLNFAYFDMKEVVYKDVELELVSLPFFADEKIVILDYFMDITTAKKRFLTDDELKSFEE
FT                   YLDNPSPTTKLIIFAEGKLDSKRRLVKLLKRDAKVFDAVEVKEQELRQYFQKWSQKQGL
FT                   QFTNHSFENLLIKSGFQFSEIQKNLLFLQSYKANSVIEEEDIVNAIPKTLQDNIFDLTQ
FT                   FILTKKMDQARDLVRDLTLQGEDEIKLIAVMLGQFRTFTQVKILAESGQTESQIASSLG
FT                   SYLGRNPNPYQIKFALRDSRGLSLSFLKQAISYLIETDYQIKTGLYEKGFLFEKALLQI
FT                   ASQVN"
FT   gene            707908..708513
FT                   /locus_tag="SPP_0775"
FT   CDS_pept        707908..708513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0775"
FT                   /product="superoxide dismutase [Mn] (General stress protein
FT                   24)(GSP24)"
FT                   /EC_number="1.15.1.1"
FT                   /note="identified by match to protein family HMM PF00081;
FT                   match to protein family HMM PF02777"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20810"
FT                   /protein_id="ACO20810.1"
FT                   /translation="MAIILPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEK
FT                   HPEIGEDLEALLADVESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAID
FT                   ATFGSFEEFQAAFTAAATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLD
FT                   VWEHAYYVKYRNVRPDYIKAFFSVINWNKVDELYAAAK"
FT   gene            708669..709199
FT                   /locus_tag="SPP_0776"
FT   CDS_pept        708669..709199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0776"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF06265"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21730"
FT                   /protein_id="ACO21730.1"
FT                   /translation="MRKEIAPELYNYNKFPGPEFHLHGDKVETEGIAFSLVENIKDAFD
FT                   VTTFNQRFSEVLTKFDYIVGDWSNEQLRLRGFYKDDRTEEKLEKISRLQDYLLEYCSYG
FT                   CAYFVLENEAPKRASFDKKMRKTEEETPSRKGKKPTQTKRKSNADKKNRRRQKDQHSQK
FT                   EDKEQRHFVIRQK"
FT   gene            709220..710305
FT                   /locus_tag="SPP_0777"
FT   CDS_pept        709220..710305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0777"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00048"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20318"
FT                   /db_xref="GOA:C1CJL5"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJL5"
FT                   /protein_id="ACO20318.1"
FT                   /translation="MKPSIHSLTHQTMQEWVLEQGEKKFRADQIWEWLYRKRVQSFEEM
FT                   TNLSKDLIAKLNDQFVVNPLKQGIVQESADGTVKYLFELPDGMLIETVLMCQHYGLSVC
FT                   VTTQVGCNIGCTFCASGLIKKQRDLNNGEIVAQIMLVQKYFDERGQDERISHIVVMGIG
FT                   EPFDNYNNVLNFFRTINDDKGMAIGARHITVSISGLAHKIRDFADEGVQVNLAVSLHAP
FT                   NNELRSSIMKINRAFPIEKLFAAIEYYIETTNRRVTFEYIMLNEVNDGVEQALELAELL
FT                   KNIKKSSYVNLIPYNPVSEHDQYSRSPKERVLAFYDTLKKKGGNCVVRQEHGTDIDAAC
FT                   GQLLFNTMKRDRQKAVAAVNP"
FT   gene            710305..710787
FT                   /locus_tag="SPP_0778"
FT   CDS_pept        710305..710787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0778"
FT                   /product="VanZ family protein"
FT                   /note="identified by match to protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21579"
FT                   /protein_id="ACO21579.1"
FT                   /translation="MMKKTYNHILVWGVIFYSICIVYFCFTPQEQSTVGVGTPDIQHLG
FT                   RLVFLLTPFNSLWKLGEVSDIGQLCWIFLQNILNVFLFFPLIFQLLYLFPNLRKTKKVL
FT                   LFSFLVSLGIECTQLILDFFFDFNRVFEIDDLWTNTLGGYLAWLLYKRLHKNKIRN"
FT   gene            710789..712330
FT                   /locus_tag="SPP_0779"
FT   CDS_pept        710789..712330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0779"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20367"
FT                   /protein_id="ACO20367.1"
FT                   /translation="MSILEVKNLSHGFGDRAIFEDVSFRLLKGEHIGLVGANGEGKSTF
FT                   MSIVTGKMLPDEGKVEWSKYVTAGYLDQHSVLAERQSVRDVLRTAFDELFKAEARINDL
FT                   YMEMAEDGADVDALMEEVGELQDRLESRDFYTLDAKIDEVARALGVMDFGMDTDVTSLS
FT                   GGQRTKVLLAKLLLEKPDILLLDEPTNYLDAEHIDWLKRYLQNYENAFVLISHDIPFLN
FT                   DVINIVYHVENQQLTRYSGDYYQFQEVYAMKKSQLEAAYERQQKEIADLKDFVARNKAR
FT                   VATRNMAMSRQKKLDKMDIIELQSEKPKPSFDFKPARTPGRFIFQTKNLQIGYDLPLTK
FT                   PLNLTFERNQKVAIIGANGIGKTTLLKSLLGIISPIAGEVERGDYLELGYFEQEVEGGN
FT                   RQTPLEAVWNAFPALNQAEVRAALARCGLTTKHIESQIQVLSGGEQAKVRFCLLMNREN
FT                   NVLVLDEPTNHLDVDAKDELKRALKEYRGSILMVCHEPDFYEGWIDQIWDFNNLT"
FT   gene            complement(712386..713189)
FT                   /locus_tag="SPP_0780"
FT   CDS_pept        complement(712386..713189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0780"
FT                   /product="peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin-type"
FT                   /note="identified by match to protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20655"
FT                   /protein_id="ACO20655.1"
FT                   /translation="MKKLATLLLLSTVALAGCSSVQRSLRGDDYVDSSLAAEESSKVAA
FT                   QSAKELNDALTNENANFPQLSKEVAEDEAEVILHTSQGDIRIKLFPKLAPLAVENFLTH
FT                   AKEGYYNGITFHSVIDGFMVQTGDPKGDGTGGQSIWHDKDKTKDKGTGFKNEITPYLYN
FT                   IRGALAMANTGQPNTNGSQFFINQSSTDTSSKLPTSKYPQKIIEAYKEGGNPSLDGKHP
FT                   VFGQVIDGMDVVDKIAKAEKDEKDKPTTAITIDSIEVVKDYDFKS"
FT   gene            complement(713272..713493)
FT                   /locus_tag="SPP_0781"
FT   CDS_pept        complement(713272..713493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0781"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21123"
FT                   /protein_id="ACO21123.1"
FT                   /translation="MSFYGLFYNGIAITPNTYLSAWFVNFIAALPLNFLIVEPIARFIL
FT                   SSFQKPFTGEEVEEVEDFQDDDEIPTII"
FT   gene            complement(713972..714181)
FT                   /locus_tag="SPP_0782"
FT   CDS_pept        complement(713972..714181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0782"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21283"
FT                   /protein_id="ACO21283.1"
FT                   /translation="MLSVNTILEKFYKEHQVKPFISPERELDTWLLSPKPVPKRNMDLL
FT                   VDDSLAGDIILLWRIQFGTFTTET"
FT   gene            714351..714623
FT                   /gene="rpsP"
FT                   /locus_tag="SPP_0783"
FT   CDS_pept        714351..714623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="SPP_0783"
FT                   /product="ribosomal protein S16"
FT                   /note="identified by match to protein family HMM PF00886;
FT                   match to protein family HMM TIGR00002"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21740"
