(data stored in ACNUC7421 zone)

EMBL: CP000921

ID   CP000921; SV 1; circular; genomic DNA; STD; PRO; 2112148 BP.
XX
AC   CP000921;
XX
PR   Project:PRJNA28037;
XX
DT   29-MAR-2009 (Rel. 100, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Streptococcus pneumoniae Taiwan19F-14, complete genome.
XX
KW   .
XX
OS   Streptococcus pneumoniae Taiwan19F-14
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-2112148
RA   Hotopp J.D., Censini S., Masignani V., Covacci A., Tettelin H.;
RT   ;
RL   Submitted (28-DEC-2007) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; 6e669d7c0a18154dfd3c974adee3dfae.
DR   BioSample; SAMN02603443.
DR   EnsemblGenomes-Gn; EBG00001058450.
DR   EnsemblGenomes-Gn; EBG00001058451.
DR   EnsemblGenomes-Gn; EBG00001058452.
DR   EnsemblGenomes-Gn; EBG00001058453.
DR   EnsemblGenomes-Gn; EBG00001058454.
DR   EnsemblGenomes-Gn; EBG00001058455.
DR   EnsemblGenomes-Gn; EBG00001058456.
DR   EnsemblGenomes-Gn; EBG00001058457.
DR   EnsemblGenomes-Gn; EBG00001058458.
DR   EnsemblGenomes-Gn; EBG00001058459.
DR   EnsemblGenomes-Gn; EBG00001058460.
DR   EnsemblGenomes-Gn; EBG00001058461.
DR   EnsemblGenomes-Gn; EBG00001058462.
DR   EnsemblGenomes-Gn; EBG00001058463.
DR   EnsemblGenomes-Gn; EBG00001058464.
DR   EnsemblGenomes-Gn; EBG00001058465.
DR   EnsemblGenomes-Gn; EBG00001058466.
DR   EnsemblGenomes-Gn; EBG00001058467.
DR   EnsemblGenomes-Gn; EBG00001058468.
DR   EnsemblGenomes-Gn; EBG00001058469.
DR   EnsemblGenomes-Gn; EBG00001058470.
DR   EnsemblGenomes-Gn; EBG00001058471.
DR   EnsemblGenomes-Gn; EBG00001058472.
DR   EnsemblGenomes-Gn; EBG00001058473.
DR   EnsemblGenomes-Gn; EBG00001058474.
DR   EnsemblGenomes-Gn; EBG00001058475.
DR   EnsemblGenomes-Gn; EBG00001058476.
DR   EnsemblGenomes-Gn; EBG00001058477.
DR   EnsemblGenomes-Gn; EBG00001058478.
DR   EnsemblGenomes-Gn; EBG00001058479.
DR   EnsemblGenomes-Gn; EBG00001058480.
DR   EnsemblGenomes-Gn; EBG00001058481.
DR   EnsemblGenomes-Gn; EBG00001058482.
DR   EnsemblGenomes-Gn; EBG00001058483.
DR   EnsemblGenomes-Gn; EBG00001058484.
DR   EnsemblGenomes-Gn; EBG00001058485.
DR   EnsemblGenomes-Gn; EBG00001058486.
DR   EnsemblGenomes-Gn; EBG00001058487.
DR   EnsemblGenomes-Gn; EBG00001058488.
DR   EnsemblGenomes-Gn; EBG00001058489.
DR   EnsemblGenomes-Gn; EBG00001058490.
DR   EnsemblGenomes-Gn; EBG00001058491.
DR   EnsemblGenomes-Gn; EBG00001058492.
DR   EnsemblGenomes-Gn; EBG00001058493.
DR   EnsemblGenomes-Gn; EBG00001058494.
DR   EnsemblGenomes-Gn; EBG00001058495.
DR   EnsemblGenomes-Gn; EBG00001058496.
DR   EnsemblGenomes-Gn; EBG00001058497.
DR   EnsemblGenomes-Gn; EBG00001058498.
DR   EnsemblGenomes-Gn; EBG00001058499.
DR   EnsemblGenomes-Gn; EBG00001058500.
DR   EnsemblGenomes-Gn; EBG00001058501.
DR   EnsemblGenomes-Gn; EBG00001058502.
DR   EnsemblGenomes-Gn; EBG00001058503.
DR   EnsemblGenomes-Gn; EBG00001058504.
DR   EnsemblGenomes-Gn; EBG00001058505.
DR   EnsemblGenomes-Gn; EBG00001058506.
DR   EnsemblGenomes-Gn; EBG00001058507.
DR   EnsemblGenomes-Gn; EBG00001058508.
DR   EnsemblGenomes-Gn; EBG00001058509.
DR   EnsemblGenomes-Gn; EBG00001058510.
DR   EnsemblGenomes-Gn; EBG00001058511.
DR   EnsemblGenomes-Gn; EBG00001058512.
DR   EnsemblGenomes-Gn; EBG00001058513.
DR   EnsemblGenomes-Gn; EBG00001058514.
DR   EnsemblGenomes-Gn; EBG00001058515.
DR   EnsemblGenomes-Gn; EBG00001058516.
DR   EnsemblGenomes-Gn; EBG00001058517.
DR   EnsemblGenomes-Gn; EBG00001058518.
DR   EnsemblGenomes-Gn; EBG00001058519.
DR   EnsemblGenomes-Gn; EBG00001058520.
DR   EnsemblGenomes-Gn; EBG00001058521.
DR   EnsemblGenomes-Gn; EBG00001058522.
DR   EnsemblGenomes-Gn; EBG00001058523.
DR   EnsemblGenomes-Gn; EBG00001058524.
DR   EnsemblGenomes-Gn; EBG00001058525.
DR   EnsemblGenomes-Gn; EBG00001058526.
DR   EnsemblGenomes-Gn; EBG00001058527.
DR   EnsemblGenomes-Gn; EBG00001058528.
DR   EnsemblGenomes-Gn; EBG00001058529.
DR   EnsemblGenomes-Gn; EBG00001058530.
DR   EnsemblGenomes-Gn; EBG00001058531.
DR   EnsemblGenomes-Gn; EBG00001058532.
DR   EnsemblGenomes-Gn; EBG00001058533.
DR   EnsemblGenomes-Gn; EBG00001058534.
DR   EnsemblGenomes-Gn; EBG00001058535.
DR   EnsemblGenomes-Gn; EBG00001058536.
DR   EnsemblGenomes-Gn; EBG00001058537.
DR   EnsemblGenomes-Gn; EBG00001058538.
DR   EnsemblGenomes-Gn; EBG00001058539.
DR   EnsemblGenomes-Gn; EBG00001058540.
DR   EnsemblGenomes-Gn; EBG00001058541.
DR   EnsemblGenomes-Gn; EBG00001058542.
DR   EnsemblGenomes-Gn; EBG00001058543.
DR   EnsemblGenomes-Gn; EBG00001058544.
DR   EnsemblGenomes-Gn; EBG00001058545.
DR   EnsemblGenomes-Gn; EBG00001058546.
DR   EnsemblGenomes-Gn; EBG00001058547.
DR   EnsemblGenomes-Gn; EBG00001058548.
DR   EnsemblGenomes-Gn; EBG00001058549.
DR   EnsemblGenomes-Gn; EBG00001058550.
DR   EnsemblGenomes-Gn; EBG00001058551.
DR   EnsemblGenomes-Gn; EBG00001058552.
DR   EnsemblGenomes-Gn; EBG00001058553.
DR   EnsemblGenomes-Gn; EBG00001058554.
DR   EnsemblGenomes-Gn; EBG00001058555.
DR   EnsemblGenomes-Gn; EBG00001058556.
DR   EnsemblGenomes-Gn; EBG00001058557.
DR   EnsemblGenomes-Gn; EBG00001058558.
DR   EnsemblGenomes-Gn; SPT_0049.
DR   EnsemblGenomes-Gn; SPT_0050.
DR   EnsemblGenomes-Gn; SPT_0051.
DR   EnsemblGenomes-Gn; SPT_0053.
DR   EnsemblGenomes-Gn; SPT_0054.
DR   EnsemblGenomes-Gn; SPT_0055.
DR   EnsemblGenomes-Gn; SPT_0934.
DR   EnsemblGenomes-Gn; SPT_0980.
DR   EnsemblGenomes-Gn; SPT_1066.
DR   EnsemblGenomes-Gn; SPT_1327.
DR   EnsemblGenomes-Gn; SPT_1341.
DR   EnsemblGenomes-Gn; SPT_1342.
DR   EnsemblGenomes-Gn; SPT_1521.
DR   EnsemblGenomes-Gn; SPT_1718.
DR   EnsemblGenomes-Gn; SPT_1824.
DR   EnsemblGenomes-Gn; SPT_1825.
DR   EnsemblGenomes-Gn; SPT_1826.
DR   EnsemblGenomes-Gn; SPT_1827.
DR   EnsemblGenomes-Gn; SPT_1828.
DR   EnsemblGenomes-Gn; SPT_1829.
DR   EnsemblGenomes-Gn; SPT_1830.
DR   EnsemblGenomes-Gn; SPT_1831.
DR   EnsemblGenomes-Gn; SPT_1832.
DR   EnsemblGenomes-Gn; SPT_1833.
DR   EnsemblGenomes-Gn; SPT_1834.
DR   EnsemblGenomes-Gn; SPT_1835.
DR   EnsemblGenomes-Gn; SPT_1836.
DR   EnsemblGenomes-Gn; SPT_1837.
DR   EnsemblGenomes-Gn; SPT_1838.
DR   EnsemblGenomes-Gn; SPT_1839.
DR   EnsemblGenomes-Gn; SPT_1840.
DR   EnsemblGenomes-Gn; SPT_1841.
DR   EnsemblGenomes-Gn; SPT_1843.
DR   EnsemblGenomes-Gn; SPT_1844.
DR   EnsemblGenomes-Gn; SPT_1845.
DR   EnsemblGenomes-Gn; SPT_1940.
DR   EnsemblGenomes-Gn; SPT_1988.
DR   EnsemblGenomes-Gn; SPT_1989.
DR   EnsemblGenomes-Gn; SPT_1990.
DR   EnsemblGenomes-Gn; SPT_1991.
DR   EnsemblGenomes-Gn; SPT_1992.
DR   EnsemblGenomes-Gn; SPT_1993.
DR   EnsemblGenomes-Gn; SPT_1994.
DR   EnsemblGenomes-Gn; SPT_1995.
DR   EnsemblGenomes-Gn; SPT_1996.
DR   EnsemblGenomes-Gn; SPT_1997.
DR   EnsemblGenomes-Gn; SPT_1999.
DR   EnsemblGenomes-Gn; SPT_2000.
DR   EnsemblGenomes-Gn; SPT_2001.
DR   EnsemblGenomes-Gn; SPT_2063.
DR   EnsemblGenomes-Gn; SPT_2064.
DR   EnsemblGenomes-Gn; SPT_2065.
DR   EnsemblGenomes-Gn; SPT_2066.
DR   EnsemblGenomes-Gn; SPT_2067.
DR   EnsemblGenomes-Gn; SPT_2068.
DR   EnsemblGenomes-Gn; SPT_2069.
DR   EnsemblGenomes-Gn; SPT_2070.
DR   EnsemblGenomes-Gn; SPT_2071.
DR   EnsemblGenomes-Gn; SPT_2072.
DR   EnsemblGenomes-Gn; SPT_2073.
DR   EnsemblGenomes-Gn; SPT_2074.
DR   EnsemblGenomes-Gn; SPT_2076.
DR   EnsemblGenomes-Gn; SPT_2077.
DR   EnsemblGenomes-Gn; SPT_2078.
DR   EnsemblGenomes-Gn; SPT_2253.
DR   EnsemblGenomes-Gn; SPT_2254.
DR   EnsemblGenomes-Gn; SPT_2258.
DR   EnsemblGenomes-Gn; SPT_2262.
DR   EnsemblGenomes-Gn; SPT_2263.
DR   EnsemblGenomes-Gn; SPT_2264.
DR   EnsemblGenomes-Gn; SPT_2265.
DR   EnsemblGenomes-Gn; SPT_2266.
DR   EnsemblGenomes-Gn; SPT_2268.
DR   EnsemblGenomes-Gn; SPT_2269.
DR   EnsemblGenomes-Gn; SPT_2271.
DR   EnsemblGenomes-Gn; SPT_2272.
DR   EnsemblGenomes-Gn; SPT_2282.
DR   EnsemblGenomes-Tr; EBT00001661522.
DR   EnsemblGenomes-Tr; EBT00001661523.
DR   EnsemblGenomes-Tr; EBT00001661524.
DR   EnsemblGenomes-Tr; EBT00001661525.
DR   EnsemblGenomes-Tr; EBT00001661526.
DR   EnsemblGenomes-Tr; EBT00001661527.
DR   EnsemblGenomes-Tr; EBT00001661528.
DR   EnsemblGenomes-Tr; EBT00001661529.
DR   EnsemblGenomes-Tr; EBT00001661530.
DR   EnsemblGenomes-Tr; EBT00001661531.
DR   EnsemblGenomes-Tr; EBT00001661532.
DR   EnsemblGenomes-Tr; EBT00001661533.
DR   EnsemblGenomes-Tr; EBT00001661534.
DR   EnsemblGenomes-Tr; EBT00001661535.
DR   EnsemblGenomes-Tr; EBT00001661536.
DR   EnsemblGenomes-Tr; EBT00001661537.
DR   EnsemblGenomes-Tr; EBT00001661538.
DR   EnsemblGenomes-Tr; EBT00001661539.
DR   EnsemblGenomes-Tr; EBT00001661540.
DR   EnsemblGenomes-Tr; EBT00001661541.
DR   EnsemblGenomes-Tr; EBT00001661542.
DR   EnsemblGenomes-Tr; EBT00001661543.
DR   EnsemblGenomes-Tr; EBT00001661544.
DR   EnsemblGenomes-Tr; EBT00001661545.
DR   EnsemblGenomes-Tr; EBT00001661546.
DR   EnsemblGenomes-Tr; EBT00001661547.
DR   EnsemblGenomes-Tr; EBT00001661548.
DR   EnsemblGenomes-Tr; EBT00001661549.
DR   EnsemblGenomes-Tr; EBT00001661550.
DR   EnsemblGenomes-Tr; EBT00001661551.
DR   EnsemblGenomes-Tr; EBT00001661552.
DR   EnsemblGenomes-Tr; EBT00001661553.
DR   EnsemblGenomes-Tr; EBT00001661554.
DR   EnsemblGenomes-Tr; EBT00001661555.
DR   EnsemblGenomes-Tr; EBT00001661556.
DR   EnsemblGenomes-Tr; EBT00001661557.
DR   EnsemblGenomes-Tr; EBT00001661558.
DR   EnsemblGenomes-Tr; EBT00001661559.
DR   EnsemblGenomes-Tr; EBT00001661560.
DR   EnsemblGenomes-Tr; EBT00001661561.
DR   EnsemblGenomes-Tr; EBT00001661562.
DR   EnsemblGenomes-Tr; EBT00001661563.
DR   EnsemblGenomes-Tr; EBT00001661564.
DR   EnsemblGenomes-Tr; EBT00001661565.
DR   EnsemblGenomes-Tr; EBT00001661566.
DR   EnsemblGenomes-Tr; EBT00001661567.
DR   EnsemblGenomes-Tr; EBT00001661568.
DR   EnsemblGenomes-Tr; EBT00001661569.
DR   EnsemblGenomes-Tr; EBT00001661570.
DR   EnsemblGenomes-Tr; EBT00001661571.
DR   EnsemblGenomes-Tr; EBT00001661572.
DR   EnsemblGenomes-Tr; EBT00001661573.
DR   EnsemblGenomes-Tr; EBT00001661574.
DR   EnsemblGenomes-Tr; EBT00001661575.
DR   EnsemblGenomes-Tr; EBT00001661576.
DR   EnsemblGenomes-Tr; EBT00001661577.
DR   EnsemblGenomes-Tr; EBT00001661578.
DR   EnsemblGenomes-Tr; EBT00001661579.
DR   EnsemblGenomes-Tr; EBT00001661580.
DR   EnsemblGenomes-Tr; EBT00001661581.
DR   EnsemblGenomes-Tr; EBT00001661582.
DR   EnsemblGenomes-Tr; EBT00001661583.
DR   EnsemblGenomes-Tr; EBT00001661584.
DR   EnsemblGenomes-Tr; EBT00001661585.
DR   EnsemblGenomes-Tr; EBT00001661586.
DR   EnsemblGenomes-Tr; EBT00001661587.
DR   EnsemblGenomes-Tr; EBT00001661588.
DR   EnsemblGenomes-Tr; EBT00001661589.
DR   EnsemblGenomes-Tr; EBT00001661590.
DR   EnsemblGenomes-Tr; EBT00001661591.
DR   EnsemblGenomes-Tr; EBT00001661592.
DR   EnsemblGenomes-Tr; EBT00001661593.
DR   EnsemblGenomes-Tr; EBT00001661594.
DR   EnsemblGenomes-Tr; EBT00001661595.
DR   EnsemblGenomes-Tr; EBT00001661596.
DR   EnsemblGenomes-Tr; EBT00001661597.
DR   EnsemblGenomes-Tr; EBT00001661598.
DR   EnsemblGenomes-Tr; EBT00001661599.
DR   EnsemblGenomes-Tr; EBT00001661600.
DR   EnsemblGenomes-Tr; EBT00001661601.
DR   EnsemblGenomes-Tr; EBT00001661602.
DR   EnsemblGenomes-Tr; EBT00001661603.
DR   EnsemblGenomes-Tr; EBT00001661604.
DR   EnsemblGenomes-Tr; EBT00001661605.
DR   EnsemblGenomes-Tr; EBT00001661606.
DR   EnsemblGenomes-Tr; EBT00001661607.
DR   EnsemblGenomes-Tr; EBT00001661608.
DR   EnsemblGenomes-Tr; EBT00001661609.
DR   EnsemblGenomes-Tr; EBT00001661610.
DR   EnsemblGenomes-Tr; EBT00001661611.
DR   EnsemblGenomes-Tr; EBT00001661612.
DR   EnsemblGenomes-Tr; EBT00001661613.
DR   EnsemblGenomes-Tr; EBT00001661614.
DR   EnsemblGenomes-Tr; EBT00001661615.
DR   EnsemblGenomes-Tr; EBT00001661616.
DR   EnsemblGenomes-Tr; EBT00001661617.
DR   EnsemblGenomes-Tr; EBT00001661618.
DR   EnsemblGenomes-Tr; EBT00001661619.
DR   EnsemblGenomes-Tr; EBT00001661620.
DR   EnsemblGenomes-Tr; EBT00001661621.
DR   EnsemblGenomes-Tr; EBT00001661622.
DR   EnsemblGenomes-Tr; EBT00001661623.
DR   EnsemblGenomes-Tr; EBT00001661624.
DR   EnsemblGenomes-Tr; EBT00001661625.
DR   EnsemblGenomes-Tr; EBT00001661626.
DR   EnsemblGenomes-Tr; EBT00001661627.
DR   EnsemblGenomes-Tr; EBT00001661628.
DR   EnsemblGenomes-Tr; EBT00001661629.
DR   EnsemblGenomes-Tr; EBT00001661630.
DR   EnsemblGenomes-Tr; SPT_0049-1.
DR   EnsemblGenomes-Tr; SPT_0050-1.
DR   EnsemblGenomes-Tr; SPT_0051-1.
DR   EnsemblGenomes-Tr; SPT_0053-1.
DR   EnsemblGenomes-Tr; SPT_0054-1.
DR   EnsemblGenomes-Tr; SPT_0055-1.
DR   EnsemblGenomes-Tr; SPT_0934-1.
DR   EnsemblGenomes-Tr; SPT_0980-1.
DR   EnsemblGenomes-Tr; SPT_1066-1.
DR   EnsemblGenomes-Tr; SPT_1327-1.
DR   EnsemblGenomes-Tr; SPT_1341-1.
DR   EnsemblGenomes-Tr; SPT_1342-1.
DR   EnsemblGenomes-Tr; SPT_1521-1.
DR   EnsemblGenomes-Tr; SPT_1718-1.
DR   EnsemblGenomes-Tr; SPT_1824-1.
DR   EnsemblGenomes-Tr; SPT_1825-1.
DR   EnsemblGenomes-Tr; SPT_1826-1.
DR   EnsemblGenomes-Tr; SPT_1827-1.
DR   EnsemblGenomes-Tr; SPT_1828-1.
DR   EnsemblGenomes-Tr; SPT_1829-1.
DR   EnsemblGenomes-Tr; SPT_1830-1.
DR   EnsemblGenomes-Tr; SPT_1831-1.
DR   EnsemblGenomes-Tr; SPT_1832-1.
DR   EnsemblGenomes-Tr; SPT_1833-1.
DR   EnsemblGenomes-Tr; SPT_1834-1.
DR   EnsemblGenomes-Tr; SPT_1835-1.
DR   EnsemblGenomes-Tr; SPT_1836-1.
DR   EnsemblGenomes-Tr; SPT_1837-1.
DR   EnsemblGenomes-Tr; SPT_1838-1.
DR   EnsemblGenomes-Tr; SPT_1839-1.
DR   EnsemblGenomes-Tr; SPT_1840-1.
DR   EnsemblGenomes-Tr; SPT_1841-1.
DR   EnsemblGenomes-Tr; SPT_1843-1.
DR   EnsemblGenomes-Tr; SPT_1844-1.
DR   EnsemblGenomes-Tr; SPT_1845-1.
DR   EnsemblGenomes-Tr; SPT_1940-1.
DR   EnsemblGenomes-Tr; SPT_1988-1.
DR   EnsemblGenomes-Tr; SPT_1989-1.
DR   EnsemblGenomes-Tr; SPT_1990-1.
DR   EnsemblGenomes-Tr; SPT_1991-1.
DR   EnsemblGenomes-Tr; SPT_1992-1.
DR   EnsemblGenomes-Tr; SPT_1993-1.
DR   EnsemblGenomes-Tr; SPT_1994-1.
DR   EnsemblGenomes-Tr; SPT_1995-1.
DR   EnsemblGenomes-Tr; SPT_1996-1.
DR   EnsemblGenomes-Tr; SPT_1997-1.
DR   EnsemblGenomes-Tr; SPT_1999-1.
DR   EnsemblGenomes-Tr; SPT_2000-1.
DR   EnsemblGenomes-Tr; SPT_2001-1.
DR   EnsemblGenomes-Tr; SPT_2063-1.
DR   EnsemblGenomes-Tr; SPT_2064-1.
DR   EnsemblGenomes-Tr; SPT_2065-1.
DR   EnsemblGenomes-Tr; SPT_2066-1.
DR   EnsemblGenomes-Tr; SPT_2067-1.
DR   EnsemblGenomes-Tr; SPT_2068-1.
DR   EnsemblGenomes-Tr; SPT_2069-1.
DR   EnsemblGenomes-Tr; SPT_2070-1.
DR   EnsemblGenomes-Tr; SPT_2071-1.
DR   EnsemblGenomes-Tr; SPT_2072-1.
DR   EnsemblGenomes-Tr; SPT_2073-1.
DR   EnsemblGenomes-Tr; SPT_2074-1.
DR   EnsemblGenomes-Tr; SPT_2076-1.
DR   EnsemblGenomes-Tr; SPT_2077-1.
DR   EnsemblGenomes-Tr; SPT_2078-1.
DR   EnsemblGenomes-Tr; SPT_2253-1.
DR   EnsemblGenomes-Tr; SPT_2254-1.
DR   EnsemblGenomes-Tr; SPT_2258-1.
DR   EnsemblGenomes-Tr; SPT_2262-1.
DR   EnsemblGenomes-Tr; SPT_2263-1.
DR   EnsemblGenomes-Tr; SPT_2264-1.
DR   EnsemblGenomes-Tr; SPT_2265-1.
DR   EnsemblGenomes-Tr; SPT_2266-1.
DR   EnsemblGenomes-Tr; SPT_2268-1.
DR   EnsemblGenomes-Tr; SPT_2269-1.
DR   EnsemblGenomes-Tr; SPT_2271-1.
DR   EnsemblGenomes-Tr; SPT_2272-1.
DR   EnsemblGenomes-Tr; SPT_2282-1.
DR   EuropePMC; PMC3318815; 22307284.
DR   EuropePMC; PMC4122920; 24916661.
DR   EuropePMC; PMC6152367; 29856703.
DR   EuropePMC; PMC6375853; 30800118.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP000921.
DR   SILVA-SSU; CP000921.
DR   StrainInfo; 118681; 0.
XX
CC   Submission of strain to ATCC is pending.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2112148
FT                   /organism="Streptococcus pneumoniae Taiwan19F-14"
FT                   /strain="Taiwan19F-14"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:487213"
FT   gene            197..1558
FT                   /gene="dnaA"
FT                   /locus_tag="SPT_0001"
FT   CDS_pept        197..1558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SPT_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23662"
FT                   /db_xref="GOA:C1CU44"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CU44"
FT                   /protein_id="ACO23662.1"
FT                   /translation="MKEKQFWNRILEFAQERLTRSMYDFYAIQAELIKVEENVATIFLP
FT                   RSEMEMVWEKQLKDIIVVAGFEIYDAEITPHYIFTKPQDTTSSQVEEATNLTLYDYSPK
FT                   LVSIPYSDTGLKEKYTFDNFIQGDGNVWAVSAALAVSEDLALTYNPLFIYGGPGLGKTH
FT                   LLNAIGNEILKNIPNARVKYIPAESFINDFLDHLRLGEMEKFKKTYRSLDLLLIDDIQS
FT                   LSGKKVATQEEFFNTFNALHDKQKQIVLTSDRSPKHLEGLEERLVTRFSWGLTQTITPP
FT                   DFETRIAILQSKTEHLGYNFQSDTLEYLAGQFDSNVRDLEGAINDITLIARVKKIKDIT
FT                   IDIAAEAIRARKQDVSQMLVIPIDKIQTEVGNFYGVSIKEMKGSRRLQNIVLARQVAMY
FT                   LSRELTDNSLPKIGKEFGGKDHTTVIHAHVKIKSLIDQDDNLRLEIESIKKKIK"
FT   gene            1717..2853
FT                   /gene="dnaN"
FT                   /locus_tag="SPT_0002"
FT   CDS_pept        1717..2853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SPT_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23107"
FT                   /protein_id="ACO23107.1"
FT                   /translation="MIHFSINKNLFLQALNTTKRAISSKNAIPILSTVKIDVTNEGITL
FT                   IGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQI
FT                   VLTSGKSEITLKGKDSEQYPRIQEISASTPLILETKLLKKIINETAFAASTQESRPILT
FT                   GVHFVLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIEAV
FT                   EIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLL
FT                   SSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKA
FT                   LNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVRTN"
FT   gene            2918..3112
FT                   /locus_tag="SPT_0003"
FT   CDS_pept        2918..3112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0003"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF06107"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22512"
FT                   /protein_id="ACO22512.1"
FT                   /translation="MYQVGNFVEMKKSHACTIKSTGKKANRWEITRVGADIKIKCSNCE
FT                   HVVMMGRYDFERKMNKIID"
FT   gene            complement(3563..3982)
FT                   /locus_tag="SPT_0004"
FT   CDS_pept        complement(3563..3982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0004"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23810"
FT                   /protein_id="ACO23810.1"
FT                   /translation="MTPEQVKETLEGVKWINKEIEGLYLELATLESGIIKKQELSNTRV
FT                   QTSRVNTAENNLISVLKLKEDTLQRIERLTEERMEISRLIDKLANPLERSVLRLFYLNV
FT                   LEAWQVAEEIDRSKTTVYLIRQKAIEHLAGLVHAD"
FT   gene            4106..4297
FT                   /locus_tag="SPT_0005"
FT   CDS_pept        4106..4297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0005"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23481"
FT                   /protein_id="ACO23481.1"
FT                   /translation="MYNDGVKLIEVRGEGDSPRISLWFDKQLRDVFISLISLSFCKELR
FT                   QVISLLICLSFGKQQIQK"
FT   gene            complement(4601..4852)
FT                   /locus_tag="SPT_0006"
FT   CDS_pept        complement(4601..4852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0006"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22671"
FT                   /protein_id="ACO22671.1"
FT                   /translation="MKAIKNRLNKLNKLAVVDEVDTVFLTQIDTGHFEVRYRIGGKNPK
FT                   DIIEVYPTKEEAEKAISEIKNTKGLRIFWDNLALLEDN"
FT   gene            complement(4839..5180)
FT                   /locus_tag="SPT_0007"
FT   CDS_pept        complement(4839..5180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0007"
FT                   /product="phage replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22343"
FT                   /protein_id="ACO22343.1"
FT                   /translation="MANYLMTGNVKKASELSEITRKTAYNYLNDATFKRIYRERRSEQL
FT                   KESTTLLQNASVEAVNVLREIMLDKTVSPYARQQSAQSILNMAYKAVEMVEVVEQLEIL
FT                   EAKILDEGD"
FT   gene            complement(5231..5356)
FT                   /locus_tag="SPT_0008"
FT   CDS_pept        complement(5231..5356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23620"
FT                   /protein_id="ACO23620.1"
FT                   /translation="MDDFIKTPFKDIKLADYKKSKKRMDELREMTGISEFSELEQ"
FT   gene            complement(5560..6084)
FT                   /locus_tag="SPT_0009"
FT   CDS_pept        complement(5560..6084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0009"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23048"
FT                   /protein_id="ACO23048.1"
FT                   /translation="MTLKTFSDKAKTFNFTYEFKDQDTAQVAGSALMGYMIGTYVVPSI
FT                   SITYKNKGTLVAEYVEDHKLNKTFKRIRDGFKDYYKQPVNDEAFEERYKRERVLQLKES
FT                   EDFESLLNKVTDYELKLLDYAERLLSDKPILMDSMTAFGTLEMLGNESINLFQKLDVEG
FT                   EYKGLADYSGQ"
FT   gene            complement(6177..6374)
FT                   /locus_tag="SPT_0010"
FT   CDS_pept        complement(6177..6374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0010"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22560"
FT                   /protein_id="ACO22560.1"
FT                   /translation="MAMNICQRVIRLEETVERISEALDGFIENANHNAIVSNKNIERIQ
FT                   ESFEIVFKELDELKAVPDKH"
FT   gene            complement(6694..8259)
FT                   /locus_tag="SPT_0011"
FT   CDS_pept        complement(6694..8259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0011"
FT                   /product="DNA primase"
FT                   /note="identified by match to protein family HMM PF08706;
FT                   match to protein family HMM TIGR01613"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24047"
FT                   /protein_id="ACO24047.1"
FT                   /translation="MHGLSIEREVRTIELEELANLKSEILEVREQEQPPRTMWELYSRI
FT                   WELGDQWRKENSYIVNEGKKNERVEIPRPSVAIVAKALQEICHFTFIGEGVISDISKLY
FT                   LYHLDLGHYVSSNDIFRKLLLKYDSRLTSNKFFLELISYIRTETKMKPPLDDYRYIPVA
FT                   NGVYNIKTHKLEEFSPNFVITSKIQTEYNPCARKPILDGWFDFDRWLEALAVNDKEVVA
FT                   LLWQVINEAINPNRTRKKMVLMVGDGNNGKGTFQALLENLIGRSNISNLKPDQFGKEFY
FT                   LGALEGKVCNIGDDISNKYLDEVSDLMSVISGDPVQVNKKSLQPVEARFRLLCIFSGND
FT                   LPRARNKTMGWYRRLCIIPFRADFNGQKERHEIKDRFIKNKELLEWVLFKVLNMPDFDS
FT                   FIEPEAVQKMLSKYKNDNDYIKVWVENFYIPNGWHEINHVPMFIARNKLKEFAEDIGID
FT                   KPKLGQFSNAVMAELEKTTSYKYSAKNGTVSSKFYDVLDPQGFQRKRFVKGIWGIHLED
FT                   EDLG"
FT   gene            complement(8228..9088)
FT                   /locus_tag="SPT_0012"
FT   CDS_pept        complement(8228..9088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0012"
FT                   /product="phage protein"
FT                   /note="identified by match to protein family HMM PF08708"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22965"
FT                   /protein_id="ACO22965.1"
FT                   /translation="MTIYEARGFQSNLVYPFDKIEPFQYIERFKPLVVPESADPEEYKR
FT                   TQAPYCLSGKVMPEKNGSYKRNNTSLIYRDLIFLDYDDIQGTTEDFIEAVSSALFGYSY
FT                   ILYPTIKHSIEKPRFRLVVKSNNVMNEATYKQVVKEIADKIGLPFDMASLTWSQLQGLP
FT                   VTTGDPATYQKIVEHGLDYPVPKVEPRAKQGTTERYKPRVSGQRSMTMRIIDTLFNGFG
FT                   DEGGRNVALTRFVGLLFNKWVDCDLETAYELTKIANSVTVEPLPIEELDRTFSSIARAE
FT                   YRKRG"
FT   gene            complement(9085..9357)
FT                   /locus_tag="SPT_0013"
FT   CDS_pept        complement(9085..9357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAV62370.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22616"
FT                   /protein_id="ACO22616.1"
FT                   /translation="MFSLSRESEQDLAHGILEVVERYLEAREKVPPRLTKLINRVELKE
FT                   ELKISDNTLNKWESQGLRRYQPPDDGSRMIYYLVTDIWKFLGVDE"
FT   gene            complement(9350..9691)
FT                   /locus_tag="SPT_0014"
FT   CDS_pept        complement(9350..9691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0014"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22364"
FT                   /protein_id="ACO22364.1"
FT                   /translation="MSLSENDKRVLRLIKVGAENSITGSEISLTTKLTERTVRDIIKRL
FT                   VVKHNIPIVGVRCGVFSGYFIPANKGELLDGAKAFYNQVQEESKRLAVLMNSDLESYKE
FT                   TLKEVGGYV"
FT   gene            complement(9672..9848)
FT                   /locus_tag="SPT_0015"
FT   CDS_pept        complement(9672..9848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0015"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22235"
FT                   /protein_id="ACO22235.1"
FT                   /translation="MGLLTKQALDLETKTAILKALDTIIETQKAILQGVASGQITFVNK
FT                   SKGEEGLDESIRE"
FT   gene            complement(9962..10177)
FT                   /locus_tag="SPT_0016"
FT   CDS_pept        complement(9962..10177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0016"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23966"
FT                   /protein_id="ACO23966.1"
FT                   /translation="MNELDISNTQAAVLIVILIGLLLYLNHRDRKKSAQIERENQQTIK
FT                   TPSEDLNPEYGRYIQLAGVNVWGGME"
FT   gene            complement(10170..10436)
FT                   /locus_tag="SPT_0017"
FT   CDS_pept        complement(10170..10436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23698"
FT                   /protein_id="ACO23698.1"
FT                   /translation="MTKEEIRNILDELDDLTLGLNTAENAFDATFHFFSKNISTKEKTM
FT                   LLTLEYDTQSAIFNLAYDCLINAKENLVNTIRMYRKELEEKHE"
FT   gene            complement(10454..10594)
FT                   /locus_tag="SPT_0018"
FT   CDS_pept        complement(10454..10594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22827"
FT                   /protein_id="ACO22827.1"
FT                   /translation="MILDLGKMTQAEFDEVMADIKARNPNLLQLITDFLDRKVTPEEVD
FT                   D"
FT   gene            complement(10606..11106)
FT                   /locus_tag="SPT_0019"
FT   CDS_pept        complement(10606..11106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23025"
FT                   /protein_id="ACO23025.1"
FT                   /translation="MISDKLEAISTNLEEIQKSLVGAETALAKREISRVLNDLDDVYSE
FT                   LTSTEYHEQQQTIKEQTERMKQRVIAEVIGELEEREESYYRNFWGDTQFIKLLSNFDGF
FT                   LFLNTYLAEITKENTYPMEQSQLLNYVWELIAVDIAKKKRGKKNVLDSWTDSSLYTRGM
FT                   MID"
FT   gene            complement(11103..11243)
FT                   /locus_tag="SPT_0020"
FT   CDS_pept        complement(11103..11243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0020"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22563"
FT                   /protein_id="ACO22563.1"
FT                   /translation="MEETTYDIIAKSLDRISMELHQADENNDFSRIWVLSGQLKGQWRK
FT                   T"
FT   gene            complement(11644..11790)
FT                   /locus_tag="SPT_0021"
FT   CDS_pept        complement(11644..11790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23501"
FT                   /protein_id="ACO23501.1"
FT                   /translation="MEQYTKRASALIITFNRGVISQDEFIEEFTKLREKVVKAVSEAKN
FT                   DKL"
FT   gene            complement(11794..12222)
FT                   /locus_tag="SPT_0022"
FT   CDS_pept        complement(11794..12222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0022"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23955"
FT                   /protein_id="ACO23955.1"
FT                   /translation="MRKKHQVVKFKDIAEKLPELEGKRLEEITKVLGYRNLESCRTNLC
FT                   KLKQNNRLDFTLEKGVYSKFALLDGTVKEELEDKELSERGRYLKSVDRYKAMLNAFSIA
FT                   FDSTVKAETRQKAEHDGLKALDRIPDKHYALLYDMMEG"
FT   gene            complement(12376..12549)
FT                   /locus_tag="SPT_0023"
FT   CDS_pept        complement(12376..12549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0023"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22553"
FT                   /protein_id="ACO22553.1"
FT                   /translation="MTDKIKKVGRPKGENSNTVKLTVRVSEQLNSKLEEYGKKNGLTKP
FT                   ETLRKAFENLTK"
FT   gene            complement(12788..13036)
FT                   /locus_tag="SPT_0024"
FT   CDS_pept        complement(12788..13036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0024"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23057"
FT                   /protein_id="ACO23057.1"
FT                   /translation="MENEFKTVTNAKGVEIPKYFKDFKKLVEMDRQLAEYLCMNYELLD
FT                   SEDLGAFLETVEQGFSWILELIESKDLLYSPQTGKKA"
FT   gene            complement(13048..13653)
FT                   /locus_tag="SPT_0025"
FT   CDS_pept        complement(13048..13653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23755"
FT                   /protein_id="ACO23755.1"
FT                   /translation="MELVYMDGKKEPYTTSEIIAECAGVTHHTIQELLRKHKADFESYG
FT                   IIAFEMRKLDGRGRPMKIYRLNEQQATLLITYLRNTEPVRKFKMNLVKAFFEMRDELSK
FT                   RYLQRELEKPKRKTLTEAIKSWEKAPQHAYSTLTNLLLKGATGKNKAQLMQERESENGI
FT                   DSLTSAELTNYQRLEDMAIAMINLNMRYSEIKELIFKV"
FT   gene            complement(13675..13983)
FT                   /locus_tag="SPT_0026"
FT   CDS_pept        complement(13675..13983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0026"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23341"
FT                   /protein_id="ACO23341.1"
FT                   /translation="MNNKQVYQAQTTDHGIARALGEEIRMITDVEETTYNGHGEIIVEY
FT                   TSDVALTKLFDRIKALYEKGESYETKPFLHFKVLEDDIEPSPNGVFTAKEVAEFLGI"
FT   gene            14245..15591
FT                   /locus_tag="SPT_0027"
FT   CDS_pept        14245..15591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0027"
FT                   /product="Spn1 transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23780"
FT                   /protein_id="ACO23780.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKER
FT                   ISKYLATNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGF
FT                   FGDKTDSSTLIKNEVRMIMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVR
FT                   TGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPGRKASLMMH"
FT   gene            complement(15835..15987)
FT                   /locus_tag="SPT_0028"
FT   CDS_pept        complement(15835..15987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0028"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22476"
FT                   /protein_id="ACO22476.1"
FT                   /translation="MKQSEVAQKLGISTTTWSKWENGKSFPDVAQVKEIEKLFGVAYDD
FT                   IIFLS"
FT   gene            16230..16946
FT                   /locus_tag="SPT_0029"
FT   CDS_pept        16230..16946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0029"
FT                   /product="cI repressor"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22922"
FT                   /protein_id="ACO22922.1"
FT                   /translation="MADNIKRLLSAKGLNPRQLAIALDFKYTTVNDWVNAKTYPRIDKI
FT                   EMLANFFNVSKSDLVENKNAETPTTSLIQSIYDQLTPPRQAKALTYLKKQLLEQKNENI
FT                   VSENIISLDDYRESKTLPVIGVVTAGNGITQDDNLNIEKCFYTDEIPDDYDAIAYVVGN
FT                   SMEPKIKNGDYLFIKNTPQVDYNTIGIFQVDGANYVKKLRQGYLESLNPDCADIQLDES
FT                   NDIRTIGEVVGIYREK"
FT   gene            16965..17633
FT                   /locus_tag="SPT_0030"
FT   CDS_pept        16965..17633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0030"
FT                   /product="LIM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23624"
FT                   /protein_id="ACO23624.1"
FT                   /translation="MKFCPECGNSVVGCKFCPNCGYSINASLKTTPQKVATPSSRPSTV
FT                   RSKRTDKVGPLEIDKNHRTYRIHGARKAKGSSGLIGGTAKVVGKTTLALGTGGLSLIPS
FT                   LIKKDKNDTDWYSFDDLVSYELVINDQSVVSGGVGQALVAGAVFGVIGAVAGGIVAKRK
FT                   ATTKILNMTIRITSNDFTKPVVFIDLIKKPVKNTSKEYKEAIENAQKIIGALDVITHNS
FT                   "
FT   gene            17772..18440
FT                   /locus_tag="SPT_0031"
FT   CDS_pept        17772..18440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0031"
FT                   /product="Fic protein family"
FT                   /note="identified by match to protein family HMM PF02661"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23035"
FT                   /protein_id="ACO23035.1"
FT                   /translation="MTYSQNYLDDILVRMAYHSSGIEGNTISLPETVSIILESTLPRNG
FT                   KSIREFYEIENHKQAFSYLLDSLANHQALTVGLVQDFHALLVDRLQHDRGQFKQVQNAI
FT                   IGAEFQTASPAETPYLMTQWADNTAYRLEHAQNEKEVLEILADTHIQIERIHPFSDGNG
FT                   RTGRLILMYLAMKYLNAPIIIPKDSRAHYMELLANQNVTGLADLFKKSLDYERIRKKQF
FT                   "
FT   gene            complement(18904..19362)
FT                   /locus_tag="SPT_0032"
FT   CDS_pept        complement(18904..19362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23735"
FT                   /protein_id="ACO23735.1"
FT                   /translation="MVTDIEQARKNYMADYTPVDLTDAHKLLELAEKLQNEDISINTYE
FT                   LYKHPEAREKLFWQIAEATYMLLEDTGELQGATPTDEHLKTFVDYLEEKFNNIIKKLIA
FT                   GTDVAKLQGFLEAVEKDNPHLTKQQKGQLLKDTVVTELFKLWIKRRSK"
FT   gene            19720..19842
FT                   /locus_tag="SPT_0033"
FT   CDS_pept        19720..19842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24156"
FT                   /protein_id="ACO24156.1"
FT                   /translation="MENVNQAKEELKRIDELIAVRSSRIDFLEDKTLRITGNQR"
FT   gene            20266..20502
FT                   /locus_tag="SPT_0034"
FT   CDS_pept        20266..20502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0034"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:CAG39798.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23894"
FT                   /protein_id="ACO23894.1"
FT                   /translation="MILILPLNNKEFVMNKAWLFWSVIVLYFFIKFFDKVLDIKLFGSI
FT                   QIWLDNLPIPMKILLTIALVLFLFIVFPYRGKR"
FT   gene            20785..21090
FT                   /locus_tag="SPT_0035"
FT   CDS_pept        20785..21090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0035"
FT                   /product="replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22949"
FT                   /protein_id="ACO22949.1"
FT                   /translation="MEKWENQDKILLDKNKRGKDRNWRGRKLLSLKLADIFKELGYRET
FT                   LIERVETCGDTLRFIRREDGSLRLYQAYFCKNKLCPMCNWRRSMKYSYQTILVRLN"
FT   gene            21195..21755
FT                   /locus_tag="SPT_0036"
FT   CDS_pept        21195..21755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0036"
FT                   /product="putative DNA damage inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23266"
FT                   /protein_id="ACO23266.1"
FT                   /translation="MELQQYDELTFENIKHIDENGVEFWYARDLQKTLEYTEWRNFLLV
FT                   IDKAKIACDTAKNPIVEHFVDVNKSIPNGYNTTRDIKDFKLTRYACYLIVQNGDPRKEV
FT                   IALGQTYFALKTRQQELQENFDNLTEEQKRLAIRDEIKHHNKSLSESAESAENATYSLP
FT                   RATMFNNPEARAFSGFSKSSDLV"
FT   gene            22191..23357
FT                   /locus_tag="SPT_0037"
FT   CDS_pept        22191..23357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0037"
FT                   /product="integrase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23891"
FT                   /protein_id="ACO23891.1"
FT                   /translation="MKITEYTKKDGSTVYRSSVYLGIDTVTGKKVKTTISGRTKRELKA
FT                   KALQAQIDFEKDGSTVYKAVEIKTYAELVENWLETYCHTVKKSTLMGTKFKIDKYLLPA
FT                   FGNYRLDKLTPPIIQKQVNQWAKDYNQLGKGFQEYPLLHSLNKRILKYAVSLQAIPFNP
FT                   ARDVIVPRRKEKEGQKLKYLDDDNLKKFLTYLEQLPNTYKNFYDTVLYKTLLATGLRIR
FT                   ECLALKWSDIDLKNGTLDVNKTLNIIKEITGPKTKSSIRVIDLDNKTVLMLRLYKARQS
FT                   QIGKEMGLTYEKVFSNSFDKHIDARMLSFRLVKHLERAGCPRFTFHAFRHTHASILLNA
FT                   GLPYKEIQTRLGHAKLSMTMDIYSHLSKDNQKNATSFYEKAIEKLKSS"
FT   gene            23477..24592
FT                   /gene="ychF"
FT                   /locus_tag="SPT_0038"
FT   CDS_pept        23477..24592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="SPT_0038"
FT                   /product="GTP-binding protein YchF"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF06071; match to protein
FT                   family HMM TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22663"
FT                   /protein_id="ACO22663.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTEMITPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPLADIDTINLELILADLESVNKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTDEEQKVVKGLFLLTTKPVLYVANVDEDVVSEPD
FT                   SIDYVKQIREFAATENAEVVVISARAEEEISELDDEDKKEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGMKAPQAAGIIHSDFEKGFIRAVTMSYEDLVKYGS
FT                   EKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
FT   gene            24663..25232
FT                   /gene="pth"
FT                   /locus_tag="SPT_0039"
FT   CDS_pept        24663..25232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SPT_0039"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23241"
FT                   /db_xref="GOA:C1CNN8"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CNN8"
FT                   /protein_id="ACO23241.1"
FT                   /translation="MTKLLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIFQ
FT                   ADLASFFLNGEKIYLVKPTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKIRL
FT                   RAKGSAGGHNGIKSIIQHIGTQVFNRVKIGIGRPKNGMSVVHHVLSKFDRDEYIGILQS
FT                   VDKVDDSVNYYLQEKNFEKTMQRYNG"
FT   gene            25233..28742
FT                   /gene="mfd"
FT                   /locus_tag="SPT_0040"
FT   CDS_pept        25233..28742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="SPT_0040"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF02559; match to protein family HMM PF03461;
FT                   match to protein family HMM PF04851; match to protein
FT                   family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23583"
FT                   /protein_id="ACO23583.1"
FT                   /translation="MVTLLDLFSENDQIKKWHQNLTDKKRQLILGLSTSTKALAIASSL
FT                   EKEDRIVLLMSTYGEAEGLVSDLISILGEELVYPFLVDDAPMVEFLMSSQEKIISRVEA
FT                   LRFLTDSSKKGILVCNIAASRLILPSPNAFKDSIVKISVGEEYDQHAFIHQLKENGYRK
FT                   VTQVQTQGEFSLRGDILDIFEISQLEPCRIEFFGDEIDGIRSFEVETQLSKENKTELTI
FT                   FPASDMLLREKDYQRGQSALEKQISKTLSPILKSYLEEILSSFHQKQSHADSRKFLSLC
FT                   YDKTWTVFDYIEKDTPIFFDDYQKLMNQYEVFERELAQYFTEELQNSKAFSDMQYFSDI
FT                   EQIYKKQSPVTFFSNLQKGLGNLKFDKIYQFNQYPMQEFFNQFSFLKEEIERYKKMDYT
FT                   IILQSSNSMGSKTLEDMLEEYQIKLDSRDKTNICKESVNLIEGNLRHGFHFVDEKILLI
FT                   TEHEIFQKKLKRRFRRQHVSNAERLKDYNELEKGDYVVHHIHGIGQYLGIETIEIKGIH
FT                   RDYVSVQYQNGDQISIPVEQIHLLSKYISSDGKAPKLNKLNDGHFKKAKQKVKNQVEDI
FT                   ADDLIKLYSERSQLKGFAFSADDDDQDAFDDAFPYVETDDQLRSIEEIKRDMQASQPMD
FT                   RLLVGDVGFGKTEVAMRAAFKAVNDHKQVVILVPTTVLAQQHYTNFKERFQNFAVNIDV
FT                   LSRFRSKKEQTATLEKLKNGQVDILIGTHRVLSKDVVFADLGLMIIDEEQRFGVKHKET
FT                   LKELKKQVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLEKNDSVIRD
FT                   AVLREMERGGQVYYLYNKVDTIVQKVSELQELIPEASIGYVHGRMSEVQLENTLLDFIE
FT                   GQYDILVTTTIIETGVDIPNANTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRP
FT                   EKSISEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNLLGKSQSGFIDSVGFELYSQ
FT                   LLEEAIAKRNGNANANTRTKGNAELILQIDAYLPDTYISDQRHKIEIYKKIRQIDNRVN
FT                   YEELQEELIDRFGEYPDVVAYLLEIGLVKSYLDKVFVQRVERKDNKITIQFEKVTQRLF
FT                   LAQDYFKALSVTNLKAGIAENKELMELVFDVQNKKDYEILEGLLIFGESLLEIKESKEE
FT                   NSI"
FT   gene            28800..29066
FT                   /locus_tag="SPT_0041"
FT   CDS_pept        28800..29066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0041"