FT                   /db_xref="GOA:C1CJM1"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJM1"
FT                   /protein_id="ACO21740.1"
FT                   /translation="MAVKIRLTRMGSKKKPFYRINVADSRSPRDGRFIETVGTYNPLVA
FT                   ENQVTLKEDRVLAWLANGAQPSDTVRNILSKEGVLKKFHDSKFSK"
FT   gene            714643..714882
FT                   /locus_tag="SPP_0784"
FT   CDS_pept        714643..714882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0784"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21314"
FT                   /protein_id="ACO21314.1"
FT                   /translation="MDTIENLIIAIVKPLISQPDALTIKIEDTPEFLEYHLNLDQSDVG
FT                   RVIGRKGRTISAIRTIVYSVPTEYKKVRIVIDEK"
FT   gene            715459..716247
FT                   /locus_tag="SPP_0785"
FT   CDS_pept        715459..716247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0785"
FT                   /product="hydrolase, alpha/beta fold family, putative"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21773"
FT                   /protein_id="ACO21773.1"
FT                   /translation="MKRFEVSTEIGSLSVTYQKQKKVLVCLNGAGLLPSYENFSLILEK
FT                   PPPTIGYLTIDFPNTGRSPIHDQAGKNLDNLADAVYEVLEELGISEYILCAHSWSGILA
FT                   CKLLEKPIKRQTLVAIEPTTKKVMFADFSENPYPEMEEQMRLIDECGPELYFKNLTQAT
FT                   FSPETNKKIWELMQEKGLELENQDPEFQISGEITEEDFENLSIESHVPVFIFCQTYREK
FT                   EYRESEYWTSNTKLILGRNHHYLQWSESEKIAAIIRELSE"
FT   gene            716278..716796
FT                   /gene="rimM"
FT                   /locus_tag="SPP_0786"
FT   CDS_pept        716278..716796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="SPP_0786"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by match to protein family HMM PF01782;
FT                   match to protein family HMM PF05239; match to protein
FT                   family HMM TIGR02273"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20382"
FT                   /db_xref="GOA:C1CJM4"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJM4"
FT                   /protein_id="ACO20382.1"
FT                   /translation="MNYFNVGKIVNTQGLQGEMRVLSVTDFAEERFKKGAELALFDEKD
FT                   QFVQTVTIASHRKQKNFDIIKFKDMYHINTIEKYKGYSLKVAEEDLNDLDDGEFYYHEI
FT                   IGLEVYEGDSLVGTIKEILQPGANDVWVVKRKGKRDLLLPYIPPVVLNVDIPNKRVDVE
FT                   ILEGLDDED"
FT   gene            716786..717505
FT                   /gene="trmD"
FT                   /locus_tag="SPP_0787"
FT   CDS_pept        716786..717505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="SPP_0787"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01746;
FT                   match to protein family HMM TIGR00088"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20838"
FT                   /db_xref="GOA:C1CJM5"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJM5"
FT                   /protein_id="ACO20838.1"
FT                   /translation="MKIDILTLFPEMFSPLEHSIVGKAREKGLLDIQYHNFRENAEKAR
FT                   HVDDEPYGGGQGMLLRAQPIFDSFDAIEKKNPRVILLDPAGKQFDQVYAEDLAQEEELI
FT                   FICGHYEGYDERIKTLVTDEISLGDYVLTGGELAAMTMIDATVRLIPEVIGKESSHQDD
FT                   SFSSGLLEYPQYTRPYDYRGMVVPDVLMSGHHEKIRQWRLYESLKKTYERRPDLLEHYQ
FT                   LTVEEEKMLAEIKENKE"
FT   gene            717517..717855
FT                   /locus_tag="SPP_0788"
FT   CDS_pept        717517..717855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0788"
FT                   /product="oxygen-sensitive ribonucleoside-triphosphate
FT                   reductase"
FT                   /note="identified by match to protein family HMM PF03477"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20324"
FT                   /protein_id="ACO20324.1"
FT                   /translation="MQVIKRNGEIAEFNPDKIYQAILKAAQTVYVLTDDLRQNLAQVTK
FT                   KVVLDLQEAKVERATISMIQSMVEHRLLGAGYITIAEHYISYRLQRDLERSGYGDHIAV
FT                   HLHFEQIR"
FT   gene            complement(717886..718206)
FT                   /locus_tag="SPP_0789"
FT   CDS_pept        complement(717886..718206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0789"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21823"
FT                   /protein_id="ACO21823.1"
FT                   /translation="MRHKFQQVLNKIHDFLNGYDQPDQTETNSLTATIEEAIQKQTAVH
FT                   LILSETSFTGDIIKYDQQGQQIIVKNFAKNVSRIIRISDIQRLRFVPSTVQTAQKNRFK
FT                   KE"
FT   gene            718304..718519
FT                   /locus_tag="SPP_0791"
FT   CDS_pept        718304..718519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0791"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21188"
FT                   /protein_id="ACO21188.1"
FT                   /translation="MAEFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSP
FT                   DHTKMGKGITLSNEEFQTMVDAFKGN"
FT   gene            complement(718516..718662)
FT                   /locus_tag="SPP_0790"
FT   CDS_pept        complement(718516..718662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0790"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21237"
FT                   /protein_id="ACO21237.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVVDETDEVSNHTYGKAKLTRFEEIF
FT                   EEY"
FT   gene            complement(718725..719261)
FT                   /locus_tag="SPP_0792"
FT   CDS_pept        complement(718725..719261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0792"
FT                   /product="biotin synthase"
FT                   /note="identified by match to protein family HMM PF02632"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20570"
FT                   /protein_id="ACO20570.1"
FT                   /translation="MKKAHVYAIPAIGAALIAVLAQISLPIGPVPFTLQNFAIGLIATV
FT                   FRPREAVLSAGLYLLLGAIGLPVFAGGGAGFQALVGPTAGYLWFYLVYSGLTSSLTNSK
FT                   SGVVKIFLANLLGDALVFVGGILSLHFLAGMAFEKALAVGVLPFIIPDLGKLLAISFIS
FT                   RPLLQRLKNQAYFTN"
FT   gene            complement(719457..720803)
FT                   /gene="gor"
FT                   /locus_tag="SPP_0793"
FT   CDS_pept        complement(719457..720803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="SPP_0793"
FT                   /product="glutathione-disulfide reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF02852; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR01421"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22090"
FT                   /protein_id="ACO22090.1"
FT                   /translation="MREYDIIAIGGGSGGIATMNRAGEHGAKAAVIEEKKLGGTCVNVG
FT                   CVPKKIMWYGAQIAETFHQFGEDYGFKTTDLNFDFATLRRNREAYIDRARSSYDSSFKR