FT                   /product="ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S subunit"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22374"
FT                   /protein_id="ACO22374.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVND
FT                   QVEIRFGNKLLLVKVLEMKDSTKKEDAAGMYEIISETRVEENV"
FT   gene            29059..29427
FT                   /locus_tag="SPT_0042"
FT   CDS_pept        29059..29427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0042"
FT                   /product="septum formation initiator"
FT                   /note="identified by match to protein family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22619"
FT                   /protein_id="ACO22619.1"
FT                   /translation="MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIMLLF
FT                   ILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKY
FT                   YYSKSREKVYTIPDLLQR"
FT   gene            29432..29554
FT                   /locus_tag="SPT_0043"
FT   CDS_pept        29432..29554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24106"
FT                   /protein_id="ACO24106.1"
FT                   /translation="MENLLDVIEQFLGLSDEKLEELADKNQLLRLQEEKERKNA"
FT   gene            29547..30815
FT                   /locus_tag="SPT_0044"
FT   CDS_pept        29547..30815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0044"
FT                   /product="beta-lactamase class A"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23520"
FT                   /protein_id="ACO23520.1"
FT                   /translation="MRKFLIILLLPSFLTISKVVSTEKEVVYTSKEIYYLSQSDFGIYF
FT                   REKLSSPMVYGEVPVYANEDLVVESGELTPKTSFQITEWRLNKQGIPVFKLSNHQFIAA
FT                   DKRFLYDQSEVTPTIKKVWLESDFKLYNSPYDLKEVKSSLSAYSQVSIDKTMFVEGREF
FT                   LHIDQAGWVAKESTSEEDNRMSKVQEMLSEKYQKDSFSIYVKQLTTGKEAGINQDEKMY
FT                   AASVLKLSYLYYTQEKINEGLYQLDTTVKYVSAVNDFPGSYKPEGSGSLPKKEDNKEYS
FT                   LKDLITKVSKESDNVAHNLLGYYISNQSDATFKSKMSAIMGDDWDPKEKLISSKMAGKF
FT                   MEAIYNQNGFVLESLTKTDFDSQRIAKGVSVKVAHKIGDADEFKHDTGVVYADSPFILS
FT                   IFTKNSDYDTISKIAKDVYEVLK"
FT   gene            30812..32089
FT                   /locus_tag="SPT_0045"
FT   CDS_pept        30812..32089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0045"
FT                   /product="tRNA(Ile)-lysidine synthase
FT                   (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine
FT                   synthase)"
FT                   /EC_number="6.3.4.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432; match to protein
FT                   family HMM TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22868"
FT                   /db_xref="GOA:C1CNP4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CNP4"
FT                   /protein_id="ACO22868.1"
FT                   /translation="MREPDFLNHFLKKGYFKKHAKAVLALSGGLDSMFLFKVLSTYQKE
FT                   LEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFSEARARNFRYDFFQ
FT                   EVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQ
FT                   KKDFPSIFHFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIA
FT                   ELSNNINVEDLQQLFSYSESTQRVLLQTYLNRFPDLNLTKAQFAEVQQILKSKSQYRHP
FT                   IKNGYELIKEYQQFQICKISPQADEKEDELVLHYQNQVAYQGYLFSFGLPLEGESIQQI
FT                   PVSRETSIHIRHRKTGDVLIQNGHRKKLRRLFIDLKIPMEKRNSALIIEQFGEIVSILG
FT                   IATNNLSKKTKNDIMNTVLYIEKIDR"
FT   gene            32093..32635
FT                   /gene="hpt"
FT                   /locus_tag="SPT_0046"
FT   CDS_pept        32093..32635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SPT_0046"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24109"
FT                   /protein_id="ACO24109.1"
FT                   /translation="MLENDIKKVLVSHDEITEAAKKLGAQLTKDYAGKNPILVGILKGS
FT                   IPFMAELVKHIDTHIEMDFMMVSSYHGGTASSGVINIKQDVTQDIKGRHVLFVEDIIDT
FT                   GQTLKNLRDMFKAREAASVKIATLLDKPEGRVVEIEADYTCFTIPNEFVVGYGLDYKEN
FT                   YRNLPYIGVLKEEVYSN"
FT   gene            32651..34609
FT                   /locus_tag="SPT_0047"
FT   CDS_pept        32651..34609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0047"
FT                   /product="putative Cell division protease FtsH homolog"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23902"
FT                   /protein_id="ACO23902.1"
FT                   /translation="MKKQNNGLIKNPFLWLLFIFFLVTGFQYFYSGNNSGGSQQINYTE
FT                   LVQEITDGNVKELTYQPNGSVIEVSGVYKNPKTSKEGTGIQFFTPSVTKVEKFTSTILP
FT                   ADTTVSELQKLATDHKAEVTVKHESSSGIWINLLVSIVPFGILFFFLFSMMGNMGGGNG
FT                   RNPMSFGRSKAKAANKEDIKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAAPA
FT                   IIFIDEIDAVGRQRGVGLGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAEDVDLKLVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKSIIDASDIDEAEDRVIAGPSKKDKTVSQKERELVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMGGRVAEEIIFNV
FT                   QTTGASNDFEQATQMARAMVTEYGMSEKLGPVQYEGNHAMLGAQSPQKSISEQTAYEID
FT                   EEVRSLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDSTQIKALYETGKMPEAVEEE
FT                   SHALSYDEVKSKMNDEK"
FT   gene            34731..35210
FT                   /locus_tag="SPT_0048"
FT   CDS_pept        34731..35210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0048"
FT                   /product="competence-specific global transcription
FT                   modulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23467"
FT                   /protein_id="ACO23467.1"
FT                   /translation="MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISRE
FT                   EGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRRYDKEPYEEVGEISHRISEGGLWLD
FT                   DYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH"
FT   gene            35304..35378
FT                   /locus_tag="SPT_0049"
FT   tRNA            35304..35378
FT                   /locus_tag="SPT_0049"
FT                   /product="tRNA-Glu"
FT   gene            35641..37098
FT                   /gene="rrs1"
FT                   /locus_tag="SPT_0050"
FT   rRNA            35641..37098
FT                   /gene="rrs1"
FT                   /locus_tag="SPT_0050"
FT                   /product="16S ribosomal RNA"
FT   gene            37224..37301
FT                   /locus_tag="SPT_0051"
FT   tRNA            37224..37301
FT                   /locus_tag="SPT_0051"
FT                   /product="tRNA-Ala"
FT   gene            37422..40323
FT                   /gene="rrl1"
FT                   /locus_tag="SPT_0053"
FT   rRNA            37422..40323
FT                   /gene="rrl1"
FT                   /locus_tag="SPT_0053"
FT                   /product="23S ribosomal RNA"
FT   gene            40400..40515
FT                   /gene="rrf_1"
FT                   /locus_tag="SPT_0054"
FT   rRNA            40400..40515
FT                   /gene="rrf_1"
FT                   /locus_tag="SPT_0054"
FT                   /product="5S ribosomal RNA"
FT   gene            40521..40597
FT                   /locus_tag="SPT_0055"
FT   tRNA            40521..40597
FT                   /locus_tag="SPT_0055"
FT                   /product="tRNA-Asn"
FT   gene            complement(41353..41496)
FT                   /pseudo
FT                   /locus_tag="SPT_0056"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            complement(41544..41750)
FT                   /pseudo
FT                   /locus_tag="SPT_0057"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            42067..42303
FT                   /locus_tag="SPT_0058"
FT   CDS_pept        42067..42303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22450"
FT                   /protein_id="ACO22450.1"
FT                   /translation="MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRY
FT                   GIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC"
FT   gene            42492..43820
FT                   /gene="purA"
FT                   /locus_tag="SPT_0059"
FT   CDS_pept        42492..43820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SPT_0059"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22483"
FT                   /protein_id="ACO22483.1"
FT                   /translation="MYVRKEEPEGSDKIMTSVVVVGTQWGDEGKGKITDFLSANAEVIA
FT                   RYQGGDNAGHTIVIDGKKFKLHLIPSGIFFPEKISVIGNGMVVNPKSLVKELSYLHEEG
FT                   VTTDNLRISDRAHVILPYHIELDRLQEEAKGDNKIGTTIKGIGPAYMDKAARVGIRIAD
FT                   LLDKDIFRERLERNLAEKNRLFEKLYDSKAIVFDDIFEEYYEYGQQIKKYVIDTSVILN
FT                   DALDNGKRVLFEGAQGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKIDKVVGVCKA
FT                   YTSRVGDGPFPTELFDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNL
FT                   SLNSIDVLSGLDTVKICVAYDLDGQRIDYYPASLEQLKRCKPIYEELPGWSEDITGVRN
FT                   LEDLPENARNYVRRVSELVGVRISTFSVGPGREQTNILESVWS"
FT   gene            44021..44488
FT                   /locus_tag="SPT_0060"
FT   CDS_pept        44021..44488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0060"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24101"
FT                   /protein_id="ACO24101.1"
FT                   /translation="MYYTLEEKEVFMREALREAEIALEHDEIPIGCVIVKDGEIIGRGH
FT                   NAREELQRAVMHAEIMAIEDANLSKESWRLLDCTLFVTIEPCVMCSGAIGLARIPNVVY
FT                   GAKNQKFGAAGSLYDILTDERLNHRVEVEIGILEDECAAIMQDFFRNRRKK"
FT   gene            44524..44614
FT                   /gene="srpB"
FT                   /locus_tag="SPT_2262"
FT   ncRNA           44524..44614
FT                   /gene="srpB"
FT                   /locus_tag="SPT_2262"
FT                   /product="bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            44675..45118
FT                   /locus_tag="SPT_0061"
FT   CDS_pept        44675..45118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0061"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   (dUTPase) (dUTP pyrophosphatase)"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by match to protein family HMM PF00692"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23669"
FT                   /protein_id="ACO23669.1"
FT                   /translation="MKIRGFELVSSFTDENLLPKRETAHAAGYDLKVAVRTVVAPGEIV
FT                   LVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKN
FT                   ITDQEVVLEVGERIVQAVFATFLIADGDAADGVRTGGFGSTGH"
FT   gene            45078..45635
FT                   /locus_tag="SPT_0062"
FT   CDS_pept        45078..45635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0062"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23209"
FT                   /protein_id="ACO23209.1"
FT                   /translation="MAFELVDLDRQGTRMKIIFVRHGEPDYRELEERSYIGFGIDLAPL
FT                   SEMGRQQVQKLSKNPLLSSAEIIVSSAVTRALETASYVVCATGLPLRVEPLLHEWQVYK
FT                   TGIENFETARRLFLENKGELLPNSPIQYETATEMKSRFLECMSKYREHQTVVVVAHRML
FT                   MRQFVPNEKIDFCQVIECELEI"
FT   gene            45748..47010
FT                   /gene="radA"
FT                   /locus_tag="SPT_0063"
FT   CDS_pept        45748..47010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SPT_0063"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22473"
FT                   /protein_id="ACO22473.1"
FT                   /translation="MEEVEVAEVKNARVSLTGEKTKPMKLAEVTSINVNRTKTEMEEFN
FT                   RVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQVGTVLYVSGEESAQQIKLRAERL
FT                   GDIDSEFYLYAETNMQSVRAEVERIQPDFLIIDSIQTIMSPEISGVQGSVSQVREVTAE
FT                   LMQLAKTNNIAIFIVGHVTKEGTLAGPRMLEHMVDTVLYFEGERHHTFRILRAVKNRFG
FT                   STNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPT
FT                   MFGNAKRTTTGLDFNRASLIMAVLEKRAGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVA
FT                   IASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINETAKLGFTKIYVPQNSLTGITL
FT                   PKEIQVIGVTTIQEVLKKVFA"
FT   gene            47083..47580
FT                   /locus_tag="SPT_0064"
FT   CDS_pept        47083..47580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0064"
FT                   /product="carbonate dehydratase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23841"
FT                   /protein_id="ACO23841.1"
FT                   /translation="MSYFEQFMQANQAYVALHGQLNLPLKPKTRVAIVTCMDSRLHVAQ
FT                   ALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGTREIVVLHHTDCGAQTFENEPFQE
FT                   YLKEELGVDVSDQDFLPFQDIEESVREDMQLLIESPLIPDDVIISGAIYNVDTGSMTVV
FT                   EL"
FT   gene            47605..48420
FT                   /locus_tag="SPT_0065"
FT   CDS_pept        47605..48420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0065"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24134"
FT                   /protein_id="ACO24134.1"
FT                   /translation="MKKSSILFIFILLLCIGLQYETIYYTDGSRSGAEYGLMGVSIFLA
FT                   LFYMIPALYFLFRIGKKWELPKKVLILSLLGGMFLSGWLSSFANTYIHDLLGVLFPDST
FT                   FLNAFESAIVAPLVEEPLKLLPLVFVLALIPVRKLKSLFLLGIASGLGFQMIEDIGYIR
FT                   TDLPEGFDFTISRILERIISGIASHWTFSGLAVVGVYLLYRAYKGQKVGKKQGLIFLGL
FT                   ALGTHFLFNSPFVELETELPLAIPVVTAIALYGFYHAYCFVEKHNELMT"
FT   gene            48565..49533
FT                   /locus_tag="SPT_0066"
FT   CDS_pept        48565..49533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0066"
FT                   /product="ribose-Phosphate pyrophosphokinase (rppk)
FT                   (phosphoribosylpyrophosphate synthetase) (p-rib-pp
FT                   synthetase) (prpp synthetase)"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22934"
FT                   /protein_id="ACO22934.1"
FT                   /translation="MSFSDLKLFALSSNKELAERVAQEIGIELGKSSVRQFSDGEIQVN
FT                   IEESIRGKHVFILQSTSSPVNDNLLEILIMVDALKRASAESVNVVMPYYGYARQDRKAR
FT                   AREPITSKLVANMLEVAGVDRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERRGMV
FT                   GSDYVVVSPDHGGVTRARKLAEFLKTSIAIIDKRRSVDKMNTSEVMNIIGKVEGKTCIL
FT                   IDDMIDTAGTICHAADALAEAGAVEVYASCTHPVLSGPATDNIQKSAIKKLVVLDTIYL
FT                   PEERLIDKIEQISIAHLLGDAIVRIHEKRPLSPLFDIEKKI"
FT   gene            complement(50077..50310)
FT                   /locus_tag="SPT_0067"
FT   CDS_pept        complement(50077..50310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23164"
FT                   /protein_id="ACO23164.1"
FT                   /translation="MFSQLHMREEQVLLAQDYASETARAEGLEQGLERGKVEGRAERKL
FT                   FAFLDIVRQGLLTSEVASQQLGMSVSEFEALL"
FT   gene            complement(50268..50594)
FT                   /locus_tag="SPT_0068"
FT   CDS_pept        complement(50268..50594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0068"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23271"
FT                   /protein_id="ACO23271.1"
FT                   /translation="MDSNYFSDDLAFHSFSMREDTTGEVLAITNNGQENHLVKMAFLEL
FT                   KNTEKPAKTRFASHGWSFSATNPLPSNRNEPLPKQINCWTTRAGPRRTGKCLVNYICEK
FT                   NKSC"
FT   gene            complement(50634..50948)
FT                   /locus_tag="SPT_0069"
FT   CDS_pept        complement(50634..50948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23602"
FT                   /protein_id="ACO23602.1"
FT                   /translation="MIAKKIFSNPEITCQFIRDMLDLPAKNVTILEGSDIHVLLSMPYS
FT                   VQDFYTSIDVLAELDNGTQVIIEIQVHHQNFFINHLWAYLCSQVNQNLEKIRQREGDTH
FT                   "
FT   gene            51240..53873
FT                   /locus_tag="SPT_0070"
FT   CDS_pept        51240..53873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0070"
FT                   /product="DNA polymerase I (POL I)"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00476;
FT                   match to protein family HMM PF01367; match to protein
FT                   family HMM PF02739; match to protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24257"
FT                   /protein_id="ACO24257.1"
FT                   /translation="MDKKKLLLIDGSSVAFRAFFALYQQLDRFKNAAGLHTNAIYGFQL
FT                   MLSHLLERVEPSHILVAFDAGKTTFRTEMYADYKGGRAKTPDEFREQFPFIRELLDHMG
FT                   IRHYELAQYEADDIIGTLDKLAEQDGFDITIVSGDKDLIQLTDEHTVVEISKKGVAEFE
FT                   AFTPDYLMEEMGLTPAQFIDLKALMGDKSDNIPGVTKVGEKTGIKLLLEHGSLEGIYEN
FT                   IDGMKTSKMKENLINDKEQAFLSKTLATIDTKAPIAIGLEDLVYSGPDVENLGKFYDEM
FT                   GFKQLKQALNVSSADVSESLDFTIVDQISQDMLSEESIFHFELFGENYHTDNLVGFAWS
FT                   CGDKLYATDKLELLQDPIFKDFLEKTSLRVYDFKKVKVLLQRFGVDLQAPAFDIRLAKY
FT                   LLSTVEDNEIATIASLYGQTYLVDDETFYGKGVKKAIPEREKFLEHLACKLAVLVETEP
FT                   ILLEKLSENGQLELLYDMEQPLAFVLAKMEIAGIMVKKETLLEMQAENELVIEKLTQEI
FT                   YELAGEEFNVNSPKQLGVLLFEKLGLPLEYTKKTKTGYSTAVDVLERLAPIAPIVKKIL
FT                   DYRQIAKIQSTYVIGLQDWILADGKIHTRYVQDLTQTGRLSSVDPNLQNIPARLEQGRL
FT                   IRKAFVPEWEDSVLLSSDYSQIELRVLAHISKDEHLIKAFQEGADIHTSTAMRVFGIER
FT                   PDDVTANDRRNAKAVNFGVVYGISDFGLSNNLGISRKEAKAYIDTYFERFPGIKNYMDE
FT                   VVREARDKGYVETLFKRRRELPDINSRNFNIRGFAERTAINSPIQGSAADILKIAMIQL
FT                   DKALVAGGYQTKMLLQVHDEIVLEVPKSELVEMKKLVKQTMEEAIQLSVPLIADENEGA
FT                   TWYEAK"
FT   gene            53958..54395
FT                   /locus_tag="SPT_0071"
FT   CDS_pept        53958..54395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0071"
FT                   /product="CoA binding protein"
FT                   /note="identified by match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22669"
FT                   /protein_id="ACO22669.1"
FT                   /translation="MSQEFINPSDGVIRQYLATSKTLAVVGLSDREETTSNRVTKEMQA
FT                   RGYKIIPVNPKAAGGEILGEKAYASLAEIPFPVDIVNVYRRSEFLPDVARDFLKADAKI
FT                   FWAQLGLESLEAKEILRDGGCDDIVMNRCIKREHTRLIEEA"
FT   gene            complement(54578..55588)
FT                   /locus_tag="SPT_0072"
FT   CDS_pept        complement(54578..55588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0072"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF03601"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23421"
FT                   /protein_id="ACO23421.1"
FT                   /translation="MSFLSKNGAGILVCLLISIVSWYLGGFFPVIGAPVFAIFMGMLLH
FT                   PFLSSYKQLDVGLTFSSKKLLQYAVILLGFGLNISQVFAVGQSSLPVILSTISIALIVA
FT                   YLFQRFFALDTKLATLIGVGSSICGGSAIAATAPVIHAKEKEVAQAISVIFFFNVLAAL
FT                   IFPTLGTWLHLSNDGFALFAGTAVNDTSSVTATASAWDSLYQTNTLESATIVKLTRTLA
FT                   IIPITLFLSYWQSREQKNKQGLQLKKVFPLFILHFILASLLTTLLTSLGVSSSFFTPLK
FT                   QLSKFLIIMAMSAIGLKTNLVAMVKSSGKSIVLGAVCWIAIILTSLGMQTLIGIF"
FT   gene            55737..56906
FT                   /locus_tag="SPT_0073"
FT   CDS_pept        55737..56906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0073"
FT                   /product="putative aminotransferase A"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22229"
FT                   /protein_id="ACO22229.1"
FT                   /translation="MDLTKRFNKQLDKIQVSLIRQFDQVISEIPGVLRLTLGEPDFTTP
FT                   DHVKEAAKRAIDQNQSYYTGMSGLLTLRQAASDFVKEKYQLDYAPENEILVTIGATEAL
FT                   SATLTAILEEGDKVLLPAPAYPGYEPIVNLVGAEIVEIDTTENGFVLTPEMLEKAILEQ
FT                   GDKLKAVILNYPANPTGITYSREQLEALAAVLRKYEIFVVCDEVYSELTYTGEAHVSLG
FT                   TMLRDQAIIINGLSKSHAMTGWRLGLIFAPAAFTAQLIKSHQYLVTAANTMAQHAAVEA
FT                   LTAGKNDAEPMKKEYIQRRDYIIEKMTALGFEIIKPDGAFYIFAKIPAGYNQDSFAFLK
FT                   DFAQKKAVAFIPGAAFGRYGECYVRLSYAASMETIKEAMKRLEEYMREA"
FT   gene            56903..57673
FT                   /gene="recO"
FT                   /locus_tag="SPT_0074"
FT   CDS_pept        56903..57673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="SPT_0074"
FT                   /product="DNA repair protein RecO"
FT                   /note="identified by match to protein family HMM PF02565;
FT                   match to protein family HMM TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22796"
FT                   /protein_id="ACO22796.1"
FT                   /translation="MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKRMFFVKHAGQSK
FT                   LAPVIQPLVLARFLLRINDDGLSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQ
FT                   DNQQDAPLFAFLQKTLELMEAGLDYQVLTNIFEIQILTRFGISLNFNECVFCHRVGQAF
FT                   DFSFKYGTCLCPEHYHEDERRCHLNPNIPYLLNQFQAIDFETLETISLKPGIKQELRQF
FT                   MDQLYEEYVGIHLKSKKFIDSLADWGQLLKEEKK"
FT   gene            57670..58662
FT                   /gene="plsX"
FT                   /locus_tag="SPT_0075"
FT   CDS_pept        57670..58662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SPT_0075"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504;
FT                   match to protein family HMM TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23367"
FT                   /db_xref="GOA:C1CNR5"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CNR5"
FT                   /protein_id="ACO23367.1"
FT                   /translation="MKKIAVDAMGGDYAPQAIVEGVNQALSDFSDIEVQLYGDEAKIKQ
FT                   YLTATERVSIIHTDEKIDSDDEPTRAIRNKKNASMVLAAKAVKDGEADAVLSAGNTGAL
FT                   LAAGFFIVGRIKNIDRPGLMSTLPTVDGKGFDMLDLGANAENTAQHLHQYAVLGSFYAK
FT                   NVRGIAQPRVGLLNNGTESSKGDPLRKETYELLAADESLNFIGNVEARDLMNGVADVVV
FT                   ADGFTGNAVLKSIEGTAMGIMGLLKTAITGGGLRAKLGALLLKDSLRGLKKQLNYSDVG
FT                   GAVLFGVKAPVVKTHGSSDAKAVYSTIRQIRTMLETDVVAQTAREFSGE"
FT   gene            58668..58901
FT                   /locus_tag="SPT_0076"
FT   CDS_pept        58668..58901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0076"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24242"
FT                   /protein_id="ACO24242.1"
FT                   /translation="MTEKEIFDRIVTIIQERQGEDFVVTESLSLKDDLDADSVDLMEFI
FT                   LTLEDEFSIEISDEEIDQLQNVGDVVKIIQGK"
FT   gene            58944..59237
FT                   /locus_tag="SPT_0077"
FT   CDS_pept        58944..59237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0077"
FT                   /product="mobile genetic element"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24215"
FT                   /protein_id="ACO24215.1"
FT                   /translation="MRNIGQAGKILADSGYQGLMKIYPQAQTPRKSSRLKPLTVEDKAC
FT                   NHALSKEISKVENIFAKVKTFKMFSTTYRNHRKRFGLRMNLIAGIINHELGF"
FT   gene            59440..59670
FT                   /locus_tag="SPT_0078"
FT   CDS_pept        59440..59670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0078"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22501"
FT                   /protein_id="ACO22501.1"
FT                   /translation="MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAARGLQL
FT                   GIKTRTWQGAATGAAGGAILGGVAYAATCWW"
FT   gene            59673..59798
FT                   /locus_tag="SPT_0079"
FT   CDS_pept        59673..59798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0079"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22548"
FT                   /protein_id="ACO22548.1"
FT                   /translation="MDFKSFIIGLVVGIFGPYMDDLIRKKFLKSSEKKTEKSVKK"
FT   gene            60385..62538
FT                   /locus_tag="SPT_0080"
FT   CDS_pept        60385..62538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0080"
FT                   /product="transport/processing ATP-binding protein ComA"
FT                   /EC_number="3.4.22.-"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412; match to protein family HMM TIGR01193"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23925"
FT                   /protein_id="ACO23925.1"
FT                   /translation="MKFGKRHYRPQVDQMDCGVASLAMVFGYYGSYYFLAHLRELAKTT
FT                   MDGTTALGLVKVAEEIGFETRAIKADMTLFDLPDLTFPFVAHVLKEGKLLHYYVVTGQD
FT                   KDSIHIADPDPGVKLTKLPRERFEEEWTGVTLFMAPSPDYKPHKEQKNGLLSFIPILVK
FT                   QRGLIANIVLATLLVTVINIVGSYYLQSIIDTYVPDQMRSTLGIISIGLVIVYILQQIL
FT                   SYAQEYLLLVLGQRLSIDVILSYIKHVFHLPMSFFATRRTGEIVSRFTDANSIIDALAS
FT                   TILSIFLDVSTVVIISLVLFSQNTNLFFMTLLALPIYTVIIFAFMKPFEKMNRDTMEAN
FT                   AVLSSSIIEDINGIETIKSLTSESQRYQKIDKEFVDYLKKSFTYSRAESQQKALKKVAH
FT                   LLLNVGILWMGAVLVMDGKMSLGQLITYNTLLVYFTNPLENIINLQTKLQTAQVANNRL