FT                   NGVDLIEGHAEFVDSHTVSVNGELIRAKHIVIATGAHPSIPNIPGAELGGSSDDVFAWE
FT                   ELPESVAILGAGYIAVELAGVLHTFGVKTDLFVRRDRPLRGFDSYIVEGLVKEMERINL
FT                   PLHTHKVPAKLEKTAKGITIHFEDGTSHTASQVIWATGRRPNVKSLQLEKAGVTLNERG
FT                   FIQVDEYQNTVVEGIYALGDVTGEKELTPVAIKAGRTLSERLFNGKTTAKMDYSTIPTV
FT                   VFSHPAIGTVGLTEEQAIKEYGQDQIKVYKSSFTSMYSACTCNRQETRFKLITAGSEEK
FT                   VVGLHGIGYGVDEMIQGFAVAIKMRATKADFDATVAIHPTSSEEFVTMR"
FT   gene            721068..722267
FT                   /locus_tag="SPP_0794"
FT   CDS_pept        721068..722267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0794"
FT                   /product="membrane-fusion protein"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20896"
FT                   /protein_id="ACO20896.1"
FT                   /translation="MKKKNGKAKKWQLYAAIGAASVVVLGAGGILLFRQPSQTAVKDEP
FT                   THLVVAKEGSVASSVLLSGTVTAKNEQYVYFDASKGDLDEILVSVGDKVSEGQALVKYS
FT                   SSEAQAAYDSASRAVAKADRHINELNQARNEAASAQAPQLPAPVGGEDATVQSPTPVAG
FT                   NSVASIDAQLGDARDARADAAAQLSKAQSQLDATTVLSTLEGTVVEVNSNVSKSPTGAS
FT                   QVMVHIVSNENLQVKGELSEYNLANLSVGQEVSFTSKVYPDKKWTGKLSYISDYPKNNG
FT                   EAASPAAGNNTGSKYPYTIDVTGEVGDLKQGFSVNIEVKSKTKAILVPVSSLVMDDSKN
FT                   YVWIVDEQQKAKKVEVSLGNADAENQEITSGLTNGAKVISNPTSSLEEGKEVKADEATN
FT                   "
FT   gene            722251..722952
FT                   /locus_tag="SPP_0795"
FT   CDS_pept        722251..722952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0795"
FT                   /product="macrolide export ATP-binding/permease protein
FT                   MacB"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20341"
FT                   /protein_id="ACO20341.1"
FT                   /translation="MKQLISLKNIFRSYRNGDQELQVLKNINLEVNEGEFVAIMGPSGS
FT                   GKSTLMNTIGMLDTPTSGEYYLEGQEVAGLGEKQLAKVRNQQIGFVFQQFFLLSKLNAL
FT                   QNVELPLIYAGVSSSKRRKLAEEYLDKVELTERSHHLPSELSGGQKQRVAIARALVNNP
FT                   SIILADEPTGALDTKTGNQIMQLLVDLNKEGKTIIMVTHEPEIAAYAKRQIVIRDGVIS
FT                   SDSAQLGKEEN"
FT   gene            722954..724213
FT                   /locus_tag="SPP_0796"
FT   CDS_pept        722954..724213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0796"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21847"
FT                   /protein_id="ACO21847.1"
FT                   /translation="MQNLKFAFSSIMAHKMRSLLTMIGIIIGVSSVVVIMALGDSLSRQ
FT                   VNKDMTKSQKNISVFFSPKKSKDGSFTQKQSAFTVSGKEEEVPVEPPKPQESWVQEAAK
FT                   LKGVDSYYVTNSTNAILTYQDKKVENANLTGGNRTYMDAVKNEIIAGRSLREQDFKEFA
FT                   SVILLDEELSISLFESPQEAINKVVEVNGFSYRVIGVYTSPEAKRSKIYGFGGLPITTN
FT                   ISLAANFNIDEIASIVFRVNDTSLTPTLGPELARKMTELAGLQQGEYQVADESVVFAEI
FT                   QQSFSFMTTIISSIAGISLFVGGTGVMNIMLVSVTERTREIGLRKALGATRANILIQFL
FT                   IESMILTLLGGLIGLTIASGLTALAGLLLQGLIEGIEVGVSIPVALFSLAVSASVGMIF
FT                   GVLPANKASKLDPIEALRYE"
FT   gene            724337..726334
FT                   /gene="metG"
FT                   /locus_tag="SPP_0797"
FT   CDS_pept        724337..726334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="SPP_0797"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM PF09334; match to protein
FT                   family HMM TIGR00398; match to protein family HMM
FT                   TIGR00399"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21638"
FT                   /protein_id="ACO21638.1"
FT                   /translation="MSEKNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVF
FT                   YLTGLDEHGQKIQQKAEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKV
FT                   VAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVE
FT                   WVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFIEPGLEDLAVSRTTFTW
FT                   GVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWNGTVFHMVGKDILRFHSIY
FT                   WPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNL
FT                   PVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLA
FT                   EVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVM
FT                   SHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPADVTVVAKGTPIF
FT                   PRLNMEEEITYIKEQMEGNKPAVEKEWNPDEVELKLNKDEIKFEDFDKVEIRVAEVKEV
FT                   SKVEGSDKLLQFRLDAGDGEDRQILSGIAKYYPNEQELVGKKVQIVANLKPRKMMKKYV
FT                   SQGMILSAEHDGKLTLLTVDPAVPNGSVIG"
FT   gene            726755..727075
FT                   /locus_tag="SPP_0798"
FT   CDS_pept        726755..727075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0798"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21335"
FT                   /protein_id="ACO21335.1"
FT                   /translation="MKETQLLKGVLEGCVLDMIGQKERYGYELVQTLREAGFDTIVPGT
FT                   IYPLLQKLEKNQWIRGDMRPSPDGPDRKYFSLMKEGEERVSVFWQQWDDLSQKVEGIKN
FT                   GG"
FT   gene            727079..727894
FT                   /locus_tag="SPP_0799"
FT   CDS_pept        727079..727894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0799"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20998"
FT                   /protein_id="ACO20998.1"
FT                   /translation="MKKMKYYEETSALLHEFSEENQKYFEELWESFNLAGFLYDEDYLR
FT                   EQIYLMMLDFSEAERDGMSAEDYLGKNPKKIMKEILKGAPRSSIKESLLTPILVLAVLR
FT                   YYQLLSDFSKGPLLTVNLLTFLGQLLIFLIGFGLVATILRRSLVQDSPKMKIGTYIVVG
FT                   TIVLLVVLGYVGMASFIQEGAFYIPAPWDSLSVFTISLVICIWNWKEAVFRPFVSMIIA
FT                   HLVVGSLLRYYEWMGISNVFLTKVIPLAVLFIGIFVLFRGFKKIKWSEV"
FT   gene            727969..728895
FT                   /locus_tag="SPP_0800"
FT   CDS_pept        727969..728895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0800"
FT                   /product="oxidoreductase, aldo/keto reductase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20630"
FT                   /protein_id="ACO20630.1"
FT                   /translation="MRYITLGQDDKELSEIVLGMMRIKDKSVKEVEELVETALSVGINA
FT                   FDLADIYGRGRCEELLGLVLKNRPDLREKMWIQSKCGIRIEEFTYFDFSKDYIIKSVDG
FT                   ILQRLKIDHLDSLLLHRPDALMESDQVAEAFDLLYKQGKVRDFGVSNQNPMMMELLKKD
FT                   VKQPLAVNQLQLSAAFTPGFESAFHVNMEDSQAAMRDGSIFEYCQLHDVVIQAWSVLQF
FT                   GYFKGNFVGNEKFQALNQVLDRLAIKYGVTSSTIAISWILRYPAKMQAVVGTTNPKHLR
FT                   EVSQAANFSLTRKEWYEIYLAAGNNLP"
FT   gene            728995..729231
FT                   /locus_tag="SPP_0801"
FT   CDS_pept        728995..729231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22125"
FT                   /protein_id="ACO22125.1"