FT                   NEVYLVASEFEEKKTVEDLSLMKGDMTFKQVHYKYGYGRDVLSDINLTVPQGSKVAFVG
FT                   ISGSGKTTLAKMMVNFYDPSQGEISLGSVNLNQIDKKALRQYINYLPQQPYVFNGTILE
FT                   NLLLGAKEGTTQEDILRAVELAEIREDIERMPLNYQTELTSDGAGISGGQRQRIALARA
FT                   LLTDAPVLILDEATSSLDILTEKRIVDNLMALDKTLIFIAHRLTIAERTEKVVVLDQGK
FT                   IVEEGKHADLLAQGGFYAHLVNS"
FT   gene            62551..63900
FT                   /locus_tag="SPT_0081"
FT   CDS_pept        62551..63900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0081"
FT                   /product="transport protein ComB"
FT                   /note="identified by match to protein family HMM TIGR01000"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23758"
FT                   /protein_id="ACO23758.1"
FT                   /translation="MKPEFLESAEFYNRRYHNFSSSVIVPMALLLVFLLGFATVAEKEM
FT                   SLSTRATVEPSRILANIQSTSNNRILVNHLEENKLVKKGDLLVQYQEGAEGVQAESYAS
FT                   QLDMLKDQKKQLEYLQKSLQGGENHFPEEDKFGYQATFRDYISQAGSLRASTSQQNETI
FT                   ASQNAAASQTQAEIGNLISQTEAKIRDYQTAKSAIETGASLAGQNLAYSLYQSYKSQGE
FT                   ENPQTKVQAVAQVEAQISQLESSLATYRVQYAGSGTQQAYASGLSSQLESLKSQHLAKV
FT                   GQELTLLAQKILEAESGKKVQGNLLDKGKITASEDGVLHLNPETSDSSMVAEGTLLAQL
FT                   YPSLEREGKAKLTAYLSSKDVARIKVGDSVRYTTTHDAGNQLFLDSTITSIDATATKTE
FT                   KGNFFKIEAETNLTSEQAEKLRYGVEGRLQMITGKKSYLRYYLDQFLNKE"
FT   gene            64070..64777
FT                   /gene="purC"
FT                   /locus_tag="SPT_0082"
FT   CDS_pept        64070..64777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SPT_0082"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23023"
FT                   /db_xref="GOA:C1CNS2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CNS2"
FT                   /protein_id="ACO23023.1"
FT                   /translation="MSKQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQVAGK
FT                   GVLNNQISSFIFEKLNAAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRF
FT                   GVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIADDQQIAYLKEETRRINELLKV
FT                   WFAEIGLKLIDFKLEFGFDKDGKIILADEFSPDNCRLWDADGNHMDKDVFRRGLGELTD
FT                   VYEIVWEKLQELK"
FT   gene            64788..64922
FT                   /locus_tag="SPT_0083"
FT   CDS_pept        64788..64922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0083"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase (saicar synthetase)"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23543"
FT                   /protein_id="ACO23543.1"
FT                   /translation="MENLRLSTKRTQAEKVPQTFSLCRELGELTDVYEIVWEKLQGLK"
FT   gene            64979..68704
FT                   /locus_tag="SPT_0084"
FT   CDS_pept        64979..68704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0084"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF02769;
FT                   match to protein family HMM TIGR01857"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23218"
FT                   /protein_id="ACO23218.1"
FT                   /translation="MDKRIFVEKKADFQVKSESLVREFQHNLGLSSLKSIRIVQVYDVF
FT                   DLAEDLFAPAEKHIFSEQVTDHVLDEVSVQADLANYAFFAIESLPGQFDQCAASSQEAL
FT                   LLLGSSSDVTVNTAQLYLVNKDIDATELEAVKNYLLNPVDSRFKDITTGIAKQEFSESD
FT                   KIIPKLTFFESYTAEDFARYKAEQGMAMEVDDLLFIQDYFKSIGRVPTETELKVLDTYW
FT                   SDHCRHTTFETELKHIDFSASKFQKQLQSTYDKYIAMREELGRSEKPQTLMDMATIFGR
FT                   YERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNETHNHPTEIEPFGGAATC
FT                   IGGAIRDPLSGRSYVYQAMRISGAGDITAPISETRAGKLPQQVISKTAAHGYSSYGNQI
FT                   GLATTYVREYFHPGFVAKRMELGAVVGAAPKGNVVREKPEAGDVIILLGGKTGRDGVGG
FT                   ATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGNVTRLIKKSNDFGAGGVCVAI
FT                   GELADGLEIDLNKVPLKYQGLNGTEIAISESQERMAVVVRPEDVDTFVAECNKENIDAV
FT                   VVATVTEKPNLVMHWNGETIVDLERRFLDTNGVRVVVDAKVVDKDVKLPEERQTSAETL
FT                   ESDTLTVLSDLNHASQKGLQTIFDCSVGRSTVNHPLGGRYQLTPTEASVQKLPVQHGVT
FT                   HTASVIAQGFNPYVAEWSPYHGAAYAVIEVTARLVAAGANWSKARFSYQEYFERMDKQA
FT                   ERFGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEELTVPPTLVAFGVTTADSRKVLS
FT                   PEFKAVGENIYYIPGQALSAEIDFDLIKKNFAQFEAIQADHKVTSASAVKYGGVVESLA
FT                   LATFGNYIGAEVTLPELKTALTAQLGGFVFTSPEEIAGVEKVGQTKADFTLTVNGVKLD
FT                   GHKLDSAFQGTLEEVYPTEFTQAKELEEVPAVASDVVIKAKEKVEKPVVYIPVFPGTNS
FT                   EYDSAKAFEKEGAEVNLVPFVTLNEEAIVKSVETMVDNIDKTNILFFAGGFSAADEPDG
FT                   SAKFIVNILLNEKVRVAIDSFIARGGLIIGICNGFQALVKSGLLPYGNFEAANSTSPTL
FT                   FYNDANQHVAKMVETRIANTNSPWLAGVQVGDIHAIPVSHGEGKFVVTAEEFAELRDNG
FT                   QIFSQYVDFNGKPSMDSKYNPNGSVHAIEGITSKNGQIIGKMGHSERYEDGLFQNIPGN
FT                   KDQHLFASAVKHFTGK"
FT   gene            68797..70239
FT                   /gene="purF"
FT                   /locus_tag="SPT_0085"
FT   CDS_pept        68797..70239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SPT_0085"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22636"
FT                   /protein_id="ACO22636.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPDAAKLTYFGLHSLQHRGQEGAGIL
FT                   SNDQGQLKRHRDMGLLSEVFRNPANLDKLTGAGAIGHVRYATAGEASVDNIQPFLFRFH
FT                   DMQFGLAHNGNLTNAASLKKELEQRGAIFSATSDSEILAHLIRRSHNPSLMGKIKEALS
FT                   LVKGGFAYILLFEDKLIAALDPNGFRPLSIGKMANGAVVVSSETCAFEVIGAEWIRDLK
FT                   PGEIVIIDDEGIQYDSYTDDTQLAICSMEYIYFARPDSNIHGVNVHTARKRMGAQLARE
FT                   FKHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLIKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMVDDSIVRGTTSRRIVQLLKEAGATEVHVAIGSPALAYPCFYGID
FT                   IQTRQELIAANHTVEETRQIIGADSLTYLSIDSLIESIGIETDAPNGGLCVAYFDGDYP
FT                   TPLYDYEEDYRRSLEEKTSFYK"
FT   gene            70276..71298
FT                   /gene="purM"
FT                   /locus_tag="SPT_0086"
FT   CDS_pept        70276..71298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SPT_0086"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22289"
FT                   /db_xref="GOA:C1CNS6"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CNS6"
FT                   /protein_id="ACO22289.1"
FT                   /translation="MTNKNAYAQSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFGG
FT                   MFDLSKTGVKEPVLISGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYVATGKNEPAKLEQVVAGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVVEGDVLLGLASSGLHSNGYSLVRRVFADYTGEEVLPELEGKKLKEVLL
FT                   EPTRIYVKAVLPLIKEELVNGIAHITGGGFIENVPRMFADDLAAEIDESKVPVLPIFKA
FT                   LEKYGQIKHEEMFEIFNMGVGLMLAVSPENVERVKELLDEAVYEIGRIVKKENESVIIK
FT                   "
FT   gene            71295..71840
FT                   /gene="purN"
FT                   /locus_tag="SPT_0087"
FT   CDS_pept        71295..71840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SPT_0087"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24007"
FT                   /protein_id="ACO24007.1"
FT                   /translation="MKKIAVFASGNGSNFQVIAEEFPVEFVFSDHRDAYVLERAKQLGV
FT                   LSYAFELKEFESKADYEAALVELLEEHQIDLVCLAGYMKIVGPTLLSAYEGRIVNIHPA
FT                   YLPEFPGAHGIEDAWNAGVGQSGVTIHWVDSGVDTGQVIKQVRVPRLADDTIDRFEARI
FT                   HEAEYRLYPEVVKALFTD"
FT   gene            71924..72433
FT                   /locus_tag="SPT_0088"
FT   CDS_pept        71924..72433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0088"
FT                   /product="teicoplanin resistance protein"
FT                   /note="identified by match to protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23315"
FT                   /protein_id="ACO23315.1"
FT                   /translation="MLESKKTTRYVFYVYLMLLTWGILFKFETNPEFIAFFLAPRYINW
FT                   IPFSEPLIVDGKIVFAEILFNLISFIPLGVCFPLIKTNLSSLRIVGTGFLISLLFECLQ
FT                   YILAIGITDITDLTLNTLGVCVGLLIYQIFIRVFKSQTRKWINILGMLSLGFAYLVLLL
FT                   LHLIGV"
FT   gene            72458..74005
FT                   /gene="purH"
FT                   /locus_tag="SPT_0089"
FT   CDS_pept        72458..74005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SPT_0089"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22906"
FT                   /db_xref="GOA:C1CNS9"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CNS9"
FT                   /protein_id="ACO22906.1"
FT                   /translation="MTKRVLISVSDKAGIVEFAQELKKLGWEIISTGGTKVALDNAGVD
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDLDSHLEAAKDNKIELIDLVVVNLYP
FT                   FKETILKPDVTYADAVENIDIGGPSMLRSAAKNHASVTVVVDPADYAVVLDELAANGET
FT                   SYETRQRLAAKVFRHTAAYDALIAEYFTAQVGESKPEKLTLTYDLKQPMRYGENPQQDA
FT                   DFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDSPTVVALKHMNPCGI
FT                   GQADDIETAWDYAYESDPVSIFGGIVVLNREVDAATAEKMHGVFLEIIIAPSYTDEALA
FT                   ILINKKKNLRILALPFNAQEASEVEAEYTGVVGGLLVQNQDVVKESPADWQVVTKRQPT
FT                   ETEATALEFAWKAIKYVKSNGIIVTNDHMTLGVGPGQTNRVASVRLAIDQAKDRLDGAV
FT                   LASDAFFPFADNVEEIAKAGIKAIIQPGGSVRDQESIEAADKYGLTMVFTGVRHFRH"
FT   gene            74127..75389
FT                   /gene="purD"
FT                   /locus_tag="SPT_0090"
FT   CDS_pept        74127..75389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SPT_0090"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02655; match to protein
FT                   family HMM PF02843; match to protein family HMM PF02844;
FT                   match to protein family HMM PF08442; match to protein
FT                   family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22456"
FT                   /protein_id="ACO22456.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLESKDVEKVFVAPGNDGMTLDGLELV
FT                   NISISEHSKLIDFAKTNDVAWTFIGPDDALAAGIVDDFNQAGLKAFGPTRAAAELEWSK
FT                   DFAKEIMVKYGVPTAIYGTFSDFEEAKAYIEKHGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAAHEMLLDNKFGDSGARVVIEEFLEGEEFSLFAFVNGDKFYIMPTAQDHKRAYDGDK
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVDTIVKPVLEGVIKEGRPYLGVLYAGLILTADGPK
FT                   VIEFNARFGDPETQIILPRLTSDFAQNITDILDSKEPNIMWTDKGVTLGVVVASKGYPL
FT                   DYERGVELPAKTEGDVITYYAGAKFAENSRALLSNGGRVYMLVTTADTVKEAQASIYQE
FT                   LSQQKIEGLFYRTDIGSKAIK"
FT   gene            75792..76280
FT                   /gene="purE"
FT                   /locus_tag="SPT_0091"
FT   CDS_pept        75792..76280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SPT_0091"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23825"
FT                   /protein_id="ACO23825.1"
FT                   /translation="MKPVISIIMGSKSDWATMQKTAEVLDRFGVAYEKKVVSAHRTPDL
FT                   MFKHAEEARSRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGVDSLYSIVQ
FT                   MPGGVPVATMAIGEAGATNAALFALRLLSVEDKSIADALANFAEEQGKIAEESSNELI"
FT   gene            76267..77358
FT                   /gene="purK"
FT                   /locus_tag="SPT_0092"
FT   CDS_pept        76267..77358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SPT_0092"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF02222;
FT                   match to protein family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22852"
FT                   /protein_id="ACO22852.1"
FT                   /translation="MSSSKTIGIIGGGQLGQMMATSAIYMGHKVIALDPAADCPASRVA
FT                   EIIVAPYNDVDALRQLADRCDVLTYEFENVDADGLDAVIKDGQLPQGTDLLRISQNRIF
FT                   EKDFLSNKAQVTVAPYKVVTSSLDLADIDLSKNYVLKTATGGYDGHGQKVIRSEADLEA
FT                   AYALADSADCVLEEFVNFDLEISVIVSGNGKEVTFFPVQENIHRNNILSKTIVPARISE
FT                   SLADKAKAMAVRIAEQLNLSGTLCVEMFATDDDVIVNEIAPRPHNSGHYSIEACDFSQF
FT                   DTHILGVLGAPLPVIKLHAPAVMLNVLGQHVEAAEQYVTENSSAHLHMYGKIEAKHNRK
FT                   MGHVTLFSDVPDSVDELGEGIDF"
FT   gene            77368..77595
FT                   /locus_tag="SPT_0093"
FT   CDS_pept        77368..77595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22841"
FT                   /protein_id="ACO22841.1"
FT                   /translation="MIQIIVNTFIEKDKTGAVVEVLYASADQDKVQAKYEELAAQYPEN
FT                   YLAIYDVPLDTDLNTLDHYPSVFIEKEEFE"
FT   gene            77658..78956
FT                   /gene="purB"
FT                   /locus_tag="SPT_0094"
FT   CDS_pept        77658..78956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SPT_0094"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00928"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22277"
FT                   /protein_id="ACO22277.1"
FT                   /translation="MINRYSRPEMANIWSEENKYRAWLEVEILSDEAWAELGEIPKEDV
FT                   ALIRKKADFDIDRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIIADKAKEHKFTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCDKLGIRAQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMITAYENVALWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MIRNMNSTFGLIFSQRAMLTLIEKGMTREQAYDLVQPKTAYSWDNQVDFKPLLEADSEV
FT                   TSRLTQEEIDEIFNPVYYTKRVDDIFERLGLGD"
FT   gene            complement(79011..82949)
FT                   /locus_tag="SPT_0095"
FT   CDS_pept        complement(79011..82949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0095"
FT                   /product="beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="identified by match to protein family HMM PF00728;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF04650; match to protein family HMM PF07501;
FT                   match to protein family HMM TIGR01167; match to protein
FT                   family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24022"
FT                   /protein_id="ACO24022.1"
FT                   /translation="MKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTTTTTENQ
FT                   PTIHTVSDSPQSSENRTEETPKAELQPEAPKTVETETPATDKVASLPKTEEKPQEEVSS
FT                   TPSDKAEVVTPTSAEKETANKKEEEASPKKEEAKEVDSKESNTDKTDKDKPAKKDEAKA
FT                   EADKPETETGKERAATVNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLL
FT                   VGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYA
FT                   KDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKAL
FT                   IDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYAN
FT                   DLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKG
FT                   HQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAW
FT                   ADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQTLNEVPKDLNRYTAESVAAVKE
FT                   AEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTPEAQKEEEAKREVEKLAKNKVI
FT                   SIDAGRKYFTLNQLKRIVDKASELGYSDVHLLLGNDGLRFLLDDMTITANGKTYASDDV
FT                   KKAIIEGTKAYYDDPNGTALTQAEVTELIEYAKSKDIGLIPAINSPGHMDAMLVAMEKL
FT                   GIKNPQAHFDKVSKTTMDLKNEEAMNFVKALIGKYMDFFAGKTKIFNFGTDEYANDATS
FT                   AQGWYYLKWYQLYGKFAEYANTLAAMAKERGLQPMAFNDGFYYEDKDDVQFDKDVLISY
FT                   WSKGWWGYNLASPQYLASKGYKFLNTNGDWYYILGQKPEDGGGFLKKAIENTGKTPFNQ
FT                   LASTKYPEVDLPTVGSMLSIWADRPSAEYKEEEIFELMTAFADHNKDYFRANYNALREE
FT                   LAKIPTNLEGYSKESLEALDAAKTALNYNLNRNKQAELDTLVANLKAALQGLKPAATHS
FT                   GSLDENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISV
FT                   LTENGKTTETVLDSQVTKEVINQVVEVGAPVTHKGDESGLAPTTEVKPRLDIQKEEIPF
FT                   TTVTRENPLLLKGKTQVITKGVNGHRSNFYSVSTSADGKEVKTLVNSVVAQEAVTQIVE
FT                   VGTMVTHVGDENGQAAIAEEKPKLEIPSQPAPSTAPAEESKALPQDPAPVVIEKKLPET
FT                   GTHDSAGLVVAGLMATLAAYGLTKRKED"
FT   gene            complement(83265..84008)
FT                   /locus_tag="SPT_0096"
FT   CDS_pept        complement(83265..84008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0096"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23096"
FT                   /protein_id="ACO23096.1"
FT                   /translation="MEKENRGKNMAIPKYQYIKDELKNKIISGQFSSGDKFYTEAELIS
FT                   MYDVSSITVVRALNDLAKDGYIVRQQGKGTFISRARKHKLVEFSDIELFNAKDDKVTVL
FT                   SIERGNKLVYLEKLGLRGDQFYYKIERIRESNGVVYIYHTSYIPEQYINANYPNLEYYS
FT                   SIYNRFKLDYHIHMNDEHFEEINEIVFPTPEHAASVLGVDEHFPTVLQTKITKLESTGQ
FT                   VLEYSETYKRSDYYKIKFISCDRDH"
FT   gene            84329..86116
FT                   /locus_tag="SPT_0097"
FT   CDS_pept        84329..86116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0097"
FT                   /product="beta-galactosidase (Lactase)"
FT                   /EC_number="3.2.1.23"
FT                   /note="identified by match to protein family HMM PF01301;
FT                   match to protein family HMM PF02449"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24222"
FT                   /protein_id="ACO24222.1"
FT                   /translation="MTRFEIRDDFYLDGKSFKILSGAIHYFRVPPEDWYHSLYNLKALG
FT                   FNTVETYVAWNLHEPREGEFHFEGDLDLEKFLQIAQDLGLYAIVRPSPFICAEWEFGGL
FT                   PAWLLTKNMRIRSSDPAYIEAVGRYYDQLLPRLVPRLLDNGGNILMMQVENEYGSYGED
FT                   KAYLRAIRQLMEECGVTCPLFTSDGPWRATLKAGTLIEEDLFVTGNFGSKAPYNFSQMQ
FT                   EFFDEHGKKWPLMCMEFWDGWFNRWKEPIITRDPKELADAVREVLEQGSINLYMFHGGT
FT                   NFGFMNGCSARGTLDLPQVTSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYPQLEPLY
FT                   KESMELDAIPLVEKVSLFETLDSLSSPVESLYPQKMEELGQSYGYLLYRTETNWDAEEE
FT                   RLRIIDGRDRAQLYVDGQWVKTQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHK
FT                   FLADTQRKGIRTGVCKDLHFLLNWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEE
FT                   PKDTYLDLSEFGKGVAFVNGQNLGRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYK
FT                   EEIHLTRKPTLKHIKGENL"
FT   gene            86113..86589
FT                   /locus_tag="SPT_0098"
FT   CDS_pept        86113..86589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0098"
FT                   /product="phosphotransferase system sugar-specific eiib
FT                   component"
FT                   /note="identified by match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23707"
FT                   /protein_id="ACO23707.1"
FT                   /translation="MTIVGCRIDGRLIHGQVANLWAGKLNVSRIMVVDDEVVNNDIEKS
FT                   GLKLATPPGVKLSILPVEKAAANILAGKYDSQRLFIVARKPDRFLGLVEAGVPLETLNV
FT                   GNMSQTPETRSITRSINVVDKDVEDFHKLAEKGVKLTAQMVPNDPISDFLSLLK"
FT   gene            86617..87522
FT                   /locus_tag="SPT_0099"
FT   CDS_pept        86617..87522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0099"
FT                   /product="PTS system, IIC component"
FT                   /note="identified by match to protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23062"
FT                   /protein_id="ACO23062.1"
FT                   /translation="MIQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGDV
FT                   TTGLLIGGNLQLFVLGVGTFGGASRIDATSGAVLATAFSVSQGIDAPLAITTIAVPVAA
FT                   LLTYFDVLGRMTTTFFAHRVDAAIERFDYKGIERNYLLGAIPWALSRALPVFFALAFGG
FT                   AFVQSVVDFVEAYKWVADGLTLAGRMLPGLGFAILLRYLPVKRNLHYLAMGFGLTAMLT
FT                   VLYSYVTGLGGAVAGIVGTLPAEVAEKIGFVNNFKGLSMIGISIVGIFLAVLHFKNSQK
FT                   VAVAAPSTPSESGEIEDDEF"
FT   gene            87509..88324
FT                   /locus_tag="SPT_0100"
FT   CDS_pept        87509..88324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0100"
FT                   /product="PTS system, IID component"
FT                   /note="identified by match to protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23399"
FT                   /protein_id="ACO23399.1"
FT                   /translation="MTNSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLYMILPQ
FT                   LRKMYGDGTPELKEMMKVHTQFFNTSPFFHTIIAGFDLAMEEKDGVGSKDAVNGIKTGL
FT                   MGPFAPLGDTIFGSLVPAIMGSVAATMAIAGQPWGIFLWIAVAVAYDIFRWKQLEFAYK
FT                   EGVNLINNMQSTLTALIDAASVLGVFMMGALVATVINFEISYKLPIGEKMIDFQDILNQ
FT                   IFPRLLPAIFTAFIFWLLGKKGMNSTKAIGIIIVLALALSALGHFALGM"
FT   gene            88331..88735
FT                   /locus_tag="SPT_0101"
FT   CDS_pept        88331..88735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0101"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23822"
FT                   /protein_id="ACO23822.1"
FT                   /translation="MTKSLILVSHGRFCEELRGSTEMIMGPQDNIYTVALLPEDGPEEF
FT                   TAKFEAVIEGLDDFLVFADLLGGTPCNVVSRLIMEGRDIDLYAGMNLPMVIEFINASLT
FT                   GADADYKSRAAESIVKVNDLLAGFDDDEDE"
FT   gene            89029..90195
FT                   /locus_tag="SPT_0102"
FT   CDS_pept        89029..90195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0102"
FT                   /product="putative tagatose-6-phosphate ketose/aldose
FT                   isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22445"
FT                   /protein_id="ACO22445.1"
FT                   /translation="MLHYTKEDLLELGAEITTREIYQQPDVWREAFEFYQAKREEIAAF
FT                   LQEIADKHDYIKVILTGAGTSAYVGDTLLPYFKEVYDERKWNFNAIATTDIVANPATYL
FT                   KKDVATVLVSFARSGNSPESVATVDLAKSLVDELYQVTITCAADGKLALQAHGDDRNLL
FT                   LLQPAVSNDAGFAMTSSFTSMMLTALLVFDPTEFAVKSERFEVVSSLARKVLDKAEDVK
FT                   ELVDLDFNRVIYLGAGPFFGLAHEAQLKILELTAGQVATMYESPVGFRHGPKSLINDNT
FT                   VVLVFGTTTDYTRKYDLDLVREVAGDQIARRVVLLSDQAFGLENVKEVALGCGGVLNDI
FT                   YRVFPYIVYAQLFALLTSLKVENKPDTPSPTGTVNRVVQGVIIHEYQK"
FT   gene            90311..91348
FT                   /locus_tag="SPT_0103"
FT   CDS_pept        90311..91348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0103"
FT                   /product="aldose 1-epimerase"
FT                   /note="identified by match to protein family HMM PF01263"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22351"
FT                   /protein_id="ACO22351.1"
FT                   /translation="MKAYTERVFGNVEGEDVLAYRFETDGGYQLEVMTYGATILRYVAP
FT                   DKAGNFANVILGFDDFDSYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNASNC
FT                   NHSGSTGWDSSLFEVEEVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYETIYK
FT                   VTTDQDTLVNPTNHSYFNLSGDFTQTIDRHVFQLNTEGIYSIAPDGVPAKTPEANRDVV
FT                   KHIYNGTLLKDIFAEEDEQIQLASGLDHPFALPAGHDNAGFLYDQNSGRFLLFKTEAPC
FT                   FVVYTANFVDESVIIGGQPMLQHNGIALEAQALPDAIHSDLKGQVILKAGQTFTSKTRY
FT                   ELVVK"
FT   gene            91555..92409
FT                   /locus_tag="SPT_0104"
FT   CDS_pept        91555..92409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0104"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22967"
FT                   /protein_id="ACO22967.1"
FT                   /translation="MTYEYKSHIYLAETVLNVKDLASQTAFYQQVIGLEILSQTETESI
FT                   LGLGGKVLVQLIQAQESGEVREHYGLYHLAILLPTRKALADVLKHLTDLQIPLVGGADH
FT                   GYSEAIYLEDLEGNGIELYRDKPVSTWDIREDGRIIGVTEALAAQDIYELGERVEPFIL
FT                   AEGTRMGHIHLSVKDSRKSSQFYQKVLGLEDKFSVPSASWIAAGDYHHHLAVNEWGGKG
FT                   LASRKQGLPGLAYYVIEVAHKKELLTIAQRAQEVDAPIKWMTSSQLEITDSDGIVTRIR
FT                   LAR"
FT   gene            92559..92816
FT                   /locus_tag="SPT_0105"
FT   CDS_pept        92559..92816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02583"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24254"
FT                   /protein_id="ACO24254.1"
FT                   /translation="MTNSKYITCLKRSEGQLCGIQKMIEGDRDCADIVTQLTAVRSSVE
FT                   RVIEMIITENLTECINQPLDDSEAQKERLEKAIRYLIKRK"
FT   gene            complement(92858..93220)
FT                   /locus_tag="SPT_0106"
FT   CDS_pept        complement(92858..93220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0106"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22683"
FT                   /protein_id="ACO22683.1"
FT                   /translation="MKIKVQTRKLAASCSKHCFKVVDGTDEVSSKHCFEVVDRTDEVSN
FT                   HIYGKVKLTWFEEIFEEYKSLHNKTHSTKVLMNCTPKVRQKKSNFWGSVHSTPDTMRFF
FT                   NFKDFLQLLLTHIKLF"
FT   gene            complement(93274..93570)
FT                   /locus_tag="SPT_0107"
FT   CDS_pept        complement(93274..93570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23512"
FT                   /protein_id="ACO23512.1"
FT                   /translation="METSISMADFYGKYQNENLELIDVREAHEFQAGHAPGAKNLPLST