FT                   /translation="MTFEEILPGLKAKKKYVRTGWGGAENYVQLFDTIEQNGLALEVTP
FT                   YFLINVSGEGEGFSMWSPTACDVLATDWVEVHD"
FT   gene            729224..729922
FT                   /locus_tag="SPP_0802"
FT   CDS_pept        729224..729922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0802"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21849"
FT                   /protein_id="ACO21849.1"
FT                   /translation="MTKRVLITGVSSGIGLAQARLFLEKGYQVYGVDQGEKPLLEGDFH
FT                   FLQRDLTLDLEPIFDWCPQVDVLCNTAGVLDDYKPLLEQTAQDIQEIFEINYIIPVELT
FT                   RYYLTQMLENKKGIIINMCSIASSLAGGGGHAYTSSKHALAGFTKQLALDYAEAGIQVF
FT                   GIAPGAVKTAMTAADFEPGGLADWVASETPIKRWIEPEEIAELSLFLASGKASAMQGQI
FT                   LTIDGGWSLK"
FT   gene            729933..730433
FT                   /locus_tag="SPP_0803"
FT   CDS_pept        729933..730433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0803"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21251"
FT                   /protein_id="ACO21251.1"
FT                   /translation="MEIKKHFGVYAVCLENGKLLCIEKTRGPYQHRYDLPGGSQQLGEG
FT                   LTETLTREVMEETGFTVRSYSNPRIYDVFVREELKNFMVHHVMALYDVEMNESAPQVTI
FT                   SEAVSDGANDSLGYIWMDIQEITEENASPLVFKVKSELLGFPELDKTSYMNWKVNDEKS
FT                   TCP"
FT   gene            730411..731280
FT                   /locus_tag="SPP_0804"
FT   CDS_pept        730411..731280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0804"
FT                   /product="PEP-utilizing enzyme family protein"
FT                   /note="identified by match to protein family HMM PF02896"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20884"
FT                   /protein_id="ACO20884.1"
FT                   /translation="MRNQLALSGEKILEKIYPQLFHHVGMIRGEYLLRELNQNIILASC
FT                   QQFVKDYLETICSLYSDEEVWYRFTELTNTEANCLVGTKEFFDEGHPLFGYRGTRRLLA
FT                   CLDEFQAEAHVVTEVYQTNPNLSVIFPFVNDADQLKQAITVLRQYGFTGKVGTMIELPS
FT                   AYFDLSSILETGISKIVVGMNDLTSFVFATMRNSQWHDMESPIMLDMLRDMQDKARKNK
FT                   INFAVAGYLNTSFIQKMNQLGIKCIIHYSSIPEIFDLEIDHPDHLKHIKEESKKLQRST
FT                   HDTARNVE"
FT   gene            731255..731695
FT                   /locus_tag="SPP_0805"
FT   CDS_pept        731255..731695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0805"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06171"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20278"
FT                   /protein_id="ACO20278.1"
FT                   /translation="MTPQEMWNKYKQINPLIGDEIDAWAFGVEPDLLADLVFKGEKTAT
FT                   ASAYDLYVLEDEPLPQVGTFDVILDSQNQAVCIVEITKVSVELFNQVSAQHAFKEGEGD
FT                   KSLAYWRQVHEDFFTDCLGEVGLTFTPESKVVLEEFRKVYPL"
FT   gene            731818..734364
FT                   /locus_tag="SPP_0806"
FT   CDS_pept        731818..734364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0806"
FT                   /product="aminopeptidase N"
FT                   /note="identified by match to protein family HMM PF01433"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22128"
FT                   /protein_id="ACO22128.1"
FT                   /translation="MQAVEHFIKQFVPEHYDLFLDLSRETKTFSGKVTITGQAQSDRIS
FT                   LHQKDLEITSVEVAGQARPFTVDHDNEALHIELAEAGQVELVLAFSGKITDNMTGIYPS
FT                   YYTVDGVKKEVLSTQFESHFAREAFPCVDEPEAKATFDLSLRFDQAEGELALSNMPEID
FT                   VENRKETGIWKFETTPRMSSYLLAFVAGDLQGVTAKTKNGTLVGVYSTKAHPLSNLDFS
FT                   LDIAVRSIEFYEDYYGVKYPIPQSLHIALPDFSAGAMENWGLVTYREVYLVVDENSTFA
FT                   SRQQVALVVAHELAHQWFGNLVTMKWWDDLWLNESFANMMEYVCVDTIEPSWNIFEDFQ
FT                   TGGVPLALERDATDGVQSVHVEVKHPDEINTLFDGAIVYAKGSRLMHMLRRWLGDADFA
FT                   KGLHAYFEKHQYSNTIGSDLWDALGQASGRDVAAFMDSWLEQPGYPVLTVKVENDVLKI
FT                   SQKQFFIGENEDKNRLWVVPLNSNWKGLPDTLETESIEIPGYAALLAENEGALRLNTEN
FT                   TAHYITDYQGDLLEAVLAELETLDNTSKLQIVQERRLLAEAGHISYADLLPVLDKLAKE
FT                   ESYLVVSAVSQVISALERFIDEGTDAETAFKGLVAKLARHNYDRLGFEAKDGESDEDEL
FT                   VRQLAVSMMIRSNDAEASQVASQIFATHKENLAGLPAAIRSQVLINEMKHHETKDLLAL
FT                   YLDTYTHATDAVFKRQLAAALAYSTDADNIQNLITSWKDKFVVKPQDLSAWYYQFLAHQ
FT                   ATQKTAWSWARENWAWIKAALGGDMSFDSFVILPAHVFKTQQRLAEYKEFFEPQLSDLA
FT                   LSRNIGMGIKEIAARVDLISREKAAVEAVVLQYGNA"
FT   gene            734473..735147
FT                   /locus_tag="SPP_0807"
FT   CDS_pept        734473..735147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0807"
FT                   /product="transcriptional regulatory protein CiaR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21701"
FT                   /protein_id="ACO21701.1"
FT                   /translation="MIKILLVEDDLGLSNSVFDFLDDFADVMQVFDGEEGLYEAESGVY
FT                   DLILLDLMLPEKNGFQVLKELREKGITTPVLIMTAKESLDDKGHGFELGADDYLTKPFY
FT                   LEELKMRIQALLKRSGKFNENTLTYGNIVVNLSTNTVKVEDTPVELLGKEFDLLVYFLQ
FT                   NQNVILPKTQIFDRLWGFDSDTTISVVEVYVSKVRKKLKGTTFAENLQTLRSVGYLLKD
FT                   VQ"
FT   gene            735137..736471
FT                   /locus_tag="SPP_0808"
FT   CDS_pept        735137..736471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0808"
FT                   /product="sensor protein CiaH"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21103"
FT                   /protein_id="ACO21103.1"
FT                   /translation="MFSKLKKTWYADDFSYFIRNFGVFTLIFSTMTLIILQVMHSSLYT
FT                   SVDDKLHGLSENPQAVIQLAINRATEEIKDLENARADASKVEIKPNVSSNTEVILFDKD
FT                   FTQLLSGNRFLGLDKIKLEKKELGHIYQIQVFNSYGQEEIYRVILMETNISSVSTNIKY
FT                   AAVLINTSQLEQASQKHEQLIVVVMASFWILSLLASLYLARVSVRPLLESMQKQQSFVE
FT                   NASHELRTPLAVLQNRLETLFRKPEATIMDVSESIASSLEEVRNMRFLTTSLLNLARRD
FT                   DGIKPELAEVPTSFFNTTFTNYEMIASENNRVFRFENRIHRTIVTDQLLLKQLMTILFD
FT                   NAVKYTEEDGEIDFLISATDRNLYLLVSDNGIGISTEDKKKIFDRFYRVDKARTRQKGG
FT                   FGLGLSLAKQIVDALKGTVTVKDNKPKGTIFEVKIAIQTPSKKKK"
FT   gene            complement(736505..736792)
FT                   /locus_tag="SPP_0809"
FT   CDS_pept        complement(736505..736792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0809"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21499"
FT                   /protein_id="ACO21499.1"
FT                   /translation="MPVRKLQSYEVDYQEELNQQLPHYQAYTPEAQSDANLKEILFFIN
FT                   IAVFCICIAIFSFIFLALKLSTALAFAAAIGFSLLVLKVQRSIIKRKRRR"
FT   gene            736932..737861
FT                   /locus_tag="SPP_0810"
FT   CDS_pept        736932..737861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0810"
FT                   /product="protease"
FT                   /note="identified by match to protein family HMM PF01136"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21213"
FT                   /protein_id="ACO21213.1"
FT                   /translation="MEKIVITATAESIEQVEQLLEAGVDRIYVGEKDFGLRLPTTFSYD
FT                   QLREIAKLVHDAGKELIVAVNALMHQDMMDRIKPFLDFLEEIKTDYITIGDAGVFYVVN
FT                   RDGYSFKTIYDASTMVTSSRQINFWGQKAGASEAVLAREIPSAELFKMPEILEIPAEVL
FT                   VYGASVIHHSKRPLLQNYYNFTHIDDEKTHKRDLFLAEPSDPESHYSIFEDNHGTHIFA
FT                   NNDLDLMIKLTELVEHGFTRWKLEGLYTPGQNFVEIAKLFIQARNLIQEGNFSHDQAFL
FT                   LDEEVRKLHPKNRFLDTGFYDYDPDMVK"
FT   gene            738061..740511
FT                   /locus_tag="SPP_0811"
FT   CDS_pept        738061..740511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0811"
FT                   /product="DnaQ family exonuclease/DinG family helicase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM TIGR00573; match to protein
FT                   family HMM TIGR01407"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20566"
FT                   /protein_id="ACO20566.1"
FT                   /translation="MKTIGNRYVVVDLEATSTGSKAKIIQVGIVVIEDGEIVDHYTTDV
FT                   NPHEPLDAHIKELTGLTDQRLAQAPDFSQVARKIFDLVEDGIFVAHNVQFDANLLAENL
FT                   FFEGYELRNPRVDTVELAQVFFPELEKYSLPILCRELGIPLKHAHTALSDAQATAELLL
FT                   FLREKMTQLPKGLLERLLEMADALLYESYLVIEETYRNQSILSSPDLVQVQGLYFKKMA
FT                   ASLEPRKLSQDFSKNISLLNLEVREEQESFAKEVGLLLKDEPVSLIQAPTGIGKTYGYL
FT                   LPALSQSKERQIVLSVPTKILQNQIMEEEGKRLKEVFHTDIHSLKGPQNYLKLDAFYHS
FT                   LQENDENRLFRRFKMQVLVWLTETETGDLDEIGQLYRYQHFLADLRHDGNLSSQNLFVT
FT                   EDFWKRSQERAETCKLLVTNHAYLVTRLEDNPEFVSDRLLIIDEVQKILLALENLLQET
FT                   YDIQSIIDLIDKALVGEENRVQQRILESIRFECLYLIEQFQSGKSRKNILDSLDNLHQY
FT                   FSELEVEGFDELVRYFTAEGDYWLEVTETSQKKIQISSTKSGRTLLSSLLPESCQVLGV
FT                   SATLEISQRVSLADLLGYPEVKFVKIESRGKQEQEVVMVKDFPLVTETSLEVYAREVAA
FT                   LLVEIQAFQQPILVLFTAKDMLLAVSDLLTVSHLAQYKNGDVHQLKKRFEKGEQQILLG
FT                   AASFWEGVDFSSHPFVIQVVPRLPFQNPQEPLTKKINQELNQEGKNAFYDYQLPMAIIR
FT                   LKQALGRSMRREYQRSLTLILDRRIVGKRYGKQIVASLAEEATVKTISRSEVDEAIDRF
FT                   FNEL"
FT   gene            740521..741771
FT                   /locus_tag="SPP_0812"
FT   CDS_pept        740521..741771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0812"
FT                   /product="RodA"
FT                   /note="identified by match to protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20338"
FT                   /protein_id="ACO20338.1"
FT                   /translation="MYESIRLVYMKRSLDSRVDYSLLLPVFFLLVIGVVAIYIAVSHDY
FT                   PNNILPILGQQVAWIALGLVIGFVVMLFNTEFLWKVTPFLYILGLGLMILPIVFYNPSL
FT                   VASTGAKNWVSINGITLFQPSEFMKISYILMLARVIVQFTKKHKEWRRTVPLDFLLIFW
FT                   MILFTIPVLVLLALQSDLGTALVFVAIFSGIVLLSGVSWKIIIPVFVTAVTGVAGFLAI
FT                   FISKDGRAFLHQIGMPTYQINRILAWLNPFEFAQTTTYQQAQGQIAIGSGGLFGQGFNA
FT                   SNLLIPVRESDMIFTVIAEDFGFIGSVLVIALYLMLIYRMLKITLKSNNQFYTYISTGL
FT                   IMMLLFHIFENIGAVTGLLPLTGIPLPFISQGGSAIISNLIGVGLLLSMSYQTNLAEEK
FT                   SGKVPFKRKKVVLKQIK"
FT   gene            741782..742336
FT                   /locus_tag="SPP_0813"
FT   CDS_pept        741782..742336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0813"
FT                   /product="4-methyl-5(b-hydroxyethyl)-thiazole monophosphate
FT                   biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM TIGR01383"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20834"
FT                   /protein_id="ACO20834.1"
FT                   /translation="MVKVAVMLAQGFEEIEALTVVDVLRRANITCDMVGFEEQVTGSHA
FT                   IQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRDNQTLIQELQSFEQEGKKLAAICAAPI
FT                   ALNQAEILKNKRYTCYDGVQEQILDGHYVKETVVVDGQLTTSRGPSTALAFAYELVEQL
FT                   GGDAESLRTGMLYQDVFGKNQ"
FT   gene            742412..742984
FT                   /locus_tag="SPP_0814"
FT   CDS_pept        742412..742984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0814"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21589"
FT                   /protein_id="ACO21589.1"
FT                   /translation="MKDMKYHDYIWDLGGTLLDNYETSTAAFVETLALYGITQDHDSVY
FT                   QALKVSTPFAIETFAPNLENFLEKYKENEARELEHPILFEGVSDLLEVISNQGGRHFLV
FT                   SHRNDQVLEILEKTSIAAYFTEVVTSSSGFKRKPNPESMLYLREKYQISSGLVIGDRPI
FT                   DIEAGQAAGLDTHLFTSIVNLRQVLDI"
FT   gene            742999..744945
FT                   /gene="gyrB"
FT                   /locus_tag="SPP_0815"
FT   CDS_pept        742999..744945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SPP_0815"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22025"
FT                   /protein_id="ACO22025.1"
FT                   /translation="MTEEIKNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHH
FT                   LVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTV
FT                   LHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRGHVVADLEI
FT                   VGDTDKTGTTVHFTPDPKIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQT
FT                   KHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMDDITVEVAMQYTTGYHENVMSFANN
FT                   IHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQ
FT                   FEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRARE
FT                   VTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGK
FT                   ILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTL
FT                   LLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGR
FT                   TKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRRE
FT                   FIEENAVYSTLDV"
FT   gene            745027..746754
FT                   /gene="ezrA"
FT                   /locus_tag="SPP_0816"
FT   CDS_pept        745027..746754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ezrA"
FT                   /locus_tag="SPP_0816"
FT                   /product="septation ring formation regulator EzrA"
FT                   /note="identified by match to protein family HMM PF06160"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21574"
FT                   /db_xref="GOA:C1CJQ4"
FT                   /db_xref="InterPro:IPR010379"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJQ4"
FT                   /protein_id="ACO21574.1"
FT                   /translation="MSNGQLIYLMVAIAVILVLAYVVAIFLRKRNEGRLEALEERKEEL
FT                   YNLPVNDEVEAVKNMHLIGQSQVAFREWNQKWVDLSLNSFADIENNLFEAEGYNHSFRF