FT                   LEQGYKELKPDHEYYVICQGGVRSASTCQFLSSQGLTVTNVEGGMNAWPGQVE"
FT   gene            complement(93560..93679)
FT                   /locus_tag="SPT_0108"
FT   CDS_pept        complement(93560..93679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0108"
FT                   /product="coenzyme A disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23909"
FT                   /protein_id="ACO23909.1"
FT                   /translation="MRSYIAEPILKQAGFTAQNLDGAYSLYKMVNPEGVEYGN"
FT   gene            93791..94555
FT                   /locus_tag="SPT_0109"
FT   CDS_pept        93791..94555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0109"
FT                   /product="phosphorylase, Pnp/Udp family"
FT                   /note="identified by match to protein family HMM PF01048"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22653"
FT                   /protein_id="ACO22653.1"
FT                   /translation="MIQKHAIPILEFDDNPQAVIMPNHEGLDLQLPKKCVYAFLGEEID
FT                   RYAREVGANCVGEFVSATKTYPVYVINYKGEEVCLAQAPVGSAPAAQFMDWLIGYGVEQ
FT                   IISTGTCGVLADIEENAFLVPVRALRDEGASYHYVAPCRYMEMQPEAIAAIEEVLEDRG
FT                   IPYEEIMTWTTDGFYRETAEKVAYRKEEGCAVVEMECSALAAVAQLRGVLWGELLFTAD
FT                   SLADLDQYDSRDWGSEAFNKALELSLASVHHL"
FT   gene            complement(94795..94947)
FT                   /locus_tag="SPT_0110"
FT   CDS_pept        complement(94795..94947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24015"
FT                   /protein_id="ACO24015.1"
FT                   /translation="MRTKASLRKLVTGYSKHCFEVVDRTDEVSSKHCFEVADRTDEVSN
FT                   IYTAR"
FT   gene            95165..96544
FT                   /locus_tag="SPT_0111"
FT   CDS_pept        95165..96544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0111"
FT                   /product="Trk transporter membrane-spanning protein-K+
FT                   transport"
FT                   /note="identified by match to protein family HMM PF02386"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23545"
FT                   /protein_id="ACO23545.1"
FT                   /translation="MLFKLSKEKIELGLSRLSPARRIFLSFALVILLGSLLLSLPFVQV
FT                   ESSRATYFDHLFTAVSAVCVTGLSTLPVAHTYNIWGQIICLLLIQIGGLGLMTFIGVFY
FT                   IQSKQKLSLRSRATIQDSFSYGETRSLRKFVYSIFLTTFLVESLGAILLSFRLIPQLGW
FT                   GRGLFSSIFLAISAFCNAGFDNLGSTSLFAFQTDLLVNLVIAGLIITGGLGFMVWFDLA
FT                   GHVGRKKKGRLHFHTKLVLLLTIGLLLFGTATTLFLEWNNAGTIGNLPVADKVLVSFFQ
FT                   TVTMRTAGFSTIDYTQAHPVTLLIYILQMFLGGAPGGTAGGLKITTFFVLLVFARSELL
FT                   GLPHANVARRTIASRTVQKSFSVFIIFLMSFLIGLILLGITAKGNPPFIHLIFETISAL
FT                   STVGVTANLTPDLGKLALSVIMPLMFMGRIGPLTLFVSLADYHPEKKDMIHYMKADISI
FT                   G"
FT   gene            96558..97223
FT                   /locus_tag="SPT_0112"
FT   CDS_pept        96558..97223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0112"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23235"
FT                   /protein_id="ACO23235.1"
FT                   /translation="MSDRTIGILGLGIFGSSVLAALAKQDMNIIAIDDHAERINQFEPV
FT                   LARGVIGDITDEELLRSAGIDTCDTVVVATGENLESSVLAVMHCKSLGVPTVIAKVKSQ
FT                   TAKKVLEKIGADSVISPEYEMGQSLAQTILFHNSVDVFQLDKNVSIVEMKIPQSWAGQS
FT                   LSKLDLRGKYNLNILGFREQENSPLDVEFGPDDLLKADTYILAVINNQYLDTLVALNS"
FT   gene            97358..97516
FT                   /locus_tag="SPT_0113"
FT   CDS_pept        97358..97516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0113"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22778"
FT                   /protein_id="ACO22778.1"
FT                   /translation="MKIKDQTRKLATGCSKHCFEVVDRTDEVSSKHCFEVADRTDEVSN
FT                   IYTARRR"
FT   gene            97578..98594
FT                   /pseudo
FT                   /locus_tag="SPT_0115"
FT                   /note="glycosyltransferases involved in cell wall
FT                   biogenesis, authentic point mutation; this gene contains a
FT                   premature stop which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF00535"
FT   gene            98710..101739
FT                   /locus_tag="SPT_0116"
FT   CDS_pept        98710..101739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0116"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF04650; match to protein
FT                   family HMM TIGR01167; match to protein family HMM
FT                   TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23453"
FT                   /protein_id="ACO23453.1"
FT                   /translation="MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADVV
FT                   NPTPGQVLPEETSGTKEGDLSEKPGDTVLTQAKPEGVTGNTNSLPTPTERTEVSEETNS
FT                   SSLDTLFEKDEEAQENPELTDALKETVDTADVDGTQASPAETTPEQVKGGVKENTKDSI
FT                   DVPAAYLEKAEGKGPFTAGVNQVIPYELFAGDGMLTRLLLKASDNAPWSDNGTAKNPAL
FT                   PPLEGLTKGKYFYEVDLNGNTVGKQGQALIDQLRANGTQTYKATVKVYGNKDGKADLTN
FT                   LVATKNVDININGLVAKETVEKAVKDNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYE
FT                   LFAGDGMLTRLLLKASDKAPWSDNGEAKNPALSPLGENVKTKGQYFYQVALDGNVAGKE
FT                   KQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTININGLISKETVQKAVA
FT                   DNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNG
FT                   DAKNPALSPLGENVKTKGQYFYQVALDGNVAGKEKQALIDQFRANGTQTYSATVNVYGN
FT                   KDGKPDLDNIVATKKVTININGLISKETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTA
FT                   GVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNGEAKNPALSPLGENVKTKGQYFYQVA
FT                   LDGNVAGKEKQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTININGLIS
FT                   KETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYELFAGDGMLTRLLLKAS
FT                   DKAPWSDNGEAKNPALSPLGENVKTKGQYFYQVALDGNVAGKEKQALIDQFRANGTQTY
FT                   SATVNVYGNKDGKPDLDNIVATKKVTIKINVKETSDTANGSLSPSNSGSGVTPMNHNHA
FT                   TGTTDSMPADTMTSSTNTMAGENMAASANKMSDTMMSEDKAMLPNTGETQTSMASIGFL
FT                   GLALAGLLGGLGLKNKKEEN"
FT   gene            101906..102604
FT                   /locus_tag="SPT_0117"
FT   CDS_pept        101906..102604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0117"
FT                   /product="response regulator SaeR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23113"
FT                   /protein_id="ACO23113.1"
FT                   /translation="MGKTILLVDDEVEITDIHQRYLIQAGYQVLVAHDGLEALELFKKK
FT                   PIDLIITDVMMPRMDGYDLISEVQYLSPEQPFLFITAKTSEQDKIYGLSLGADDFIAKP
FT                   FSPRELVLRVHNILRRLHRGGETELISLGNLKMNHSSHEVQIGEEMLDLTVKSFELLWI
FT                   LASNPERVFSKTDLYEKIWKEDYVDDTNTLNVHIHALRQELAKYSSDQTPTIKTVWGLG
FT                   YKIEKPRGQT"
FT   gene            102601..103653
FT                   /locus_tag="SPT_0118"
FT   CDS_pept        102601..103653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0118"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22222"
FT                   /protein_id="ACO22222.1"
FT                   /translation="MKLKSYILVGYIISTLLTILVVFWAVQKMLIAKGEIYFLLGMTIV
FT                   ASLVGAGISLFLLLPVFTSLGKLKEHAKRVAAKDFPSNLEVQGPVEFQQLGQTFNEMSH
FT                   DLQVSFDSLEESEREKGLMIAQLSHDIKTPITSIQATVEGILDGIIKESEQAHYLATIG
FT                   RQTERLNKLVEELNFLTLNTARNQVETTSKDSIFLDKLLIECMSEFQFLIEQERRDVHL
FT                   QVIPESARIEGDYAKLSRILVNLVDNAFKYSAPGTKLEVVAKLEKDQLSISVTDEGQGI
FT                   APEDLENIFKRLYRVETSRNMKTGGHGLGLAIARELAHQLGGEITVSSQYGLGSTFTLV
FT                   LNLSGSENKA"
FT   gene            103848..104459
FT                   /gene="rpsD"
FT                   /locus_tag="SPT_0119"
FT   CDS_pept        103848..104459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="SPT_0119"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by match to protein family HMM PF00163;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23133"
FT                   /db_xref="GOA:C1CNV7"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CNV7"
FT                   /protein_id="ACO23133.1"
FT                   /translation="MSRYTGPSWKQARRLGLSLTGTGKELARRNYVPGQHGPNNRSKLS
FT                   EYGLQLAEKQKLRFTYGVGEKQFRNLFVQATKIKGGILGFNFMLLLERRLDNVVYRLGL
FT                   ATTRRQARQFVNHGHILVDGKRVDIPSYRVTPGQVISVREKSLKVPAILEAVEATLGRP
FT                   AFVSFDAEKLEGSLTRLPERDEINPEINEALVVEFYNKML"
FT   gene            105225..105485
FT                   /locus_tag="SPT_0120"
FT   CDS_pept        105225..105485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23349"
FT                   /protein_id="ACO23349.1"
FT                   /translation="MTGVSNPTTDSARLVLAEAKKAFADDSLTEQGLRDILQTVKDAIA
FT                   SLESIKESQSATKDGGQTAGKETAGEDESANQTQEISQGIK"
FT   gene            105439..105660
FT                   /locus_tag="SPT_0121"
FT   CDS_pept        105439..105660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23808"
FT                   /protein_id="ACO23808.1"
FT                   /translation="MSLQIKLKKLAKELSKLLKDSNLETVDKDVLENSQKELQKAVLFL
FT                   ADEKGSEHTEAEVIDNLKEVIAKLKANA"
FT   gene            105949..106908
FT                   /locus_tag="SPT_0122"
FT   CDS_pept        105949..106908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0122"
FT                   /product="ABC transporter membrane-spanning permease-sugar
FT                   transport"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22872"
FT                   /protein_id="ACO22872.1"
FT                   /translation="MDIKIKREEIMKKFSKTLRDNWIFLLMVLPGALWLILFFYIPVFG
FT                   NVVAFKDYHMTSNGFIDSIINSKWVGLDNFRFLFSSRDAFIITRNTVLYNLGFIFLGLV
FT                   VSVGIAIILSELRSKRMVKIFQTSMLFPYFLSWVIISFFTDAFLNIDKGVFNHLLESLG
FT                   LKEVNFYADLGIWPYLLLFLGIWKGFGYSSVMYYATIMGIDPTYYEAATVDGASKWQRI
FT                   RNVTIPQLTPLVTVLTILAVGNIFRADFGLFYQIPHNAGQLYNVTNVLDVYVFNGLTQT
FT                   ADIGMAAAAGLYQSVVGLILVILSNLLARRVDPNSALF"
FT   gene            106922..107845
FT                   /locus_tag="SPT_0123"
FT   CDS_pept        106922..107845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0123"
FT                   /product="protein LplC"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22535"
FT                   /protein_id="ACO22535.1"
FT                   /translation="MAKKKIKKEKIDNVGIHSFSKKADIFFSIISGLIALSCILPFVFV
FT                   IIISVTDEKSLLQYGYSFFPSQFGLDGFEFLAQFKDKILQALFISVFVTVVGTLTNVFI
FT                   TTTYAYAISRTTFKYRRFFTIFVLLSMLFNAGLVPGYIMVTRVLQLGDTVWALIVPMLL
FT                   SPFNIILMRSFFKKTIPEAILESARIDGASEARIFFQICLPLSLPGIATITLLTALGFW
FT                   NDWFNALLYIKSDNLYPLQYLLMQIQQNMDYIAKAVGLTGQLGVALPKETGRMAMVVVA
FT                   TLPIAILYPFFQRYFVKGLTIGGVKE"
FT   gene            108103..109578
FT                   /locus_tag="SPT_0124"
FT   CDS_pept        108103..109578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0124"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23797"
FT                   /protein_id="ACO23797.1"
FT                   /translation="MKNWKKYAFASASVVALAAGLAACGNLTGNSKKAADSGDKPVIKM
FT                   YQIGDKPDNLDELLANANKIIEEKVGAKLDIQYLGWGDYGKKMSVITSSGENYDIAFAD
FT                   NYIVNAQKGAYADLTELYKKEGKDLYKALDPAYIKGNTVNGKIYAVPVAANVASSQNFA
FT                   FNGTLLAKYGIDISGVTSYETLEPVLKQIKEKAPDVVPFAIGKVFIPSDNFDYPVANGL
FT                   PFVIDLEGDTTKVVNRYEVPRFKEHLKTLHKFYEAGYIPKDVATSDTSFDLQQDTWFVR
FT                   EETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQVANFVISNNSKNKEKSMEILN
FT                   LLNTNPELLNGLVYGPEGKNWEKIEGKENRVRVLDGYKGNTHMGGWNTGNNWILYINEN
FT                   VTDQQIENSKKELAEAKESPALGFIFNTDNVKSEISAIANTMQQFDTAINTGTVDPDKA
FT                   IPELMEKLKSEGAYEKVLNEMQKQYDEFLKNKK"
FT   gene            109850..110836
FT                   /locus_tag="SPT_0125"
FT   CDS_pept        109850..110836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0125"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23475"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CNW3"
FT                   /protein_id="ACO23475.1"
FT                   /translation="MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEG
FT                   INGTVSGDYETTQKYMDYVHSLPGMEDLWFKIDEESEQAFKKMFVRYKKEIVHLGLEDN
FT                   DFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRE
FT                   LPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQ
FT                   GELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENE
FT                   DKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV"
FT   gene            111111..111971
FT                   /locus_tag="SPT_0126"
FT   CDS_pept        111111..111971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22635"
FT                   /protein_id="ACO22635.1"
FT                   /translation="MAKTFFIPNKQSILGEQEILNAKSILALLDGLESHSYDVVYLRQP
FT                   LNRLEYIECAIVGQSQFLFKVSYADGQKAYRVDLPDLLTKTDWQIIKSFLDALLAYTGT
FT                   DIEGLDGFDFEAYFQASIQAYLADPVARFTICQGIFNPIFFSRENLKSFLEADGLAQFE
FT                   ARVRAVQETDAYFARVSFYQDGEGKVHGVYHLAQGVKTVLPREPFVPAAYIEQLVDKEV
FT                   QWEIDLVQITGDGSKPEDYESIARLDYAKFLEVLPPSFYHQLDANQIEVQPILDKDFKT
FT                   LAQEK"
FT   gene            112358..112522
FT                   /locus_tag="SPT_0127"
FT   CDS_pept        112358..112522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0127"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22310"
FT                   /protein_id="ACO22310.1"
FT                   /translation="MDESKYLCYLEKYDALGSGRLLAKVNNTYYMFNKNQIEFLRYSNK
FT                   NAKKERKYM"
FT   gene            113248..114594
FT                   /locus_tag="SPT_0128"
FT   CDS_pept        113248..114594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0128"
FT                   /product="Spn1 transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23574"
FT                   /protein_id="ACO23574.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYDGLIFFQELFSQLKLKER
FT                   ISKYLATNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGF
FT                   FGDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVR
FT                   TGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPRKKASLMMH"
FT   gene            115516..115641
FT                   /locus_tag="SPT_0129"
FT   CDS_pept        115516..115641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0129"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23922"
FT                   /protein_id="ACO23922.1"
FT                   /translation="MTKNINFTLFDKENYESNNLDSLNLNIALSHQIDGKATNIS"
FT   gene            115666..115863
FT                   /locus_tag="SPT_0130"
FT   CDS_pept        115666..115863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0130"
FT                   /product="macrolide export ATP-binding/permease protein
FT                   MacB"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22294"
FT                   /protein_id="ACO22294.1"
FT                   /translation="MRSLSQEKDIYSFDEPTGNLDRNSTELFLNEVEKLVNEEKIVIVV
FT                   THDKDVIARASKVINMDEFH"
FT   gene            complement(116100..117164)
FT                   /locus_tag="SPT_0131"
FT   CDS_pept        complement(116100..117164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22680"
FT                   /protein_id="ACO22680.1"
FT                   /translation="MKQEWFESNDFVKTTSKNKPEEQAQEVADKAEERIADLDTPIEKN
FT                   TQVEEEVSQAEVELESQQEEKMETPEDSEARTEIEEKKASNSTEEEPDLSKETEKVTIA
FT                   EESQEALPQQKATTKEPLLISKSLESPYIPDQAPKSRDKWKEQVLDFWSWLVEALKSPT
FT                   SKLETSSTHSYTAFLLLILFSASSFFFSIYHIKHAYYGHIATINSHFPEQLAPLTLFSI
FT                   ISILVATTLFFFSFLLGSFVVRRFIYQEKDWTLEKILQQYSQLLAIPIFLTAIASFFAF
FT                   FDSLRFSALLCVISIGIILLASLHIITRPSQASEADSFYQLFLSVLVNGVIILLFFVAE
FT                   VALIGNYLRILAFL"
FT   gene            complement(117227..118138)
FT                   /locus_tag="SPT_0132"
FT   CDS_pept        complement(117227..118138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23723"
FT                   /protein_id="ACO23723.1"
FT                   /translation="MRKLTKGFLIFGVVTTVIGFILLFVGIQSDGIKSLLAMSKEPVYD
FT                   SRMEELTFGKEVENLEITLHQHALTITDSFDDQIHISYHPSLSAHHDLITNQNDRTLSL
FT                   TDKKLSESPFISSGIDGILHIVSSSSNRFNDVIIGLPKGRTLKGINISANRGQTTIINA
FT                   SLENATLNTNGYILRIEGSRIKNSKLTTPNIVNIFDTDLTDSQLESTEHHFHAENIQVH
FT                   GKVELTAKDYLRIILDQKESQRINWDVSSNYGSIFQFTREEPESRGTELSNPYKTEKTD
FT                   VKDQLIARSDDDIELISTPSRR"
FT   gene            complement(118131..118724)
FT                   /locus_tag="SPT_0133"
FT   CDS_pept        complement(118131..118724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24147"
FT                   /protein_id="ACO24147.1"
FT                   /translation="MTRTEYLTQLELYLKKLPEADQIEAMDYFRELFDDAGVEGEEELI
FT                   ASLGTPKEAAHEVLSNLLDKKINEAPAQKNNRQILHVALLALLAAPIGIPLGIAILVSL
FT                   FAILVAALTVILAFFAVSILGIIGGFLFLVESFTVLAQAKSAFILIFGSGLLAIGASSL
FT                   VLLGISYVARFFGLLIVRLVQFVLKKGKRGDQHA"
FT   gene            complement(118711..119037)
FT                   /locus_tag="SPT_0134"
FT   CDS_pept        complement(118711..119037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0134"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22525"
FT                   /protein_id="ACO22525.1"
FT                   /translation="MYFPTSSALIEFLILAVLEKGDSYGYEISQTIKLIANIKESTLYP
FT                   ILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLLTLKDEWALYTDTINGIIEGSIR
FT                   HDKN"
FT   gene            complement(119176..120342)
FT                   /locus_tag="SPT_0135"
FT   CDS_pept        complement(119176..120342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0135"
FT                   /product="cyanate permease"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23005"
FT                   /protein_id="ACO23005.1"
FT                   /translation="MKKQSLFFVPGIILIGVSLRTPFTVLPIILGNISQGLEVEVSSLG
FT                   VLTSLPLLMFTLFSPFSTQLAQKIGLEHLFTYSLFFLTIGSLIRLINLPLLYLGTLMVG
FT                   ASVAVINVLLPSLIQANQPKKIGFLTTLYVTSMGIATALASYLAVPITQASSWKGLILL
FT                   LTLLCLATFLVWLPNHRYNHRLAPQTKQKSQIKVMRNKQVWAIIIFSGFQSLIFYTVMT
FT                   WLPTMSIHAGLSSHEAGLLTSILSLISIPFSMTIPSLTTSLSTRNRQLMLTLVSLAGVV
FT                   GISMLFFPINNFIYWLAIHLLIGTATSALFPYLMVNFSLKTSAPEKTAQLSGLSQTGGY
FT                   ILAAFGPTLFGYSFDLFHSWVPSVAALLLIDILMTVALFTVDRADKIL"
FT   gene            120493..121557
FT                   /locus_tag="SPT_0136"
FT   CDS_pept        120493..121557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0136"
FT                   /product="glycosyl transferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22828"
FT                   /protein_id="ACO22828.1"
FT                   /translation="MTQNVESLLVSIVISAYNEEKYLPGLIEDLKNQTYPKENIEILFI
FT                   NAMSTDGTTAIIQQFIKEDTEFNSIRLYNNPKKNQASGFNLGVKHSVGDLILKIDAHSK
FT                   VTETFVMNNVAIIQQGEFVCGGPRPTIVEGKGKWAETLHLVEENMFGSSIANYRNSSED
FT                   RYVSSIFHGMYKREVFQKVGLVNEQLGRTEDNDIHYRIREYGYKIRYSPSILSYQYIRP
FT                   TFKKMLHQKYLNGLWIGLTSHVQFKCLSLFHYVPCLFVLSLVFSLALLPITFVFITLLL
FT                   GAYFLLLSLLTLLTLLKHKNGFLIVMPFLLFSIHFAYGFGTIVGLIRGFKWKKEYKRTI
FT                   IYLDKISQINKNML"
FT   gene            121599..123449
FT                   /locus_tag="SPT_0137"
FT   CDS_pept        121599..123449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0137"
FT                   /product="CapD protein, required for the biosynthesis of
FT                   type 1 capsular polysaccharide"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23264"
FT                   /protein_id="ACO23264.1"
FT                   /translation="MNKKLTDYVIDLVEILNKQQKQVFWGIFDIFSMVVSIIVSYILFY
FT                   GLINPAPVDYIIYTSLAFLFYQLMIGFWGLNASISRYSKITDFMKIFFGVTASSVLSYS
FT                   ICYAFLPLFSIRFIILFILLSTFLILLPRITWQLIYSRRKKGSGDGEHRRTFLIGAGDG
FT                   GALFMDSYQHPTSELELVGILDKDSKKKGQKLGGIPVLGSYDNLPELAKRHQIERVIVA
FT                   IPSLDPSEYERILQMCNKLGVKCYKMPKVETVVQGLHQAGTGFQKIDITDLLGRQEIRL
FT                   DESRLGAELTGKTILVTGAGGSIGSEICRQVSRFNPERIVLLGHGENSIYLVYHELIRK
FT                   FQGIDYVPVIADIQDYDRLLQVFEQYKPAIVYHAAAHKHVPMMERNPKEAFKNNIRGTY
FT                   NVAKAVDEAKVSKMVMISTDKAVNPPNVMGATKRVAELIVTGFNQRSQSTYCAVRFGNV
FT                   LGSRGSVIPVFERQIAEGGPVTVTDFRMTRYFMTIPEASRLVIHAGAYAKDGEVFILDM
FT                   GKPVKIYDLAKKMVLLSGHTESEIPIVEVGIRPGEKLYEELLVSTELVDNQVMDKIFVG
FT                   KVNVMPLESINQKIGEFRTLSGDELKQAIIAFANQTTHIE"
FT   gene            complement(123799..124431)
FT                   /locus_tag="SPT_0138"
FT   CDS_pept        complement(123799..124431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0138"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23721"
FT                   /protein_id="ACO23721.1"
FT                   /translation="MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRG
FT                   FMGPPLESSFATCLSKDQISEAVQIYRSYYKAKGIYEAQLFPQIVELLQELSKNYPLYI
FT                   TTTKNTPTAQDMTKNLGIHHFFDGIYGYSPEAPHKADVIHQALQIHQLAPEQAIIIGDT
FT                   KFDMLGARETGIQKLAITWGFGEQADLLNYQPDYIAHKPLEVLEYFQ"
FT   gene            complement(124453..125325)
FT                   /gene="sdaAA"
FT                   /locus_tag="SPT_0139"
FT   CDS_pept        complement(124453..125325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaAA"
FT                   /locus_tag="SPT_0139"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="identified by match to protein family HMM PF03313;
FT                   match to protein family HMM TIGR00718"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22355"
FT                   /protein_id="ACO22355.1"
FT                   /translation="MFYSIKELVEQADLDFQGNVAELMITTEFELTGREREEVFLLMER
FT                   NLEVMKASVQLGLNENKSRSGLTGGDAAKLDHYIENGKTLSDYTILSAARNAIAVNEHN
FT                   AKMGLVCATPTAGSAGCLPSVLTAAIEKLDLSHEQQLDFLFAAGAFGLVIANNASISGA
FT                   EGGCQAEVGSASAMSAAALTLAAGGTPYQASQAIAFVIKNMLGLICDPVAGLVEVPCVK
FT                   RNAMGASFAFIAADMALAGIESKIPVDEVIDAMYQVGASMPTAFRETAEGGLATTPTGR
FT                   RLQKEIFGE"
FT   gene            complement(125334..126005)
FT                   /gene="sdaAB"
FT                   /locus_tag="SPT_0140"
FT   CDS_pept        complement(125334..126005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaAB"
FT                   /locus_tag="SPT_0140"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF03315; match to protein
FT                   family HMM TIGR00719"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22913"
FT                   /protein_id="ACO22913.1"
FT                   /translation="MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTE
FT                   VEFQLFNSFAKTYRGHGTDLALVAGILGMDTDDPEIPNSLEIAHKRGIKIVWTIQKDSN
FT                   APHPNTTKITVKNAHKTISVTGISIGGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGM
FT                   IALVTEALSRYGINIAQMNVTREKAGEKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFF
FT                   K"
FT   gene            126247..126834
FT                   /locus_tag="SPT_0141"
FT   CDS_pept        126247..126834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0141"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24050"
FT                   /protein_id="ACO24050.1"
FT                   /translation="MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSE
FT                   IAETHNTTVEKLAENNHIDNIHLIYVGQELVIDGPVAPVATPAPATYAAPAAQDETVSA
FT                   PVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYQLTDSYLNGDYS
FT                   AENQERVADAYVAGRYGSWTAAKNFWLNNGWY"
FT   gene            complement(126886..127206)
FT                   /locus_tag="SPT_0142"
FT   CDS_pept        complement(126886..127206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24042"
FT                   /protein_id="ACO24042.1"
FT                   /translation="MQRLEVYKNYQHLYDLRIAILLNLSTLYLYNQDKNMCKQICYTLL
FT                   EDAKNKKSYDRLVICYVRIGICTDDSKLIQKGFSLLELTEETSMLSHLKKEVEIYYQAK
FT                   ER"
FT   gene            127658..127906
FT                   /locus_tag="SPT_0143"
FT   CDS_pept        127658..127906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0143"
FT                   /product="bacteriocin, lactococcin 972 family"
FT                   /note="identified by match to protein family HMM TIGR01653"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22684"
FT                   /protein_id="ACO22684.1"
FT                   /translation="MVCSILASTSVLAVWVDGGQWNYGVGWSGNFGYSDYLHSTRSHTA
FT                   TVKDGNKFSKDRAEAEAWARASIFKFPPTGMEYFYGF"
FT   gene            127961..130069
FT                   /locus_tag="SPT_0144"
FT   CDS_pept        127961..130069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0144"
FT                   /product="ABC transporter membrane-spanning permease-amino
FT                   acid transport"
FT                   /note="identified by match to protein family HMM TIGR01654"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23177"
FT                   /protein_id="ACO23177.1"
FT                   /translation="MKKISHLCMLLLLLCTTFFVFNVNYTREVVRIQEMGKTVDSLDLY
FT                   LKDINEPAASVLRFFEDVSKEYKVSIIKTDSGDEVVKSGVFDKDTFPYQEFGISSLDFT
FT                   TDGEGVYSNKEISNKLGTIPTFLKAKPIQLMTFQTYIKDTSRSLNGRYTITSTQEMDKD
FT                   RIVQKWSDFFKIDQATLLEPTYKSAVEVINRDLLLSAIVFVLAILLLVLVTVYQPMMEM
FT                   KRVGVQKLLGFQDRAVLADVVKGNLYLLLGGALVINLGVFFLLDYKPKDLFPMLWLSHF
FT                   LLLQLYLFISWLTYLLIQKMTISSLLKGFSSFKFGLLFNYLMKIGTTILLTVLLVGVGK
FT                   SLEQENKELDYQKQWISQGNYLTLETFQLNDNLWQEQLAGSGKALDYFYRFYQDLVEKT
FT                   QAGYVQSSSLPVKNFVQSEQIQQYQLTDTVDVYYANRNFLKSKGFKLPDTGIKKVILMP
FT                   ASTKGEEDKNQLLGKLIAFHSMKYEEQQKRTIEEMDVEIAYYEGDWSFFPYSDKRKENL
FT                   SNPIISLVNDSDMMWDEKASLSTTGLNNPIKIENTVQHQKEITELVEKLSDGNYLKFSS
FT                   IQAIQQEKVDSYRDAVRNFNLLFALFGLLSMMISYFLLVTTFLLKRRDIITKKFMGWKL
FT                   VDRYRPLLVLLLLGYSFPLLVLIFFAHAFLPLLLFAGFTCLDILFVLGLASRMEKRSLV
FT                   ELLKGGIL"
FT   gene            130066..130707
FT                   /locus_tag="SPT_0145"
FT   CDS_pept        130066..130707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0145"
FT                   /product="macrolide export ATP-binding/permease protein
FT                   MacB"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23381"
FT                   /protein_id="ACO23381.1"
FT                   /translation="MIELKNITKTIGGKVILDNLSLRIDQGDLVAIVGKSGSGKSTLLN
FT                   LLGLIDGDYSGRYEIFGQTNLAVNSAKSQTIIREHISYLFQNFALIDDETVEYNLMLAL
FT                   KYVKLPKKDKLKKVEEILERVGLSATLHQRVSELSGGEQQRIAVARAILKPSQLILADE
FT                   PTGSLDPENRDLVLKFLLEMNREGKTVIIVTHDAYVAQQCHRVIELGEGK"
FT   gene            130914..131720
FT                   /locus_tag="SPT_0146"
FT   CDS_pept        130914..131720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0146"
FT                   /product="ABC transporter solute-binding protein-amino acid
FT                   transport"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23336"
FT                   /protein_id="ACO23336.1"
FT                   /translation="MNKMKKVLMTMFGLVMLPLLFACSNNQSAGIEAIKSKGKLVVALN
FT                   PDFAPFEYQKVVDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLA
FT                   ISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSDLATYQSVNDLAQKKVGAQKGSIQETM
FT                   AKDLLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPDLAIADLNFEKEQ
FT                   DDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASIEK"
FT   gene            131737..132156
FT                   /locus_tag="SPT_0147"
FT   CDS_pept        131737..132156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0147"
FT                   /product="argininosuccinate synthase
FT                   (Citrulline--aspartateligase)"
FT                   /EC_number="6.3.4.5"
FT                   /note="identified by match to protein family HMM PF00764"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23804"
FT                   /protein_id="ACO23804.1"
FT                   /translation="MSKEKVILAYSGGLDTSVAITWLKKDYDVVAVCMDVGEGKDLDFI
FT                   HDKALKVGAVESYVIDVKDEFATDYVLVALQSHAYYEQKYPLVSALSRPLISKKLVEIA
FT                   HQTGATTIAHGCTGKGNDQVEYQIAVAKKANEAKK"
FT   gene            complement(132446..132766)
FT                   /locus_tag="SPT_0148"
FT   CDS_pept        complement(132446..132766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23078"
FT                   /protein_id="ACO23078.1"
FT                   /translation="MQRLEVYKNYQHLYDLRIAILLNLSTLYLYNQDKNMCKQICYTLL
FT                   EDAKNKKSYDRLAICYVRIGICRDNAKLIQKGFSLLELTEETSMLSHLKKEVETHYQPK
FT                   KL"
FT   gene            133525..133893
FT                   /locus_tag="SPT_0149"
FT   CDS_pept        133525..133893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23997"
FT                   /protein_id="ACO23997.1"
FT                   /translation="MELVLPNNYVALEQEEMMYLDGGGVGCNWWNSRGSFATVLDVDLA
FT                   IYSGGATIYSAYAIKKAISANRGAITRTLRSLIIKHVGSAAGHLVNTALTVTGFSLGGA
FT                   IAYGVDWADGSLDGYIFA"
FT   gene            complement(134293..135156)
FT                   /locus_tag="SPT_0150"
FT   CDS_pept        complement(134293..135156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0150"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22279"
FT                   /protein_id="ACO22279.1"
FT                   /translation="MRYDFGKVYKEIRESKGLTQEEVCGGVLSRTSLSKIESGKTTPKY
FT                   ENMEFLLRQINMSFEEFEYICQLYQPSQRTEIMQTYLNMRSIIGTSDLVNLFQKCQDYL
FT                   KTHHDLPIEEIRDMLEVVIYIRQHGAGELSDHAEQVVKKLWRKIEKQDTWYESDLKILN
FT                   TILFSFPIEYLHLITGKILQRLEVYKNYQHLYDLRIAILLNLSTLYLYNQDKNMCKQIC
FT                   YTLLEDAKNKKSYDRLAICYVRIGICTDDSKLIQKGFSLLELTEETSMLSHLKKEVEIY
FT                   YQAKER"
FT   gene            135724..135960
FT                   /locus_tag="SPT_0151"
FT   CDS_pept        135724..135960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0151"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22843"
FT                   /protein_id="ACO22843.1"
FT                   /translation="MKIREIIGTDMYGTTVSGIVSGLNKLNFTVKAVRVALEDLTPKLT
FT                   FPAILQVKNDLGQNHFVVLHSIKEKIKGTRITK"
FT   gene            136258..136434
FT                   /locus_tag="SPT_0152"
FT   CDS_pept        136258..136434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23276"
FT                   /protein_id="ACO23276.1"
FT                   /translation="MKRRIFSLFVLDLMVYIFLGYVLVIQKDVYLFSILIIFSNFSVPF
FT                   IREKEYELFKNKK"
FT   gene            136588..136800
FT                   /locus_tag="SPT_0153"
FT   CDS_pept        136588..136800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23954"
FT                   /protein_id="ACO23954.1"
FT                   /translation="MMIVLISVIVAFLYHKITEYVNNRKIDIVIFLSLLISHFIWNYYF
FT                   LPIEILIAISGANLLLSFLKKLQTK"
FT   gene            137216..137578
FT                   /locus_tag="SPT_0154"
FT   CDS_pept        137216..137578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22632"
FT                   /protein_id="ACO22632.1"
FT                   /translation="MELVLPNNYVVLEQEEMIYLDGGGVGCNWWNKRDNIAAAAVSGGM
FT                   SVYQTYAIKKLIANRGMMSRVVRSAITRYIGGVSMATITNALNIAATVAEVFSLGGAIA
FT                   YGLDIVDGKFDGYLWA"
FT   gene            137961..139019
FT                   /locus_tag="SPT_0155"
FT   CDS_pept        137961..139019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22769"
FT                   /protein_id="ACO22769.1"
FT                   /translation="MKDDQKYLLAGFYSLLVAIFYFPLIDSKGIFVSILMAVLLLYLIY
FT                   FIGTVIHIVIIKFIRKKSFKYLVLYPFTYDGSWRFQPINLLYFPEMVRDVIPINLVQEY
FT                   CQGQPYGLLKKMLKRIRLSREISLLLATIIVYFFTHRILPLSVFTFIFSYILLFAQSYL
FT                   GGNTVWIGNRRLIIDDEFEKILLSKSYIKEISSARYSEYLTCEYKNLTPIILLAIFENL
FT                   LDSYLIQNQSKVDLDIFYKVLPLLYKEKYTMGFNYFVSLNYLLYKVGFLGIIYDNEALR
FT                   DLSKQYLNKNISELQDGSFEDGIQDAVASKQIVVINEFIACLNSRCVPSQYDRFFYKDR
FT                   PYIFSRKSPIKG"
FT   gene            139335..140312
FT                   /locus_tag="SPT_0156"
FT   CDS_pept        139335..140312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23531"
FT                   /protein_id="ACO23531.1"
FT                   /translation="MKNKRYFFDTILIILLLISTIFCVSPVFIKLDILGTPSHAILTFV
FT                   LAIPLFYILSQCLHTLLLLVSSIFCKLRPIYFYFIFVIIIGARKYYRILFHQLMGFSPG
FT                   VAVFYKESQTTKNLFKFYYFLYFTTLISYYFFFTFVYDKPLLLPLIPFSIIIALVQKLY
FT                   RIENQQLFLLKSKVLTILESKKDCEFNLQDYHEIWKLQSKSELPCVALSYISLIKPYLS
FT                   ESVREQIDLLEVKRFKKINHPISLYGMLDVIKLNLYLRHYNEKNKYESMLNKILEVRPD
FT                   FVLIEQNIDDSLNSSQPLSLSLAISEIQLLLEVYMGIKHVSIRR"
FT   gene            140689..141063
FT                   /locus_tag="SPT_0157"
FT   CDS_pept        140689..141063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24184"
FT                   /protein_id="ACO24184.1"
FT                   /translation="MELVLPNNYVVLEQEEMMYLDGGFSIPRWPVATAINIAFNGVLGG
FT                   GAISLVRNYIRNYGLRRVTSAIAGAAARYVGVRVANRVAGFALSAINGFAAWMSIGDAI
FT                   TTIWANNDVNRRDPNLNALW"
FT   gene            141070..141252
FT                   /locus_tag="SPT_0158"
FT   CDS_pept        141070..141252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23927"
FT                   /protein_id="ACO23927.1"
FT                   /translation="MGIKMEKIFVIIFFVCLFISSITFLAYDFVSEEIKKLIIWMNVVF
FT                   LILIIAMIIYPKLRK"
FT   gene            141271..142173
FT                   /locus_tag="SPT_0159"
FT   CDS_pept        141271..142173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23192"
FT                   /protein_id="ACO23192.1"
FT                   /translation="MIRKLIIFLLMLPLFVLWLELHVLVNNLLLNLESPLDFVISMSLA
FT                   FCSLILSKIVLDILYALKDLYKKEALITIFPFIFIGRKKVNVRFSPYFSFHRKSLSPDD
FT                   LRSRIIWSFILEIAIILVFILKIPFVIIMLTTIFFWNIMDINHLVFNKTEFLFNQNKWE
FT                   KEDSFESDLTKTLKDKIQKSELSYSDLMSLQLYDAMNQSTFLTDSELFEDILSKIEDSH
FT                   NTLLCTGLVELLLYEISISNNNNWQEKVDKIRIHLIRINQLDFFYYTSWLRQNFDFCMN
FT                   REYHKMKSRKLLLSNKKIV"
FT   gene            142229..142582
FT                   /locus_tag="SPT_0160"
FT   CDS_pept        142229..142582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23866"
FT                   /protein_id="ACO23866.1"
FT                   /translation="MELVLPNNYVVIDEEEMMYLDGGAYLSKRACQGICAALAMSSGTF
FT                   IALAGAAVLTKKLINYIKVGGLGGWLIGAAAGVLATAAGKIAYCIGYGVLNRGCDINGN
FT                   PYPWDGFISATVR"
FT   gene            142579..143307
FT                   /locus_tag="SPT_0161"
FT   CDS_pept        142579..143307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0161"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22263"
FT                   /protein_id="ACO22263.1"
FT                   /translation="MSNVDKIRKIHIIVCWVYIFLSFRAIINDTEYFLLIFLAFIYSIV
FT                   SLPLYSVKNKIVSICLVINSILLISFPILINKFFPESFLTYTVLISVFILELAIFHLIG
FT                   KDFDTKLTNEYKKISQFRSKVSQSPWIKYLEISSFILTIFPSILYGTVDNHVLTLIFLI
FT                   KICVDTTIKFLFIRLFDTSTLMKRRIFFLFALDVIAYLFLGYLLVIQKAGYLFSVLLLF
FT                   SNFSVPFIKAKEYELFKNSK"
FT   gene            144442..144681
FT                   /locus_tag="SPT_0162"
FT   CDS_pept        144442..144681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23533"
FT                   /protein_id="ACO23533.1"
FT                   /translation="MKLLDCILDYQERFNGKTCQVSTNYKYLEIFKVNFCLTDLHHLFG
FT                   LHKITRDYASQTKPAIQAGVFILEDFRNILCTMM"
FT   gene            145231..147405
FT                   /locus_tag="SPT_0163"
FT   CDS_pept        145231..147405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0163"
FT                   /product="pneumococcal surface protein A"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23200"
FT                   /protein_id="ACO23200.1"
FT                   /translation="MNKKKMILTSLASVAILGAGFVTSQPTVVRAEESPVASQSKAEKD
FT                   YDAAVKKSEAAKKHYEEAKKKAEDAQKKYDEDQKKTEAKAEKERKASEKIAEATKEVQQ
FT                   AYLAYLQASNESQRKEADKKIKEATQRKDEAEAAFATIRTTIVVPEPSELAETKKKAEE
FT                   AKAEEKVAKRKYDYATLKLALAKKEVEAKELEIEKLQYEISTLEQEVATAQHQVDNLKK
FT                   LLAGADPDDGTEVIEAKLKKGEAELNAKQAELAKKQTELEKLLDSLDPEGKTQDELDKE
FT                   AEEAELDKKADELQNKVADLEKEISNLEILLGGADPEDDTAALQNKLAAKKAELAKKQT
FT                   ELEKLLDSLDPEGKTQDELDKEAEEAELDKKADELQNKVADLEKEISNLEILLGGADSE
FT                   DDTAALQNKLATKKAELEKTQKELDAALNELGPDGDEEETPAPAPQPEQPAPAPKPEQP
FT                   APAPKPEQPAPAPKPEQPAPAPKPEQPAKPEKPAEEPTQPEKPATPKTGWKQENGMWYF
FT                   YNTDGSMATGWLQNNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFKVSDKW
FT                   YYVNSNGAMATGWLQYNGSWYYLNANGDMATGWLQYNGSWYYLNANGDMATGWAKVNGS
FT                   WYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFKVS
FT                   DKWYYVNGLGALAVNTTVDGYKVNANGEWV"
FT   gene            147658..147783
FT                   /locus_tag="SPT_0164"
FT   CDS_pept        147658..147783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0164"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22988"
FT                   /protein_id="ACO22988.1"
FT                   /translation="MTISFKKQFLSSSLSSLTKRVIMNTAQATFNREAHTTFNRE"
FT   gene            147806..148927
FT                   /gene="trmU"
FT                   /locus_tag="SPT_0165"
FT   CDS_pept        147806..148927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="SPT_0165"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="identified by match to protein family HMM PF03054;
FT                   match to protein family HMM TIGR00420"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22406"
FT                   /db_xref="GOA:C1CP03"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP03"
FT                   /protein_id="ACO22406.1"
FT                   /translation="MSDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTD
FT                   ENGVCTATEDYKDVVAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCN
FT                   KEIKFKAFLDYAITLGADYVATGHYARVARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQ
FT                   LQKTMFPLGHLEKPEVRRLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLPAQPGRM
FT                   MTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHD
FT                   SLMSTSLEASQVHFTREMPEEFTLECTAKFRYRQPDSKVTVHVKGEKTEVIFAEPQRAI
FT                   TPGQAVVFYDGEECLGGGLIDNAYRDGQVCQYI"
FT   gene            149068..149523
FT                   /locus_tag="SPT_0166"
FT   CDS_pept        149068..149523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0166"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23268"
FT                   /protein_id="ACO23268.1"
FT                   /translation="MTQQDFRTKVDNTVFGVRATALIVQNHKLLVTKDKGKYYTIGGAI
FT                   QVNESTEDAVVREVKEELGVKAQAGQLAFVVENRFEVDGVSYHNIEFHYLVDLLEDAPL
FT                   TMQEDEKRQPCEWIDLDKLQNIQLVPAFLKTALPDWEGQLRHIHLEE"
FT   gene            149533..151446
FT                   /gene="gidA"
FT                   /locus_tag="SPT_0167"
FT   CDS_pept        149533..151446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="SPT_0167"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22951"
FT                   /protein_id="ACO22951.1"
FT                   /translation="MTYHFTEEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLA
FT                   FMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKE
FT                   LYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRG
FT                   EIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPG
FT                   DEVPNHFSYTSRDEDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCP
FT                   SIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMM
FT                   RTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQ
FT                   GKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREI
FT                   GLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLR
FT                   RPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPAN
FT                   IDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNRSISKTLQK
FT                   SK"
FT   gene            complement(151578..151727)
FT                   /locus_tag="SPT_0168"
FT   CDS_pept        complement(151578..151727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0168"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22724"
FT                   /protein_id="ACO22724.1"
FT                   /translation="MKIKEQTRKLAVGCSKHCFEVVDRTDEVSSHTYGKATLTRFEEIF
FT                   EEYQ"
FT   gene            complement(151799..153478)
FT                   /locus_tag="SPT_0169"
FT   CDS_pept        complement(151799..153478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0169"
FT                   /product="metallo-beta-lactamase superfamily protein domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521; match to protein
FT                   family HMM TIGR00649"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22625"
FT                   /protein_id="ACO22625.1"
FT                   /translation="MAYTLKPEEVGVFAIGGLGEIGKNTYGIEYQDEIIIVDAGIKFPE
FT                   DDLLGIDYVIPDYSYIVDNIDRVKAVLITHGHEDHIGGIPFLLKQANVPIYAGPLALAL
FT                   IRGKLEEHGLLRNAKLYEINHNTELTFKNLKATFFRTTHSIPEPLGIVIHTPQGKIVCT
FT                   GDFKFDFTPVGEPADLHRMAALGEEGVLCLLSDSTNAEVPTFTNSEKVVGQSIMKIIQG
FT                   IEGRIIFASFASNIFRLQQATEAAVKTGRKIAVFGRSMEKAIVNGIDLGYIKAPKGTFI
FT                   EPNEIKDYPAGEVLILCTGSQGEPMAALSRIANGTHRQVQLQPGDTVIFSSSPIPGNTT
FT                   SVNKLINIISEAGVEVIHGKVNNIHTSGHGGQQEQKLMLRLIKPKYFMPVHGEYRMQKV
FT                   HAGLAVDTGVEKDNIFIMSNGDVLALTADSARIAGHFNAQDIYVDGNRIGEIGAAVLKD
FT                   RRDLSEDGVVLAVATVDFKSQMILSGPDILSRGFVYMRESGDLIRQSQRILFNAIRIAL
FT                   KNKDASVQSVNGAIVNAIRPFLYENTEREPIIIPMILTPDEE"
FT   gene            complement(153480..153713)
FT                   /locus_tag="SPT_0170"
FT   CDS_pept        complement(153480..153713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0170"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF07288"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24100"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP08"
FT                   /protein_id="ACO24100.1"
FT                   /translation="MIYKVFYQETKERSPRRETTRTLYLDIDASSELEGRITARQLVEE
FT                   NRPEYNIEYIELLSDKLLDYEKETGAFEITEF"
FT   gene            complement(154039..154284)
FT                   /locus_tag="SPT_0171"
FT   CDS_pept        complement(154039..154284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0171"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23249"
FT                   /protein_id="ACO23249.1"
FT                   /translation="MGWNFRVVNLLSLHPQTKNPSISRASKHLIQSKIQTKRHRSRGGE
FT                   KASRESQRSFSTRTWFVVVPVWQIEDSPHKRKQQKQ"
FT   gene            complement(154531..154683)
FT                   /locus_tag="SPT_0172"
FT   CDS_pept        complement(154531..154683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0172"
FT                   /product="bacteriocin-type signal sequence domain protein"
FT                   /note="identified by match to protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22976"
FT                   /protein_id="ACO22976.1"
FT                   /translation="MMKDLNNYREISNKELQEIKGGFGVGVGIALFMAGYTIGKDLRKK
FT                   FGKSC"
FT   gene            complement(154685..154870)
FT                   /locus_tag="SPT_0173"
FT   CDS_pept        complement(154685..154870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22362"
FT                   /protein_id="ACO22362.1"
FT                   /translation="MTNFDILDNQFLSLSENELSDIDGGLAPLVIFGVAVSWKAIAGGT
FT                   ALIGSGLAAGYFLGGD"
FT   gene            155048..155731
FT                   /locus_tag="SPT_0174"
FT   CDS_pept        155048..155731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0174"
FT                   /product="glycoprotein endopeptidase"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23843"
FT                   /protein_id="ACO23843.1"
FT                   /translation="MKVLAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDF
FT                   LMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAYTLNIELVGMSSLLALVPHQQ
FT                   EGLFVPLMDARRNNVYAGFYENAKPVMAEAHLSFEEVLEKVKGTSQVTFVGEVGPFVEQ
FT                   IQKHLPRTDYKETLPNAANLALLAWDKEADSLHDFVPNYLKRVEAEENWLKNHTESGES
FT                   YIKRL"
FT   gene            155728..156165
FT                   /gene="rimI"
FT                   /locus_tag="SPT_0175"
FT   CDS_pept        155728..156165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="SPT_0175"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23213"
FT                   /protein_id="ACO23213.1"
FT                   /translation="MIEIKRIQQQPDLAQAIYAVMAAVYLVSPWTLEQIQADLSQDQTW
FT                   YALAYDGAEVIGFLAVQENLFEAEVLQIAVKGAYQGQGIASALFAQLPTDKEIFLEVRQ
FT                   SNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMKREIDEG"
FT   gene            156155..157165
FT                   /locus_tag="SPT_0176"
FT   CDS_pept        156155..157165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0176"
FT                   /product="O-sialoglycoprotein endopeptidase
FT                   (Glycoprotease)"
FT                   /EC_number="3.4.24.57"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22642"
FT                   /db_xref="GOA:C1CP14"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP14"
FT                   /protein_id="ACO22642.1"
FT                   /translation="MKDRYILAFETSCDETSVAVLKNDDELLSNVIASQIESHKRFGGV
FT                   VPEVASRHHVEVITACIEEALAEAGITEEDVTAVAVTYGPGLVGALLVGLSAAKTFAWA
FT                   HGLPLIPVNHMAGHLMAAQSVEPLEFPLLALLVSGGHTELVYVSEAGDYKIVGETRDDA
FT                   VGEAYDKVGRVMGLTYPAGREIDELAHQGQDIYDFPRAMIKEDNLEFSFSGLKSAFINL
FT                   YHNAEQKGESLSTEDLCASFQAAVMDILMAKTKKALEKYPVKTLVVAGGVAANKGLRER
FT                   LAAEITDVKVIIPPLRLCGDNAGMIAYASVSEWNKENFAGWDLNAKPSLAFDTME"
FT   gene            complement(157205..157591)
FT                   /pseudo
FT                   /locus_tag="SPT_0177"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            complement(157582..158559)
FT                   /pseudo
FT                   /locus_tag="SPT_0178"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts; identified by match to
FT                   protein family HMM PF01610"
FT   gene            159781..160921
FT                   /pseudo
FT                   /locus_tag="SPT_0179"
FT                   /note="glycosyl transferase, group 1 family protein,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error"
FT   gene            160948..161823
FT                   /locus_tag="SPT_0181"
FT   CDS_pept        160948..161823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0181"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22432"
FT                   /protein_id="ACO22432.1"
FT                   /translation="MDRNIDQELVSIIIPTHNRYESLIRAVKSCLHQSYKNIEVIIIDD
FT                   NYSNVNLRNKIIHQFGYTNHRIKLILSNEDLGATNARNIGIKNSRGKYISFLDDDDEYM
FT                   PDRILKLMACFKKSRMKNLALVYSYGIIIYPNGTREEEKTDFVGNPLFVQMVHNIAGTS
FT                   FWLCKKEVLELINGFEKIDSHQDGVVLLKLLAQGYQIDIVREFLVNYYAHSKENGITGV
FT                   TQKTINADEEYYNYCRKYFNLLSFNERILVTKKYYSLNIKRLLLIGDKCKALKVIKKAR
FT                   EEKIFNEFLF"
FT   gene            161910..163526
FT                   /locus_tag="SPT_0182"
FT   CDS_pept        161910..163526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0182"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23904"
FT                   /protein_id="ACO23904.1"
FT                   /translation="MYTIIKSNIKKFSLLTIFIVAGQLLLIYAATINALVLNELIAMNL
FT                   ERFLKLSIYQMIVWCGIIFLDWVVKNYQVEVIQEFNLEIRNRVATDISNSTYQEFHSKS
FT                   SGTYLSWLNNDVQTLNDQAFKQLFLVIKGISGTIFAVVTLNHYHWSLTVATLFSLMIML
FT                   LVPKIFASKMREVSLNLTSQNEAFLKSSETILNGFDVLASLNLLYVLPKKIKEAGILLK
FT                   MVIQRKTTVETLAGAISFFLNIFFQISLVFLTGYLAIKGIVKIGTIEAIGALTGVIFTA
FT                   LGELGGQLSSIIGTKPIFLKLYSINPIESNKMNDIEPNEVNRDFPLYEAKNICYKYGDK
FT                   EILKNLNFCFQRNEKYLILGESGSGKSTLLKLLNGFLRDYSGELRFCGDDIKKTSYLNM
FT                   VSNVLYVDQKAYLFEGTIRDNILLEENYTDEEILQSLEQVGLSVKDFPNNILDYYVGDD