FT                   LKASHQIDQIESQITLIEEDIAAIRNALADLEKQESKNSGRVLHALDLFEELQHRVAEN
FT                   SEQYGQALDEIEKQLENIQSEFSQFVTLNSSGDPVEAAVILDNTENHILALSHIVDRVP
FT                   ALVTTLSTELPDQLQDLEAGYRKLIDANYHFVETDIEARFHLLYEAFKKNQENIRQLEL
FT                   DNAEYENGQAQEEINALYDIFTREIAAQKVVENLLATLPTYLQHMKENNTLLGEDIARL
FT                   NKTYLLPETAASHVRRIQTELESFEAAIVEVTSNQEEPTQAYSVLEENLEDLQTQLKDI
FT                   EDEQISVSERLTQIEKDDINARQKANVYVNRLHTIKRYMEKRNLPGIPQTFLKLFFTAS
FT                   NNTEDLMVELEQKMINIESVTRVLEIATNDMEALETETYNIVQYATLTEQLLQYSNRYR
FT                   SFDERIQEAFNEALDIFEKEFDYHASFDKISQALEVAEPGVTNRFVTSYEKTRETIRF"
FT   gene            complement(747147..747674)
FT                   /pseudo
FT                   /locus_tag="SPP_0817"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            complement(747671..748453)
FT                   /pseudo
FT                   /locus_tag="SPP_0818"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts; identified by match to
FT                   protein family HMM PF01610"
FT   gene            749207..749473
FT                   /locus_tag="SPP_0819"
FT   CDS_pept        749207..749473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0819"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21631"
FT                   /protein_id="ACO21631.1"
FT                   /translation="MTVEEEKAFLARHLKAAEAGEFVTIDALFQAYKKELGRSYTRDAF
FT                   YQLLKRHGWRNIMPRPEHPKKADAQTIVASKNKISIQEEKKAL"
FT   gene            749615..749920
FT                   /pseudo
FT                   /locus_tag="SPP_0820"
FT                   /note="transposase family protein; this region contains one
FT                   or more premature stops and/or frameshifts"
FT   gene            complement(750027..750377)
FT                   /locus_tag="SPP_0821"
FT   CDS_pept        complement(750027..750377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0821"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF05717"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0821"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20716"
FT                   /protein_id="ACO20716.1"
FT                   /translation="MIIQLSDLGQVHLVCSKIDMRQGIDSLAYVVKTHFELDPFSGQVF
FT                   LFCGGRKDRFKALYWDGQGFWLLYKRFENGRLTWPSTEKDVKALTPEQVDWLMKGFSIT
FT                   PKINPSESRDFY"
FT   gene            750619..750831
FT                   /pseudo
FT                   /locus_tag="SPP_0822"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            751057..751329
FT                   /locus_tag="SPP_0823"
FT   CDS_pept        751057..751329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0823"
FT                   /product="transposase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0823"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22195"
FT                   /protein_id="ACO22195.1"
FT                   /translation="MTEFSLDILLKAIKLARSTYYYHLKQLDKTDKDQELKAEIQSIFI
FT                   EHKGNYGYRRIYLELRNRGYLVNHKRVQGLMKVLNLQAKMRQKRK"
FT   gene            751391..751879
FT                   /locus_tag="SPP_0824"
FT   CDS_pept        751391..751879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0824"
FT                   /product="integrase core domain, putative"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0824"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20932"
FT                   /protein_id="ACO20932.1"
FT                   /translation="MEKCYTDVTEFAIPASTQKLYLSPVLDGFNSEIIAYNLSCSPNLE
FT                   QVQTMLEQAFKEKHYENTILHSDQGCQYQHDSYHRFLESKGIQASMSRKGNSQDNGMME
FT                   SFFGILKSEMFYGYEKTFKSLNQLEQAIIDYIDYYNNKRIKVKLKGLSPVQYRTKSFG"
FT   gene            complement(751991..752290)
FT                   /locus_tag="SPP_0825"
FT   CDS_pept        complement(751991..752290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0825"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08860"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0825"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20975"
FT                   /protein_id="ACO20975.1"
FT                   /translation="MKLINTTNSHSQLVKSQLESTDATLVEVYSAGNTDVIFTQAPLHY
FT                   EILISNKHRAIREPEIETIQEFFLKRKIDKTSVDEANIKTLYSEKLIGISIPIK"
FT   gene            complement(752455..752906)
FT                   /pseudo
FT                   /locus_tag="SPP_0826"
FT                   /note="MutT/nudix family protein, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            752988..753317
FT                   /locus_tag="SPP_0827"
FT   CDS_pept        752988..753317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0827"
FT                   /product="transposase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF01710"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21758"
FT                   /protein_id="ACO21758.1"
FT                   /translation="MAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWLKLKEKT
FT                   GELNHQVKGTKPRKVDRDRLKNYLTDNPDAYLTEIASEFGCHPTTITMRSKLWATLEKK
FT                   EPHLL"
FT   gene            complement(754044..756302)
FT                   /locus_tag="SPP_0828"
FT   CDS_pept        complement(754044..756302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0828"
FT                   /product="negative regulator of genetic competence
FT                   ClpC/mecB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF07724; match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0828"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22197"
FT                   /protein_id="ACO22197.1"
FT                   /translation="MLCQNCKINDSTIHLYTNLNGKQKQIDLCQNCYKIIKTDPNNSLF
FT                   KGMTDLNNRDFDPFGDFFNDLNNFRPSSNTPPIPPTQSGGGYGGNGGYGSQNRGSAQTP
FT                   PPSQEKGLLEEFGINVTEIARRGDIDPVIGRDDEIIRVIEILNRRTKNNPVLIGEPGVG
FT                   KTAVVEGLAQKIVDGDVPHKLQGKQVIRLDVVSLVQGTGIRGQFEERMQKLMEEIRKRE
FT                   DIILFIDEIHEIVGAGSASDGNMDAGNILKPALARGELQLVGATTLNEYRIIEKDAALE
FT                   RRMQPVKVDEPTVDETITILKGIQKKYEDYHHVQYTDAAIEAAATLSNRYIQDRFLPDK
FT                   AIDLLDEAGSKMNLTLNFVDPKVIDQRLIEAENLKSQATREEDFEKAAYFRDQIAKYKE
FT                   MQKKKITDQDTPIISEKTIEHIIEQKTNIPVGDLKEKEQSQLIHLAEDLKSHVIGQDDA
FT                   VDKIAKAIRRNRVGLGTPNRPIGSFLFVGPTGVGKTELSKQLAIELFGSADSMIRFDMS
FT                   EYMEKHSVAKLVGAPPGYVGYDEAGQLTEKVRHNPYSLILLDEVEKAHPDVMHMFLQVL
FT                   DDGRLTDGQGRTVSFKDAIIIMTSNAGTGKTEASVGFGAAREGRTNSVLGELGNFFSPE
FT                   FMNRFDGIIEFKALSKDNLLQIVELMLADVNKRLSSNNIRLDVTDKVKEKLVDLGYDPK
FT                   MGARPLRRTIQDYIEDTITDYYLENPSEKDLKAVMTSKGNIQIKSAKKAEVKSSEKEK"
FT   gene            complement(756531..756761)
FT                   /locus_tag="SPP_0829"
FT   CDS_pept        complement(756531..756761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0829"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08796"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0829"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20551"
FT                   /protein_id="ACO20551.1"
FT                   /translation="MESHLVRIINRLEAMANDGGNLKRNFEREGVVVAEVAYSHDEENG
FT                   PIFTLRDVEDRETYTFDSIDLIAMEIYELLY"
FT   gene            756951..757634
FT                   /locus_tag="SPP_0830"
FT   CDS_pept        756951..757634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0830"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0830"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21013"
FT                   /protein_id="ACO21013.1"
FT                   /translation="MNFSFLPKYLPYFNYGAVVTILISICVIFLGTILGVVLAFGQRSK
FT                   FKPLVWLANLYVWIFRGTPMMVQIMIAFALMHINAPTIQIGILGVDFSRLIPGILIISM
FT                   NSGAYVSETVRAGINAVPKGQLEAAYSLGIRPKNAMRYVILPQAIKNILPALGNEFITI
FT                   IKDSSLLSAIGVMELWNGATTVSTTTYLPLTPLLFAAFYYLIMTSILTVALKAFEKHMG
FT                   QGDKK"
FT   gene            757634..758368
FT                   /locus_tag="SPP_0831"
FT   CDS_pept        757634..758368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0831"
FT                   /product="glutamine transport ATP-binding protein GlnQ"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0831"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21425"
FT                   /protein_id="ACO21425.1"
FT                   /translation="MTETLIKIENLHKSFGKNEVLKGINLEIKRGEVVVIIGPSGSGKS
FT                   TLLRSMNLLEEATKGKVIFEGVDITDKKNDLFAMREKMGMVFQQFNLFPNMTVIENITL
FT                   SPIKTKGESREVAEKRAQELLEKVGLPDKADAYPQSLSGGQQQRIAIARGLAMEPDVLL
FT                   FDEPTSALDPEMVGEVLAVMQDLAKSGMTMVIVTHEMGFAREVADRVIFMADGVVVEDG
FT                   TPEQIFEQTQEQRTKDFLSKVL"
FT   gene            758501..759379
FT                   /locus_tag="SPP_0832"
FT   CDS_pept        758501..759379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0832"
FT                   /product="bifunctional protein FolD"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="identified by match to protein family HMM PF00763;
FT                   match to protein family HMM PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0832"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21702"
FT                   /protein_id="ACO21702.1"
FT                   /translation="MKEKRSDMTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVI
FT                   LVGDNPASQVYVRNKERSALAAGSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQ
FT                   LPLPKHIDEEAVLLAIDPEKDVDGFHPLNMGRLWSGHPVMIPSTPAGIMEMFHEYGIDL
FT                   EGKNAVVIGRSNIVGKPMAQLLLAKNATVTLAHSRTHNLAKVAAKADILVVAIGRAKFV
FT                   TADFVKPGAVVIDVGMNRDENGKLCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQT
FT                   YQAALRTLDRK"
FT   gene            759521..760393
FT                   /locus_tag="SPP_0833"
FT   CDS_pept        759521..760393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0833"
FT                   /product="putative YjeF homolog, C-terminus"
FT                   /note="identified by match to protein family HMM PF01256;
FT                   match to protein family HMM TIGR00196"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0833"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21238"
FT                   /protein_id="ACO21238.1"
FT                   /translation="MKVINQTLLEKVIIERSRSSHKGDYGRLLLLGGTYPYGGAIIMAA
FT                   LAAVKSGAGLVTVGTDRENIPALHSHLPEPMAFSLQDQQLLKEQLEKAEVILLGPGLRD
FT                   DASGENLVKQVFVNLSQNQILIVDGGALTILARTSLSFPSSQLILTPHQKEWEKLSGIT
FT                   IEKQKEDATASVLTSFPQGTILVEKGPATRIWEVGQSDYYQLQVGGPYQATGGMGDTLA
FT                   GMIAGFVGQFRQASLYERVAVATHLHSAIAQELSQENYVVLPTEISRYLPKIMKIICQQ
FT                   DRVSKDKLV"
FT   gene            760675..761358
FT                   /gene="rpiA"
FT                   /locus_tag="SPP_0834"
FT   CDS_pept        760675..761358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="SPP_0834"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF06026;
FT                   match to protein family HMM TIGR00021"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0834"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20750"
FT                   /db_xref="GOA:C1CJR7"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJR7"
FT                   /protein_id="ACO20750.1"
FT                   /translation="MENLKKMAGIKAAEFVSDGMVVGLGTGSTAYYFVEEIGRRIKEEG
FT                   LQITAVTTSSVTTKQAEGLNIPLKSIDQVDFVDVTVDGADEVDSQFNGIKGGGGALLME
FT                   KVVATPSKEYIWVVDESKLVEKLGAFKLPVEVVQYGAEQVFRHFERAGYKPSFREKDGQ
FT                   RFVTDMQNFIIDLALDVIENPIAFGQELDHVVGVVEHGLFNQMVDKVIVAGRDGVQIST
FT                   SKKGK"
FT   gene            761372..762583
FT                   /gene="deoB"
FT                   /locus_tag="SPP_0835"
FT   CDS_pept        761372..762583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="SPP_0835"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="identified by match to protein family HMM PF01676;
FT                   match to protein family HMM PF08342; match to protein
FT                   family HMM TIGR01696"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0835"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20221"
FT                   /db_xref="GOA:C1CJR8"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJR8"
FT                   /protein_id="ACO20221.1"
FT                   /translation="MSKFNRIHLVVLDSVGIGAAPDANNFVNAGVPDGASDTLGHISKT
FT                   VGLNVPNMAKIGLGNIPRETPLKTVAAESNPTGYATKLEEVSLGKDTMTGHWEIMGLNI
FT                   TEPFDTFWNGFPEEILTKIEEFSGRKVIREANKPYSGTAVIDDFGPRQMETGELIIYTS
FT                   ADPVLQIAAHEDIIPLDELYRICEYARSITLERPALLGRIIARPYVGEPGNFTRTANRR
FT                   DLAVSPFSPTVLDKLNEAGIDTYAVGKINDIFNGAGINHDMGHNKSNSHGIDTLLKTMG
FT                   LAEFEKGFSFTNLVDFDALYGHRRNAHGYRDCLHEFDERLPEIIAAMRENDLLLITADH
FT                   GNDPTYAGTDHTREYIPLLAYSPAFKGNGLIPVGHFADISATVADNFGVETAMIGESFL
FT                   DKLV"
FT   gene            762585..762995
FT                   /locus_tag="SPP_0836"
FT   CDS_pept        762585..762995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0836"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08002"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0836"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22096"
FT                   /protein_id="ACO22096.1"
FT                   /translation="MTRYALLVRGINVGGKNKVVMAELRQELTNLGLEKVESYINSGNI
FT                   FFTSIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLF
FT                   YTEGLDVDQVIATVESLELKDEVLYFGKLGIF"
FT   gene            763143..763952
FT                   /locus_tag="SPP_0837"
FT   CDS_pept        763143..763952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0837"
FT                   /product="purine nucleoside phosphorylase I, inosine and
FT                   guanosine-specific"
FT                   /EC_number="2.4.2.1"
FT                   /note="identified by match to protein family HMM PF00896;
FT                   match to protein family HMM TIGR01697; match to protein
FT                   family HMM TIGR01700"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0837"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21498"
FT                   /protein_id="ACO21498.1"
FT                   /translation="MTFLNKIHETATFLKEKGIAAPEFGLILGSGLGELAEEIENPVVV
FT                   DYAEIPNWGRSTVVGHAGKLVYGELAGRKVLALQGRFHFYEGNPLEVVTFPVRVMKVLG
FT                   CEGVIVTNAAGGIGFGPGTLMAISDHINMTGQNPLMGENLDDFGPRFPDMSRAYTPEYR
FT                   ATAHEVAKKLNIKLDEGVYIGVTGPTYETPAEIRSYKTLGADAVGMSTVPEVIVAAHSG
FT                   LKVLGISCITNFAAGFQEELNHEEVVEVTERVKGDFKGLLKAILAEL"
FT   gene            764428..765159
FT                   /locus_tag="SPP_0838"
FT   CDS_pept        764428..765159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0838"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0838"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21417"
FT                   /protein_id="ACO21417.1"
FT                   /translation="MLDSKEELKESENDAPKLETPLREEPRLAPQTLPEASEVLENKRE
FT                   ESKVEITEPAQADDIRKVVGELAKDISITKLYMTGHSLGCYLAQIAEVEAYQKYPDFYN
FT                   HVLRKVTTFSAPKVITSRTVWNAKNGFWDVGLESRKLAVSGKIKHYVVDNDNVVTPLIH
FT                   NDRDIVTFTGNSRFKHRSRGYFESPMNDIPNFNIGKQATLDKHGYRDPKLDKVRFFKKQ
FT                   ALPRSSSQPSAEPMENIALGK"
FT   gene            765205..765408
FT                   /locus_tag="SPP_0839"
FT   CDS_pept        765205..765408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0839"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0839"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20941"
FT                   /protein_id="ACO20941.1"
FT                   /translation="MDGKVDGNYGHNSVTHTNFQSKPWWQVDLAKEETIRQINIYNRTD
FT                   TAQDRLANFDVILLDSSGKEIE"
FT   gene            765433..765945
FT                   /locus_tag="SPP_0840"
FT   CDS_pept        765433..765945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0840"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20194"
FT                   /protein_id="ACO20194.1"
FT                   /translation="MSAQITINHKKARYVRIELEGYNALSLAEVEVFRFIATNGETAIQ
FT                   VSKSVQPISQTPVKDKTLTIQHSGAYIARYSITWEEVTVDKDGNQVVRSHSWEGNGRNQ
FT                   TAGFVLNLPIKENMRNLRVKIEKKTGLLWNRWQTIYENRPILAQPHRKITHWGTTLNSK
FT                   VSDDDVL"
FT   gene            766051..766164
FT                   /locus_tag="SPP_0841"
FT   CDS_pept        766051..766164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0841"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0841"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20539"
FT                   /protein_id="ACO20539.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVVDKTDEVSHIYNPRRR"
FT   gene            766603..767313
FT                   /gene="deoD"
FT                   /locus_tag="SPP_0842"
FT   CDS_pept        766603..767313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="SPP_0842"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR00107"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0842"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22057"
FT                   /db_xref="GOA:C1CJS5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJS5"
FT                   /protein_id="ACO22057.1"
FT                   /translation="MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNM
FT                   FGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELV
FT                   LAQAAATNSNIVRNDWPQYDFPQIASFDLLDKAYHIAKELGMTTHVGNVLSSDVFYSNY
FT                   FEKNIELGKWGVKAVEMEAAALYYLAAQYHVDALAIMTISDSLVNPDEDTTAEERQNTF
FT                   TDMMKVGLETLIAE"
FT   gene            complement(767336..767860)
FT                   /locus_tag="SPP_0843"
FT   CDS_pept        complement(767336..767860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPP_0843"
FT                   /product="topology modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0843"
FT                   /db_xref="EnsemblGenomes-Tr:ACO21582"
FT                   /protein_id="ACO21582.1"
FT                   /translation="MKITIIGYSGSGKSTLAEKLSNYYSIPKLHMDTLQFQPGWQDSDC
FT                   EWMLTEIKNFLTKHKAWVIDGNYSWCYYQERMQEADQIIFLNFLPLTCLFRAFKRYLKY
FT                   RGKVRESMAADCPERFDWEFIRWILWDGRSKTQKENYQKLCQEYSHKVTILRNQRELDQ
FT                   FLDKKRKSYNS"
FT   gene            complement(767913..768149)
FT                   /gene="rpsT"
FT                   /locus_tag="SPP_0844"
FT   CDS_pept        complement(767913..768149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="SPP_0844"
FT                   /product="ribosomal protein S20"
FT                   /note="identified by match to protein family HMM PF01649;
FT                   match to protein family HMM TIGR00029"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0844"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20919"
FT                   /db_xref="GOA:C1CJS7"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJS7"
FT                   /protein_id="ACO20919.1"
FT                   /translation="MANIKSAIKRAELNVKQNEKNSAQKSAMRTAIKAFEANPSEELFR
FT                   AASSAIDKAETKGLIHKNKASRDKARLSAKLAK"
FT   gene            complement(768217..769137)
FT                   /gene="coaA"
FT                   /locus_tag="SPP_0845"
FT   CDS_pept        complement(768217..769137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="SPP_0845"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="identified by match to protein family HMM PF00485;
FT                   match to protein family HMM TIGR00554"
FT                   /db_xref="EnsemblGenomes-Gn:SPP_0845"
FT                   /db_xref="EnsemblGenomes-Tr:ACO20339"
FT                   /db_xref="GOA:C1CJS8"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CJS8"
FT                   /protein_id="ACO20339.1"
FT                   /translation="MTNEFLHFEKISRQTWQSLHRKTTPPLTEEELESIKSFNDQISLQ
FT                   DVTDIYLPLAHLIQIYKRTKEDLAFSKGIFLQRESKSQPFIIGVSGSVAVGKSTTSRLL
FT                   QILLSRTFTDATVELVT