FT                   GRLLSGGQKQKITLARGLIRNKKIVLIDEGTSAIDRRTSLAIERKILDREDLTVIIVTH
FT                   APHPELKQYFTKIYQFPKDFI"
FT   gene            163546..163701
FT                   /locus_tag="SPT_0183"
FT   CDS_pept        163546..163701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0183"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24119"
FT                   /protein_id="ACO24119.1"
FT                   /translation="MRFYCEAYEVITEEKKVYFNDIELEVKYSSVEELFIICEKLLDKK
FT                   KVSFFM"
FT   gene            164078..164302
FT                   /locus_tag="SPT_0184"
FT   CDS_pept        164078..164302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23524"
FT                   /protein_id="ACO23524.1"
FT                   /translation="MKIFNFRDKGLIFFNKIVNGLIQNIEENLEDDIERILKYLYICLF
FT                   NEIFIIKNKVNFFDDVEFNQTLSEFLDKL"
FT   gene            164853..165053
FT                   /locus_tag="SPT_0185"
FT   CDS_pept        164853..165053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23206"
FT                   /protein_id="ACO23206.1"
FT                   /translation="MGKTKELKMYQEELDEKHYIDRISSILCYKSQILIIWKSVEKLLN
FT                   NIKELYLRNGAVYSIIFWIKK"
FT   gene            165066..166237
FT                   /pseudo
FT                   /locus_tag="SPT_0187"
FT                   /note="UDP-glucose 6-dehydrogenase, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF03721"
FT   gene            166632..167495
FT                   /locus_tag="SPT_0188"
FT   CDS_pept        166632..167495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0188"
FT                   /product="MutR"
FT                   /note="identified by match to protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23309"
FT                   /protein_id="ACO23309.1"
FT                   /translation="MIERMELGEFYKELRLARKLKQTDVACEGLTASQLSKFELGQSML
FT                   SADKLILAIQGINVTFDEFGHKLNNYQESPHMRIGRKVVNRFAHQDIAALEQLLEEVDQ
FT                   EQMAQTYRRLNAIVIKDAIHSLNKSYPLAEEDSEFLTTYLYAIESWTWFELYLFCNTMP
FT                   FLSNQDLIFLSTSLLEKSKEFKELVHNRLYMKQGLLNILSELMERKLFSYIPIFEAELE
FT                   RMLRPYDVFEKVSWQFLKKMSVFLQTKGSNQKEIERFIQSLQVLENPQLTSLFELRFQQ
FT                   YKELID"
FT   gene            167786..167983
FT                   /locus_tag="SPT_0189"
FT   CDS_pept        167786..167983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23820"
FT                   /protein_id="ACO23820.1"
FT                   /translation="MLNLQFAETMELTEAELETVYGGEFGNNAVIPAGAWGGLGTSWSI
FT                   TNFWKKYFNHDSSTVNRRHY"
FT   gene            168051..168716
FT                   /locus_tag="SPT_0190"
FT   CDS_pept        168051..168716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0190"
FT                   /product="caax amino protease family"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23526"
FT                   /protein_id="ACO23526.1"
FT                   /translation="MKKIISHRYFIIVFLLVIADQKFSVLVLRSDLVTGLSDFAYYLSD
FT                   MMLNFLVVLFALIAMIWSGKWQKINSRKFKGSYLFYSFLALLAFVVWNFVTFFLFPPTR
FT                   NEISYQHAAPTFTGATAFLMYFFYPVIAGPIFEEIIHRGLVMTALEKGKKWGLDVLGSA
FT                   ILFGVSHISNHGWVLTDFVFYMGGGLIFVVLFRMTKSIYWPIGLHIVYNGIGQLLMLL"
FT   gene            168788..170014
FT                   /locus_tag="SPT_0191"
FT   CDS_pept        168788..170014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0191"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22966"
FT                   /protein_id="ACO22966.1"
FT                   /translation="MKVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLAI
FT                   LLITISETLPQVLQIFLGVLADFQHHRVLKYTVISFTKFLLYSIVSLSLSGQSFSLLLV
FT                   TFICLINLLSDTLSYFSGAMLTPIFIRIIGQDHLAEAIGFKQSTVSLVKTISNILGGVL
FT                   LGILSIQFISLLNALTFLIAFLGILFIKTDLLKVEKTINYQEGLSVKSFCQHLLQSSKL
FT                   IWNMNKVLLVLFIISTSQAVINVTVPVSTLFLRNQPFLNLQTGQSLALLSTFELSALIV
FT                   GSLVSGYLQHTISIKTALYASLVIQLLLLVGFATVRFDWILIFSTLDAFFAGVLSPRLQ
FT                   ELVFKQIPEESMGAVQSSIGAITVVLPSLFTIALVTIATSFGTLAVSFVLLLFLLVAFV
FT                   MLLNIRESI"
FT   gene            complement(170290..170487)
FT                   /locus_tag="SPT_0192"
FT   CDS_pept        complement(170290..170487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0192"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22857"
FT                   /protein_id="ACO22857.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVVDRTDEVSSKHRFEVVDRTDEVSS
FT                   KHRFEVVDRTDEVSNIYTAK"
FT   gene            170558..171214
FT                   /locus_tag="SPT_0193"
FT   CDS_pept        170558..171214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0193"
FT                   /product="branched-chain amino acid permease"
FT                   /note="identified by match to protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22328"
FT                   /protein_id="ACO22328.1"
FT                   /translation="MPTALGYVSIGLACGTIGAPYVTPVEMGLMSLFVYAGSAQFAMLA
FT                   LIVVQAPVAAIAMTVFLINLRLFLLSLHASTYFRHTSLWYNIGMSSILTDETYGVLMGE
FT                   LAHTDKVNPMWMHGNNLNSYVAWFVGTVVGTALGGLLPNPEIFGLDFALVGMFIGIFAS
FT                   QFQIMQRRIPVRNLLIILAVVAVSFFLLLTVVSQSLAVLFATLLGCSMGVVLDGQ"
FT   gene            171204..171527
FT                   /locus_tag="SPT_0194"
FT   CDS_pept        171204..171527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0194"
FT                   /product="branched-chain amino acid transport protein AzlD"
FT                   /note="identified by match to protein family HMM PF05437"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23989"
FT                   /protein_id="ACO23989.1"
FT                   /translation="MVSKYLLLAVIFSGLVTWILRMIPFILVKYKGLPAIVERFLKFLP
FT                   VSIIFALILSSVVTGKVGSLPQIKWLDFLAVFPTAWVAFRYRNLVGTVLFGVVLIAILR
FT                   LVF"
FT   gene            171631..172461
FT                   /locus_tag="SPT_0195"
FT   CDS_pept        171631..172461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0195"
FT                   /product="ABC transporter substrate-binding protein-amino
FT                   acid transport"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23413"
FT                   /protein_id="ACO23413.1"
FT                   /translation="MKKIVKYSSLAALGLVAAGVLAACSGGAKKEGEAASKKEIIVATN
FT                   GSPRPFIYEENGELTGYEIEVVRAIFKDSDKYDVKFEKTEWSGVFAGLDADRYNMAVNN
FT                   LSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQLEAY
FT                   NAEHTDNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDNLKVIELPS
FT                   DQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAEADIK"
FT   gene            172615..173469
FT                   /locus_tag="SPT_0196"
FT   CDS_pept        172615..173469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0196"
FT                   /product="lipoprotein"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23069"
FT                   /protein_id="ACO23069.1"
FT                   /translation="MKIKKWLGLAALATVAGLALAACGNSEKKADNATTIKIATVNRSG
FT                   SEEKRWDKIQELVKKDGITLEFTEFTDYSQPNKATADGEVDLNAFQHYNFLNNWNKENG
FT                   KDLVAIADTYISPIRLYSGLNGSANKYTKVEDIPANGEIAVPNDATNESRALYLLQSAG
FT                   LIKLDVSGTALATVANIKENPKNLKITELDASQTARSLSSVDAAVVNNTFVTEAKLDYK
FT                   KALFKEQADENSKQWYNIIVAKKDWETSPKADAIKKVIAAYHTDDVKKVIEESSDGLDQ
FT                   PVW"
FT   gene            173569..174942
FT                   /locus_tag="SPT_0197"
FT   CDS_pept        173569..174942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0197"
FT                   /product="acetylornithine
FT                   deacetylase/succinyl-diaminopimelate desuccinylase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22517"
FT                   /protein_id="ACO22517.1"
FT                   /translation="MVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEV
FT                   ANYLGEIFKRVGAEVEIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTE
FT                   DPFTLSVRNGFMYGRGVDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTD
FT                   LDKYLEKHADKLRGADLLVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYG
FT                   GVVESAPWYLLQALQSLRAADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIY
FT                   GLELPLLQEERMAFLKRFFFDPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLE
FT                   PHDVLEKIRKQLDKNGFDKVELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLP
FT                   TTAGTGPMHTVFDALEVPMVAFGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE"
FT   gene            174935..175996
FT                   /locus_tag="SPT_0198"
FT   CDS_pept        174935..175996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0198"
FT                   /product="methionine import ATP-binding protein MetN"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24264"
FT                   /protein_id="ACO24264.1"
FT                   /translation="MSRDIIKLDQIDVTFHQKKRTITAVKDVTIHIQEGDIYGIVGYSG
FT                   AGKSTLVRVINLLQKPSAGKITIDDDVIFDGKVTLTAEQLRRKRQDIGMIFQHFNLMSQ
FT                   KTAEENVAFALKHSELSKEEKKAKVAKLLDLVGLADRAENYPSQLSGGQKQRVAIARAL
FT                   ANDPKILISDESTSALDPKTTKQILALLQDLNQKLGLTVVLITHEMQIVKDIANRVAVM
FT                   QDGHLIEEGSVLEIFSDPKQPLTQDFISTATGIDEAMAKIEKQEIVEHLSENSLLVQLK
FT                   YAGASTDEPLLNELYKHYQVMANILYGNIEILDGTPVGELVLVLSGEKAALAGAQEAIR
FT                   QAGVQLKVLKGVQ"
FT   gene            175998..176690
FT                   /locus_tag="SPT_0199"
FT   CDS_pept        175998..176690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0199"
FT                   /product="ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23865"
FT                   /protein_id="ACO23865.1"
FT                   /translation="MESLIQTYLPNVYKMGWAGQAGWGTAIYLTLYMTVLSFIIGGFLG
FT                   LVAGLFLVLTAPGGVLENKVVFWILDKITSIFRAVPFIILLAILSPLSHLIVKTSIGPN
FT                   AALVPLSFAVFAFFARQVQVVLAELDGGVIEAAQASGATFWDIVGVYLSEGLPDLIRVT
FT                   TVTLISLVGETAMAGAVGAGGIGNVAIAYGFNRYNHDVTILATIIIILIIFAIQFLGDF
FT                   LTKKLSHK"
FT   gene            complement(176720..177289)
FT                   /locus_tag="SPT_0200"
FT   CDS_pept        complement(176720..177289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0200"
FT                   /product="membrane-bound protein"
FT                   /note="identified by match to protein family HMM TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23136"
FT                   /protein_id="ACO23136.1"
FT                   /translation="MKKSILTTLLFAVLYFLCMGIGVLLGNLFDQTGNMFYAPAFTALV
FT                   GGSVYMILVAKVPRFGAITTIGLVIAFFFLGTKHGAGSFLPGIICGLLADEVAHLGKYK
FT                   DKTKNFLSFIIFAFSTTGPILLMWIAPKAYMATLLARGKSQEYIDRIMVAPTPGTVLLF
FT                   IASIVIGALVGALIGQALSKKFAQKI"
FT   gene            177424..178038
FT                   /locus_tag="SPT_0201"
FT   CDS_pept        177424..178038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0201"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF04854"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22954"
FT                   /protein_id="ACO22954.1"
FT                   /translation="MGRFLDFVFNRFFLGMIATAFFWLLTLAGGIILGLAPASATLMSL
FT                   YAEHGYSFREYSLKEAWSLYKQNFVSSNLIFYSFLGVGLVLTYGLYLLVQLPHQTIVHL
FT                   IATLLNVLVVALIFLAYTVSLKLQVYFALSYRNSLKLSLIGIFMSLAAVAKVLLGTVLL
FT                   VAIGYYMPALLFFVGIGMWHFFISDMLEPVYEIIHEKLATK"
FT   gene            178088..179686
FT                   /locus_tag="SPT_0202"
FT   CDS_pept        178088..179686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0202"
FT                   /product="sensor histidine kinase, putative"
FT                   /note="identified by match to protein family HMM PF00672;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22989"
FT                   /protein_id="ACO22989.1"
FT                   /translation="MIIIIASFAILLSYADWDSREKEAQRVAQRVTARTVSEIEYYHRE
FT                   STQIAQALVENQARIEGIYKYFSLSMPDYFYWQLERKASPYISVSLYENVDDLYVRNDF
FT                   VTGVAIAFQDYKEVYVSTKDKRSGEKIRAEDFKPAGNSFAIPVSDPVSDQDLGVIYISL
FT                   NPAVLYHAIDNTRGHTPMAVTVTSPFDTEIFHIGETVDRESENWLVGLTSHGYQVQVAV
FT                   PKNFVLQGTVTSSALIVGLSLLFIVILYLTLRQTFANYQKQVVDLVESIQVIAQGEEGR
FT                   RIDISEKDQELLLIAETTNDMLDRLEKNIHDIYQLELSQKDANMRALQAQINPHFMYNT
FT                   LEFLRMYAVMQSQDELADIIYEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYPK
FT                   SIAYGFKIDPELENMKIPKFTLQPLVENYFAHGVDHRRTDNVISIKALKQDGFVEILVV
FT                   DNGRGMSAEKLANIREKLSQRNFEHQASYSDQRQSIGIINVHERFVLYFGDRYAITIES
FT                   AEQAGVQYRITIQDE"
FT   gene            179698..180984
FT                   /locus_tag="SPT_0203"
FT   CDS_pept        179698..180984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0203"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23287"
FT                   /protein_id="ACO23287.1"
FT                   /translation="MYKVLLVDDEYMVTEGLKRLIPFDKWDMEVVATVSHADEALEYVQ
FT                   ENPVDVIISDVNMPDKTGLDMIREMKEILPDAAYILLSGYQEFDYVKRAMNLSVVDYLV
FT                   KPVDKVELGNLLEKIAGQLGERGKKSQTLSQELDEAEFVSYLGDKENWWIGLSKEKQGS
FT                   FTIPYYVLGQAWQIFISDQPLDGLVVTPFEAPYQEHFERWKLNAEKTLFYGSVNLQQSE
FT                   SLFAYYEPIYRVIIQGNLNQIVEELNLLEKVVLENTPRIPITKQLFIQFVMDVFHLFEH
FT                   LKADDMTDIVKTIHAIQSFDELVSYIKETLISFFGQYRMNENVVSVLEVIGRDYQKELS
FT                   LKDISKALFINPVYLGQLIKRETDSTFAELLNKQRIKAAQQLLLSTSDSIEDICYAVGY
FT                   SNLGYFYKVFRKLCGKSPKAYRKQVETIL"
FT   gene            181036..181569
FT                   /locus_tag="SPT_0204"
FT   CDS_pept        181036..181569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22499"
FT                   /protein_id="ACO22499.1"
FT                   /translation="MKKKPIYLWVLLILSALISVPSLFGIVSPLPSKEALRAAQKQVAG
FT                   VNAQQLEDQLNYTYRVAEASHSIFNVALIVLSTILVVVAIVFLVRKNLQYANYTYVGYV
FT                   LLAIIGSIYGYVGLQDAVQLVQDESMRLTVSIGSKAVSIFYIVINVLFLALVFYKMWRQ
FT                   QKALAEEEETEELA"
FT   gene            181647..182117
FT                   /locus_tag="SPT_0205"
FT   CDS_pept        181647..182117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0205"
FT                   /product="ribonucleotide reductase"
FT                   /note="identified by match to protein family HMM PF07972"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22392"
FT                   /protein_id="ACO22392.1"
FT                   /translation="MKTISLVYISLSGNTESFVTRLKDYLLSQYKGIEVQKIHIKDLVK
FT                   EGKNFYEMDHPYVAFLPTYLEGGNGVDNGDVEILTTPVGDFIAYGNNASKCFGVVGSGN
FT                   RNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYELEKEN"
FT   gene            complement(182423..183769)
FT                   /locus_tag="SPT_0206"
FT   CDS_pept        complement(182423..183769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0206"
FT                   /product="Spn1 transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23693"
FT                   /protein_id="ACO23693.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYDGLIFFQELFSQLKLKER
FT                   ISKYLVTNDHRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGF
FT                   FGDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVR
FT                   TGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPGRKASLMMH"
FT   gene            complement(184118..185380)
FT                   /locus_tag="SPT_0207"
FT   CDS_pept        complement(184118..185380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0207"
FT                   /product="mn2+ and fe2+ transporter of the nramp family"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24251"
FT                   /protein_id="ACO24251.1"
FT                   /translation="MSQAISLNQSTWASKLKAMGPGILMATAAVGGSHIVSSTQAGGSY
FT                   GWSLLLLVILANVFKYPFFRFGAEYTADTGKTLVEGYAEKGKLYLWIFFILNVFSAMVN
FT                   TAGVAILCSAIIASAFPMIGLSITQWSLILVAIIWAMLLFGGYKLLDGMVKWIMSALTI
FT                   ATVLAVIIAAVKHPEYSSDFVEKTPWQMAALPFIVSLLGWMPAPIEISAINSLWSAEKR
FT                   KTVNFNTEDALFDFNTGYIGTAILAVFFVALGALIQYPTGQAVEAASAKYISQFVGMYA
FT                   SVLGEWSRYLITFIAFLCIFGTVITVIDGYSRVNQESLRLLISQKEDNRKSLNIWMTIT
FT                   AIIGIVIIKFFAGQVSTMLRFAMIGSFLTTPFFALLNYALVTRENKNLPSWLKHLAIAG
FT                   LIFLFGFAIFFIYALAIGKAG"
FT   gene            complement(185690..186148)
FT                   /locus_tag="SPT_0208"
FT   CDS_pept        complement(185690..186148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22272"
FT                   /protein_id="ACO22272.1"
FT                   /translation="MKKQVFHDAAAGVLIGLILSILFSLIYAPNTYAPLNPYSLIGQVM
FT                   DQHQVHGALVLLYCTLIWATIGMLFNFGNRLFSRDWSMLRATLTHFFLMLAGFVPLATL
FT                   AGWFPFHWIFYLQLIIEFAIVYLIIWAILYKREAKKVDHINQLLEHRK"
FT   gene            complement(186145..186585)
FT                   /locus_tag="SPT_0209"
FT   CDS_pept        complement(186145..186585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0209"
FT                   /product="response regulator of the LytR/AlgR family"
FT                   /note="identified by match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22385"
FT                   /protein_id="ACO22385.1"
FT                   /translation="MKVELQISETYEEEKLIVQAPQPTDKVQKVIEFAENLDQREKIKG
FT                   KIDDQVYLVEIGKIQRFYIENRKVLAETASQTYSIDLRLYQVLKLLPTNFIQISQSEII
FT                   NIDSISHLKLTPNGLIEIFLKNESFTYSSRRYLKTIKEKLEL"
FT   gene            complement(186673..186798)
FT                   /locus_tag="SPT_0210"
FT   CDS_pept        complement(186673..186798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0210"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24128"
FT                   /protein_id="ACO24128.1"
FT                   /translation="MVYSIKIKEQTRKLGADSSKHCFEVVDKTDKVNNYPTARRR"
FT   gene            186941..188890
FT                   /locus_tag="SPT_0211"
FT   CDS_pept        186941..188890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0211"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="identified by match to protein family HMM PF01119;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF08676; match to protein family HMM TIGR00585"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23547"
FT                   /db_xref="GOA:C1CP43"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP43"
FT                   /protein_id="ACO23547.1"
FT                   /translation="MSHIIELPEMLANQIAAGEVIERPASVVKELVENAIDAGSSQIII
FT                   EIEEAGLKKVQITDNGHGIAHDEVELALRRHATSKIKNQADLFRIRTLGFRGEALPSIA
FT                   SVSVLTLLTAVDGASHGTKLVARGGEVEEVIPATSPVGTKVCVEDLFFNTPARLKYMKS
FT                   QQAELSHIIDIVNRLGLAHPEISFSLISDGKEMTRTAGTGQLRQAIAGIYGLVSAKKMI
FT                   EIENSDLDFEISGFVSLPELTRANRNYISLFINGRYIKNFLLNRAILDGFGSKLMVGRF
FT                   PLAVIHIHIDPYLADVNVHPTKQEVRISKEKELMTLVSEAIANSLKEQTLIPDALENLA
FT                   KSTVRNREKVDQTILPLKENTLYYEKTEPSRPSQTEVADYQVELTDEGQDLTLFAKETL
FT                   DRLTKPAKLHFAERKPANYDQLDHPELDLASIDKAYDKLEREEASSFPELEFFGQMHGT
FT                   YLFAQGRDGLYIIDQHAAQERVKYEEYRESIGNVDQSQQQLLVPYIFEFPADDALRLKE
FT                   RMPLLEEVGVFLAEYGENQFILREHPIWMAEEEIESGIYEMCDMLLLTKEVSIKKYRAE
FT                   LAIMMSCKRSIKANHRIDDHSARQLLYQLSQCDNPYNCPHGRPVLVHFTKSDMEKMFRR
FT                   IQENHTSLRELGKY"
FT   gene            complement(189215..189682)
FT                   /gene="ribH"
FT                   /locus_tag="SPT_0212"
FT   CDS_pept        complement(189215..189682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="SPT_0212"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by match to protein family HMM PF00885;
FT                   match to protein family HMM TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23156"
FT                   /db_xref="GOA:C1CP44"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP44"
FT                   /protein_id="ACO23156.1"
FT                   /translation="MNTYEGNLVANNIKIGIVVARFNEFITSKLLSGALDNLKRENVNE
FT                   KDIEVAWVPGAFEIPLIASKMAKSKKYDAIICLGAVIRGNTSHYDYVCSEVSKGIAQIS
FT                   LNSEIPVMFGVLTTDTIEQAIERAGTKAGNKGSECAQGAIEMVNLIRTLDA"
FT   gene            complement(189683..190888)
FT                   /locus_tag="SPT_0213"
FT   CDS_pept        complement(189683..190888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0213"
FT                   /product="riboflavin biosynthesis protein ribAB"
FT                   /EC_number="3.5.4.25"
FT                   /note="identified by match to protein family HMM PF00925;
FT                   match to protein family HMM PF00926; match to protein
FT                   family HMM TIGR00505; match to protein family HMM
FT                   TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22613"
FT                   /protein_id="ACO22613.1"
FT                   /translation="MEYRKIQEALEALQKGRLVLVIDDKDRENEGDLICSAQAATTENV
FT                   NFMATYAKGLICMPMSESLANQLMLSPMVENNTDNHKTAFTVSIDYKETTTGISAEERG
FT                   LTARMCVAEDITPSDFRRPGHMFPLIAKKGGVLERNGHTEATVDLLKLAGLKECGLCCE
FT                   IMNHDGKMMRIDDLIQFSKKHNIPLITIKELQEYRKAYDQLVERVSTVNMPTRYGNFKA
FT                   ISYIDKLNGEHHLALIMGNIEDEANVLCRVHSECLTGDVLGSLRCDCGQQFDKAMKIIV
FT                   ENGSGVLLYLRQEGRGIGLINKLKAYHLQDQGMDTLDANLALGFEGDLREYHIGAQMLK
FT                   DLGLQSLHLLTNNPDKVEQLEKYGITISSRISIEIEANPYDSFYLETKKNRMGHILNME
FT                   EK"
FT   gene            complement(190908..191543)
FT                   /gene="ribE"
FT                   /locus_tag="SPT_0214"
FT   CDS_pept        complement(190908..191543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="SPT_0214"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="identified by match to protein family HMM PF00677;
FT                   match to protein family HMM TIGR00187"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23323"
FT                   /protein_id="ACO23323.1"
FT                   /translation="MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNG
FT                   ICLTVTHFNHQSFTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDG
FT                   TGKISSIKKDDNAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHT
FT                   LKQTILKSKQVGSTVNLENDILGKYVQKLMDNSPKSEISKELLYQNGF"
FT   gene            complement(191528..192628)
FT                   /gene="ribD"
FT                   /locus_tag="SPT_0215"
FT   CDS_pept        complement(191528..192628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SPT_0215"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM PF01872; match to protein
FT                   family HMM TIGR00227; match to protein family HMM
FT                   TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22752"
FT                   /protein_id="ACO22752.1"
FT                   /translation="MSDSKYMKLAIKLAQKGAGYVNPNPMVGAVIVKDNHIIGQGYHEF
FT                   FGGSHAERNALKNCRESPVGATLYVTLEPCCHFGKTPPCIDAIIDSGITRVVIGSLDCN
FT                   PIVSGKGVKILEENNLQVTVGILENECLNLIKSFRKYITQHVPYVFMKYAMTIDGKIAT
FT                   KTNQSKWITEEEARKHVHQLRHHVSAIMVGVNTVIQDDPLLTCRLEEGKNPIRIICDTH
FT                   LRTPLTSKIVKTANDIKTYIATSSEDKNKMKLYQNHGCEILSIKKKGNHIDLSSLMQHL
FT                   GNMQIDSLVLEGGSLMNWSALEQQIVDELKIYIAPKIFGGSAKFPVGGEGISLPNDAIR
FT                   LKPYAFSQIGNDYLIESEVIYPCSQE"
FT   misc_binding    complement(192762..192876)
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element); riboswitch00003"
FT   gene            193033..193626
FT                   /gene="ruvA"
FT                   /locus_tag="SPT_0216"
FT   CDS_pept        193033..193626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="SPT_0216"
FT                   /product="holliday junction DNA helicase RuvA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF01330;
FT                   match to protein family HMM PF07499; match to protein
FT                   family HMM TIGR00084"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22435"
FT                   /db_xref="GOA:C1CP48"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP48"
FT                   /protein_id="ACO22435.1"
FT                   /translation="MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEDQ
FT                   IYVHQVVREDAHLLYGFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETK
FT                   NITYLTKFPKIGKKTAQQMVLDLEGKVVVAGDDLPAKIAVQASAENQELEEAMEAMLAL
FT                   GYKATELKKIKKFFEGTTDTAENYIKSALKMLVK"
FT   gene            193636..194199
FT                   /locus_tag="SPT_0217"
FT   CDS_pept        193636..194199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0217"
FT                   /product="DNA-3-methyladenine glycosylase 1"
FT                   /EC_number="3.2.2.20"
FT                   /note="identified by match to protein family HMM PF03352"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24129"
FT                   /protein_id="ACO24129.1"
FT                   /translation="MTKRCSWVKMTNPLYIAYHDEEWGQPLHDDQALFELLCMETYQAG
FT                   LSWETVLNKRQAFREAFHSYQIHSVAEMTDTELEAMLENPAIIRNRAKIFATRANAQAF
FT                   LQLQAEYGSFDAYLWSFVEGKTVVNDVPDYRQAPAKTPLSEKLAKDLKKRDFKFTGPVA
FT                   VLSFLQAAGLVDDHENDCEWKGLK"
FT   gene            194196..194873
FT                   /locus_tag="SPT_0218"
FT   CDS_pept        194196..194873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0218"
FT                   /product="caax amino protease family"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23556"
FT                   /protein_id="ACO23556.1"
FT                   /translation="MMSNKNKGILIFAILYTVLFVFDGVKLLASLMPSAIANYLVYVVL
FT                   ALYGSFLFKDRLIQQWKEIRKTKRKFFFGVLTGWLFLILMTVVFEFVSEMLKQFVGLDG
FT                   QGLNQSNIQSTFQEQPLLIAVFACVIGPLVEELFFRQVLLHYLQERLSGLLSIILVGLV
FT                   FALTHMHSLALSEWIGAVGYLGGGLAFSIIYVKEKENIYYPLLVHMLSNSLSLIILAIS
FT                   IVK"
FT   gene            complement(195010..196041)
FT                   /locus_tag="SPT_0219"
FT   CDS_pept        complement(195010..196041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0219"
FT                   /product="MccC family protein"
FT                   /note="identified by match to protein family HMM PF02016"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23356"
FT                   /protein_id="ACO23356.1"
FT                   /translation="MVSTIGIVSLSSGIIGEDFVKHEVDLGIQRLKDLGLNPIFLPHSL
FT                   KGLDFIKDHPEARAEDLIHAFSDDSIDMILCAIGGDDTYRLLPYLFENDQLQKVIKQKI
FT                   FLGFSDTTMNHLMLHKLGIKTFYGQSFLADICELDKEMLAYSLHYFKELIETGRISEIR
FT                   PSDVWYEERTDFSPTALGTPRVSHTNTGFDLLQGSAQFEGKILGGCLESLYDIFDNSRY
FT                   ADSTELCQKYKLFPDLSDWEGKILLLETSEEKPKPEDFKKMLLTLKDTGIFAVINGLLV
FT                   GKPMDETFHDDYKEALLDIIDSNIPIVYNLNVGHATPRAIVPFGVHAHVDAQEQVILFD
FT                   YNK"
FT   gene            complement(196296..196979)
FT                   /locus_tag="SPT_0220"
FT   CDS_pept        complement(196296..196979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06570"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22996"
FT                   /protein_id="ACO22996.1"
FT                   /translation="MSQIDLQKLTKKNQEFVHIATQQFIKDGKTDAEIQTIFEEVIPQI
FT                   LEEQSKGTTARSLYGAPTHWAHSFTVKEQYEKEHPKENDDPKLMIMDSALFITSLFALV
FT                   SALTTFFAADQAFGYGLITLLLVGLVGGFAFYLMYYFVYQYYGPDMDRSQRPPFWKSVL
FT                   VILASMFLWLLVFFATSFLPASLNPVLDPLPLAIIGAALLALRFYLKKRLNIRSASAGP
FT                   TRYQE"
FT   gene            complement(196991..197935)
FT                   /locus_tag="SPT_0221"
FT   CDS_pept        complement(196991..197935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0221"
FT                   /product="magnesium and cobalt transporter"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23299"
FT                   /protein_id="ACO23299.1"
FT                   /translation="MKQVFLSTTTEFKEIDTLEPGTWINLVNPTQNESLEIANTFDIDI
FT                   ADLRAPLDAEEMSRITIEDEYTLIIVDVPVTEERNNRTYYVTIPLGIIITEETIITTCL
FT                   EPLPVLDVFINRRLRNFYTFMRSRFIFQILYRNAELYLTALRSIDRKSEQIESQLHQST
FT                   RNEELIELMELEKTIVYFKASLKTNERVIKKLTSSTSNIKKYLEDEDLLEDTLIETQQA
FT                   IEMADIYGNVLHSMTETFASIISNNQNNIMKTLALVTIVMSIPTMVFSAYGMNFKDNEI
FT                   PLNGEPNAFWLIVFIAFAMSVSLTLYLIHKKWF"
FT   gene            complement(198096..199262)
FT                   /locus_tag="SPT_0222"
FT   CDS_pept        complement(198096..199262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0222"
FT                   /product="prophage Sa05, site-specific recombinase, phage
FT                   integrase family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24115"
FT                   /protein_id="ACO24115.1"
FT                   /translation="MKITEVIKKDGSKVYRANVYLGVDQVTGKKVKTKVTGRTQKEVKQ
FT                   KANQEKIAFQKAGSTRQKAVTIKNYQELATLWLESYKNTVKPNTQGNVKKLIDNHILPI
FT                   FGAYKLDKLTTPLIQSIINELADKTNRGEKAAFLHYDKIHALNKRILQYGVTMQAIPSN
FT                   PARDVVLPRNTQKAKRKKVKHFENQELKKFLGYLDNLDTHRYRYYYETTLYKFLLATGC
FT                   RINEALALSWSDIDLDNAVVHITKTLNRDIEINSPKSKASYRDIDIDQATVSMLKQYKL
FT                   RQTKEAWKIGQRERVVFSDFIHEYPSSSRLKRRLQTHFKRADVPNIGFHGFRHTHASLL
FT                   LNSGIPYKELQYRLGHSTLSMTMDIYSHLSKENAKKAVSFYETALKAL"
FT   gene            complement(199347..200861)
FT                   /locus_tag="SPT_0223"
FT   CDS_pept        complement(199347..200861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0223"
FT                   /product="divergent AAA domain family"
FT                   /note="identified by match to protein family HMM PF04326"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22526"
FT                   /protein_id="ACO22526.1"
FT                   /translation="MRKYDIPKLLLSGENQGVEFKEAKNSFPKDGMKTICSFANTNNGL
FT                   LILGVSENTKNKDFYISGVNDPDKVLDELYSLLNNPNKINRNVINEESVEVVNIKGKEI
FT                   VIIPVNKVDYKDKPIYLNDNIASTYFRQGTGDFRCSQEQINSMLRDSAKESFDSTLIQD
FT                   FSILDLDTETIKLYREKFDNINAEHPFSKLDNEQFLIKINALRRDRKDDKIKPTVAGLL
FT                   IFGTHNSIKEFIPHYNVEYVLKEFSENNRFKDRVIYDGTWGEDNLFNFFYLVIEKLYLT
FT                   LNDNSNIQENSMNRIGISKLRIAIREAFINSLIHSDYKSEKGIMIIRYPDRYIFTNGGT
FT                   LRIDIKDFFSGAHSDPRNYLIQEIFRFLNLCEKAGTGIPKIMEAVKESHLKYPNLRTEL
FT                   DSVEFTLWDTSLIDNLDIDNEYEKKILELIIEHRFVTREALEEKLKIHKNTILKYLKKL
FT                   VEKQAIDKFKSGRQYVYFITQNQDPEFQKYNHINAMYSLLEEIKRK"
FT   gene            complement(201022..201735)
FT                   /locus_tag="SPT_0224"
FT   CDS_pept        complement(201022..201735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0224"
FT                   /product="putative DNA-binding phage protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23201"
FT                   /protein_id="ACO23201.1"
FT                   /translation="MAKNSPQDLKNREYFSNNLNRVMKEKGIRQIDLHNALEIPKSTIT
FT                   GYVKGRSMPTSGNLQKLADYLGVKKSDLDPRFSDKDVYKEFLYMLDKQLDEEKYLVKNV
FT                   SKDKIFQKVKEREKRDKEIIELAKSKNFPISPEEFLTTITESLNEYNPKDNYEVLNALA
FT                   LKTSNILFWLDIVFQKTSSEFYIVFEDKEFNQEYYNKLYKKFENLFEEIKSLALQEAKK
FT                   DKENLDDFALLWGID"
FT   gene            201936..202118
FT                   /locus_tag="SPT_0225"
FT   CDS_pept        201936..202118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0225"
FT                   /product="putative DNA-binding phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23657"
FT                   /protein_id="ACO23657.1"
FT                   /translation="MRQVAKKVNKNFQTISKYEKDSTLIPFELLKELSELYQVKLDDIF
FT                   LGDSTKKIELNQKEI"
FT   gene            202134..202760
FT                   /locus_tag="SPT_0226"
FT   CDS_pept        202134..202760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22293"
FT                   /protein_id="ACO22293.1"
FT                   /translation="MELVYMDGKKEPYTLSSIVAECAEVKHRHLKILLNKHREDFESFG
FT                   KVQFKISPSESGQNVRDYILNEQQATLLITYLRNTEPVKEFKKNLVKAFFEMREELSKF
FT                   RMQRALEKPKRKTLHDSIETWEAKPKHAHSTMNNLLLKAVTDMNAKQLREERGGYNGID
FT                   SLTSDELEQYQAFEDMVIAMIGLNMSYQEIKAMAFRNKKTRQRSA"
FT   gene            203189..203584
FT                   /locus_tag="SPT_0227"
FT   CDS_pept        203189..203584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22746"
FT                   /protein_id="ACO22746.1"
FT                   /translation="MREIGEKNGLSRLSLLANQTKFIKENLHRLLWIELPELNDSHKIE
FT                   AVSKSTTGMFFHAGIFEMDAMRQAFFKRQAMHFFDNEAEQQAYIEHAEKEYLEATITLK
FT                   DILFNSKNGTQRVNKSCLIEKFEEAMQ"
FT   gene            203581..203781
FT                   /locus_tag="SPT_0228"
FT   CDS_pept        203581..203781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0228"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22296"
FT                   /protein_id="ACO22296.1"
FT                   /translation="MTLNLDNMTQAEFDEVMAEIKEKRPNLFQFIADFVDRKVSTEEVD
FT                   EYLKMKHEKQVEFIKNYQARA"
FT   gene            203783..203998
FT                   /locus_tag="SPT_0229"
FT   CDS_pept        203783..203998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0229"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22943"
FT                   /protein_id="ACO22943.1"
FT                   /translation="MNELDLTNTQSVIFMVVLIGLLLYLNHRDRKKSAQFERENQQRIE
FT                   TPSEDLSPDYGRYIQLAGVRVYGGTE"
FT   gene            203995..204336
FT                   /locus_tag="SPT_0230"
FT   CDS_pept        203995..204336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0230"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23406"
FT                   /protein_id="ACO23406.1"
FT                   /translation="MSLSENDKRVLRLIKVGAENSITGAEISLITKLAERTVQDIISRL
FT                   ITRHSVPIVGVRHGTFRGYFIPANKEELLDGAKAFYNQVQEEQKRLTVLLNADLESYKE
FT                   TLKEVGGYV"
FT   gene            204329..204610
FT                   /locus_tag="SPT_0231"
FT   CDS_pept        204329..204610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0231"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23893"
FT                   /protein_id="ACO23893.1"
FT                   /translation="MFSLSRESEQDLAHGILEVVERYLEARDTVKPRLTGLISAQEVMD
FT                   ELDIKYMTLQKWEKAGLRRYQPPLEDTRKIYYKISDIWKFLGVENGKV"
FT   gene            204745..205611
FT                   /locus_tag="SPT_0232"
FT   CDS_pept        204745..205611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0232"
FT                   /product="phage protein"
FT                   /note="identified by match to protein family HMM PF08708"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22853"
FT                   /protein_id="ACO22853.1"
FT                   /translation="MTIYEAKGFQSNLVYPFDKIEPFQYIERFKPLVVPEGADIEEYKR
FT                   TQAPYCISGKVTPEKHGSYKRNNSSLIYRDLIFLDYDDIQGTSEGFIKAISSALFGYSY
FT                   ILYPTIKHSLEKPRFRLVVKPDNVMNEATYKQVVKEIADKIGLPFDMASLTWSQLQGLP
FT                   VTTGDPASYQKIVEHGLDYPVPQTTAEPVKQNAASLPYTPRPSGQKSMTMRIIDTLFNG
FT                   FGDEGGRNVALTRFVGLLFNKWVDCDLETAYELTKIANSVTVEPLPIEELDRTFSSIAR
FT                   AEYRKRG"
FT   gene            205664..207133
FT                   /locus_tag="SPT_0233"
FT   CDS_pept        205664..207133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0233"
FT                   /product="prophage Sa05, DNA primase, P4 family"
FT                   /note="identified by match to protein family HMM PF08706;
FT                   match to protein family HMM TIGR01613"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23435"
FT                   /protein_id="ACO23435.1"
FT                   /translation="MEQEHPPRTMKELENRIFKAGEEWRAEHTETKVNENTGDVTEKVA
FT                   MPQTFTVAKILSEIVTFTFISKSNIPDYSLLYIYDLDEGIYTASNDLFNLLCKTFDVRI
FT                   KPREWPQIKLMVRTLAKIRKPLESANLIPVQNGIINLETKELLPFSPKYVITSKISTAY
FT                   HAPKRVPTDREGKTFDDWLNSIACNDSELVTLFWQIILEAIDPNHTRNKFAIFYGDGNN
FT                   GKGTFQRFLINLIGESNISALKPAQFAEKHNLETLVGKVCNIGDEAPNEYLKNPSDLMS
FT                   ITSGDTVLVNPKGRPAFEATFKLFNIFSGNYIPNGGNKTKGWYRRIMIVPFNADFNGEK
FT                   EKPWIKNEFLANKEVLEYALYKAINQEPFTHFIEPKAVKGLLEEYQEDNDYLLSWVKHE
FT                   YMEKGWHELDVVPVFIVTRSLKHYAEDMGIPKPNVYGAGKETIKHLQQLTPNRYSLRKK
FT                   RVSPEDFEKLEAWDVDKIKMRTPQHSITKQE"
FT   gene            207486..207653
FT                   /locus_tag="SPT_0234"
FT   CDS_pept        207486..207653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0234"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24013"
FT                   /protein_id="ACO24013.1"
FT                   /translation="MKVKLFEYTRRWEKEDFEKEIDDFMATVEVLDVKFSGTPSSESFN
FT                   SVAIVLVLYR"
FT   gene            207737..208267
FT                   /locus_tag="SPT_0235"
FT   CDS_pept        207737..208267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0235"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23033"
FT                   /protein_id="ACO23033.1"
FT                   /translation="MTLKTFSSKAKTFTFTYEFKDLDTALVAGHALLGYMTGTYCQPVI
FT                   SLTYKDKGTLVAEYVEDHKLNKTFKRICDSFKDYHKQPGEAEAFEERYKRERVLQLKES
FT                   EDFESLLNKVTDYELELLDYADRLLSDKPIPMDSMTAFATLEMLGDESISLLQKLDVEG
FT                   EYKGLAGYTEHLK"
FT   gene            208716..208847
FT                   /locus_tag="SPT_0236"
FT   CDS_pept        208716..208847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0236"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22494"
FT                   /protein_id="ACO22494.1"
FT                   /translation="MFDSFPERPKYMKQKRYYKHYQKFINYTRKGDSFWLNGLSSLR"
FT   gene            210043..210462
FT                   /locus_tag="SPT_0237"
FT   CDS_pept        210043..210462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0237"
FT                   /product="phage protein"
FT                   /note="identified by match to protein family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23123"
FT                   /protein_id="ACO23123.1"
FT                   /translation="MTPEQVKEKLEGVKWINKEIKGLYLELETLEGGIIKKPTLSHSRV
FT                   QTSRENKTENNLISVLKLKEDTLQRIERLTEERMKISELIDKLANPLERSVLRLFYLND
FT                   LVVSEVAEEIDRSNTTVYIIRQKAIEHLTGIVNGD"
FT   gene            210951..213782
FT                   /gene="uvrA"
FT                   /locus_tag="SPT_0238"
FT   CDS_pept        210951..213782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="SPT_0238"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23713"
FT                   /protein_id="ACO23713.1"
FT                   /translation="MQDKIVIHGARAHNLKNIDVEIPRDKLVVVTGLSGSGKSSLAFDT
FT                   LYAEGQRRYVESLSAYARQFLGNMEKPDVDAIDGLSPAISIDQKTTSKNPRSTVGTTTE
FT                   INDYLRLLYARVGTPYCINGHGAINASSVEQIVDKVLELPERQRLQILAPVIRKKKGQH
FT                   KSVIEKVQKDGYVRVRVDGEVYDVTEVPELSKSKQHNIDVVVDRIVIKEGIRSRLFDSI
FT                   EAALRIAEGYVIIDTMDDSELLFSEHYACPVCGFTVPELEPRLFSFNAPFGSCSECDGL
FT                   GIKLEVDTDLVVPDASKTLHEGALAPWNPISSNYYPNMLEQAMKVFGVAMDKPFEDLSE
FT                   EDKNLILYGSDGKEFHFHYENEFGGVRDIDIPFEGVINNIKRRYHETNSDYTRTQMRLY
FT                   MNELTCGTCQGYRLNDQALSVRVGGQQGPHIGEISDLSIADHLDLVSQLTLSENEAIIA
FT                   RPILKEIKDRLTFLNNVGLNYLTLSRSAGTLSGGESQRIRLATQIGSNLSGVLYILDEP
FT                   SIGLHQRDNDRLIASLKKMRDLGNTLIVVEHDEDTMREADYLIDVGPGAGVFGGEIVAA
FT                   GTPKQVARNSKSITGQYLSGKRVIPVPEERRVGNGRFIEVTGARENNLQNVTARFPLGK
FT                   FIAVTGVSGSGKSTLINSILKKAIAQKLNRNSDKPGKFKTITGIEHVDRLIDIDQSPIG
FT                   RTPRSNPATYTGVFDDIRDLFAQTNEAKIRGYKKGRFSFNVKGGRCEACSGDGIIKIEM
FT                   HFLPDVYVACEVCHGTRYNSETLEVHYKEKNISQVLDMTVNDAVEFFQHIPKIQRKLQT
FT                   IKDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSFYILDEPTTGLHTEDIARL
FT                   LKVLARFVDDGNTVLVIEHNLDVIKTADHIIDLGPEGGVGGGTIIVTGTPEEVAANEAS
FT                   YTGHYLKGKLHHE"
FT   gene            213775..214836
FT                   /locus_tag="SPT_0239"
FT   CDS_pept        213775..214836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0239"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM PF01321"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24248"
FT                   /protein_id="ACO24248.1"
FT                   /translation="MNKRVQAFLAKMQEKELDGIIINNLKNVYYLTGFWGSNGTVFISR
FT                   DRQVLVTDSRYIIAAKQETSGFEIVADRDELAVIAGIVKDMGLTRIGFEDEISVSYYHR
FT                   MQAAFAGLDLLPQTQFVEGLRMIKDEAEIAAIRKACSISDQAFRDALDFIKPGKTEIEI
FT                   ANFLDFRMRELGASGLSFDTILASGINSSKPHAHPMHKPVELGEAITMDFGCLYDHYVS
FT                   DMTRTIYLGHVSDEQAEIYNTVLKANQALIDQAKAGLGFRDFDKIPRDIIIEAGYGDYF
FT                   THGIGHGIGLDIHEEPYFSQTSTETIKTGMALTDEPGIYIEGKYGVRIEDDILITETGC
FT                   ELLTLAPKELIVI"
FT   gene            214968..215366
FT                   /locus_tag="SPT_0240"
FT   CDS_pept        214968..215366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0240"
FT                   /product="regulatory protein spx"
FT                   /note="identified by match to protein family HMM PF03960;
FT                   match to protein family HMM TIGR01617"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22745"
FT                   /protein_id="ACO22745.1"
FT                   /translation="MIKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLGKEGITREELLDI
FT                   LTKTDNGIASIVSSKNRYAKALGVDIEDLSVNEVLNLIMETPRILKSPILVDEKRLQVG
FT                   YKEDDIRAFLPRSVRNVENAEARLRAAL"
FT   gene            215432..216001
FT                   /locus_tag="SPT_0241"
FT   CDS_pept        215432..216001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0241"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23250"
FT                   /protein_id="ACO23250.1"
FT                   /translation="MKKIVLVSLAFLFVLVGCGQKKETGPATKTEKDTLQSALPVIENA
FT                   EKNTVVTKTLVLPKSDDGSQQTQTITYKDKTFLSLTIQQKRPVSDELKTYIDQHGVEET
FT                   QKALLEAEEKDKSIIEARKLAGFKLETKLLSATELQTTTSFDFQVLDVKKASQLEHLKN
FT                   IGFENLLKNEPSKYISDRLANGATEQ"
FT   gene            216088..216354
FT                   /locus_tag="SPT_0242"
FT   CDS_pept        216088..216354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06135"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23994"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP74"
FT                   /protein_id="ACO23994.1"
FT                   /translation="MGFTEETVRFKLDDSNKKEISETLTDVYASLNDKGYNPINQIVGY
FT                   VLSGDPAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL"
FT   gene            216358..216777
FT                   /locus_tag="SPT_0243"
FT   CDS_pept        216358..216777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03652;
FT                   match to protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23339"
FT                   /db_xref="GOA:C1CP75"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP75"
FT                   /protein_id="ACO23339.1"
FT                   /translation="MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRV
FT                   KELVDTYKVERFVVGLPKNMNNTSGPRVEASQAYGAKLEEFFGLPVDYQDERLTTVAAE
FT                   RMLIEQADISRNKRKKVIDKLAAQLILQNYLDRKF"
FT   gene            216793..217098
FT                   /locus_tag="SPT_0244"
FT   CDS_pept        216793..217098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06949"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23996"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP76"
FT                   /protein_id="ACO23996.1"
FT                   /translation="MSHDHNHDHEERELITLVDEQGNETLFEILLTIDGKEEFGKNYVL
FT                   LVPVNAEEDEDGQVEIQAYSFIENEDGTEGELQPIPEDSEDEWNMIEEVFNSFMEE"
FT   gene            217406..218656
FT                   /locus_tag="SPT_0245"
FT   CDS_pept        217406..218656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0245"
FT                   /product="dihydrofolate:folylpolyglutamate synthetase"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23405"
FT                   /protein_id="ACO23405.1"
FT                   /translation="MFEVEEWLHSRIGLNFRSGLGRIQQAVDLLGNPEQSYPIIHVTGT
FT                   NGKGSTIAFIRELFMGHGKKVATFTSPHIVSINDRICINGQPIADADFIRLADQVKEME
FT                   KTLLQTPDQLSFFELLTLVAFLYFREQEVDLVLLEVGIGGLLDTTNVVTGELAVITSIG
FT                   LDHQETLGDSLEAIAEQKAGIFKAGKKAVIAKLPPEARLVCQKKAESLAVDLYQAGQDF
FT                   LMLNGDFSSSLLNLSQLNIGLEGVYQQENAALALQTFLLFMGEGKEAVDEQAVRKALEQ
FT                   THWAGRLERIRPQIYLDGAHNLPALTRLVEFIKEKEQEGYRPQILFGALKRKDYQGMLG
FT                   YLTEKLPQVELKVTGFDYQGALDERDVTGYDIVSSYREFISDFEERADAQDLLFVTGSL
FT                   YFISEVRGYLLDREQIN"
FT   gene            218740..219195
FT                   /locus_tag="SPT_0246"
FT   CDS_pept        218740..219195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0246"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23106"
FT                   /protein_id="ACO23106.1"
FT                   /translation="MKLKRFTLSLASLASFSLLVACSQRAQQVQQPVAQQVQQPAQQNT
FT                   NTANAGGNQNQAAPVQNQPVAQPTDIDGTYTGQDDGDRITLVVTGTTGTWTELESDGDQ
FT                   KVKQVTFDSANQRMIIGDDVKIYTVNGNQIVVDDMDRDPSDQIVLTK"
FT   gene            219341..220873
FT                   /locus_tag="SPT_0247"
FT   CDS_pept        219341..220873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0247"
FT                   /product="cardiolipin synthase"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22537"
FT                   /protein_id="ACO22537.1"
FT                   /translation="MKYRKFQLLMSKYGFSLSIMLLELCLVFGLFLYLGRMAPILWITV
FT                   LILLSIITIISIVNRNTTPENKVTWLLVAFVPVFGPLLYLMFGERRLSKKEIKQLKKLG
FT                   SMHFQEANSQLLKEKLKESDKAAYGVIKSLLSMDTNADIYDQTASTFFPNGEAMWKKMV
FT                   EDLKKAEKFIFLEYYIIEEGLMWNRILDILEQKVAQGVEVKMLYDDIGCMATLTGDYAH
FT                   RLRQLGIEAHKFNKVIPRLTVAYNNRDHRKILIVDGQIAYTGGVNLADEYINHVERFGY
FT                   WKDSGIRLDGLAVKALTRLFLTTWYINRGEISDFDQYHLENHSIPSDGLTIPYGSGPKP
FT                   IFRAQVGKKVYQSLINQATESVYITTPYLIIDYDLTETIKNAAMRGVDVRIITPYIPDK
FT                   KFIQLVTRGAYPDLLSAGVRIYEYSPGFIHSKQMLVDEDFAVVGTINLDYRSLVHHYEN
FT                   AVLLYKTPSIREIARDFRNIFADSQEVYPHSIKTSWYQKLVKEIAQLFAPIL"
FT   gene            221131..222669
FT                   /locus_tag="SPT_0248"
FT   CDS_pept        221131..222669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0248"
FT                   /product="competence-induced protein Ccs4"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24255"
FT                   /protein_id="ACO24255.1"
FT                   /translation="MSVYGRVEEVHKENREPLEYQIEQESHHRESSRLPLVKILLWSTL
FT                   VTGITLGVPLLLDLMSAQEVQDFYAGWALHQTGKIYSDYYGSQGLLYYLLTYVSQGGFF
FT                   FAIFEWLALVAGGFFLFRSADTLTNQGDQAGQLVTIFYMLVTGLAFGGGYATLLALPFL
FT                   FAAFSLVAAYLSNPSHDKGFVRIGLALAGGFFFAPLSSLLFIAVVSLGLLVFNLGHRRF
FT                   AHGFYQFLAVALGFSLVFYPTAYYSAATGSFGDAISGIRYPIDSIRFDFTSKILENMFF
FT                   YGLLSLGLGFVVCIFLGLFQSKPFKLYVISVPASLVVILGLILLFFSQEPLHASYLMVV
FT                   FPVFLLLLVTNIKSQQRGRSARRSRRETPVSLWSRFFKGNLYLLVFGFVYLLSVPFLMK
FT                   FVLYPVPYQERNRLADLVKEETNTEDAIYAWDDTATLYRKSERLSPSAILSPLHYTATE
FT                   ENRNKLLNDLKEKQPKVIVVNDKVEVWSEVETLLKENYQQVKTDYSEFKVYKIK"
FT   gene            222789..224996
FT                   /gene="nrdD"
FT                   /locus_tag="SPT_0249"
FT   CDS_pept        222789..224996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="SPT_0249"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF03477; match to protein
FT                   family HMM TIGR02487"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23567"
FT                   /protein_id="ACO23567.1"
FT                   /translation="MIALEEKITILPTLFVEKRDGRRVVFDVDKIDKALHKAADKVMDV
FT                   TPLVEKRLNDLTERIITEIHSRFPQGIKIYEIQNIVEHELLEAKEYALAEEYITYRTQR
FT                   DFERSKATDINFSIHKLLNKDQTVVNENANKDSDVFNTQRDLTAGIVGKSIGLQMLPKH
FT                   VANAHQKGDIHYHDLDYSPYTPMTNCCLIDFKGMLENGFKIGNAEVESPKSIQTATAQI
FT                   SQIIANVASSQYGGCSADRIDEILAPYAEKNYQKHLKDAEEWVLPEKREDYAWKKTQKD
FT                   IYDAMQSLEYEINTLFTSNGQTPFTSLGFGLGTSRFEREIQKAILNIRIKGLGSEHRTA
FT                   IFPKLIFTLKRGLNLEEGTPNYDIKQLALECATKRMYPDVLSYDKIVDLTGSFKVPMGC
FT                   RSFLQGWKDENGVEVNSGRMNLGVVTVNLPRIALESEGDMNKFWEIFNERMNIAEDALV
FT                   YRVERTKEATPANAPILYQYGAFGHRLGKEESVDQLFKNRRATVSLGYIGLYEVATVFF
FT                   GNSWESNPDAKEFTLDIIHDMKRRVEEWSDQYGYHFSIYSTPSESLTDRFCRLDIDKFG
FT                   SIPDITDKEYYTNSFHYDVRKNPTPFEKLDFEKVYPEAGASGGFIHYCEYPVLQQNPKA
FT                   LEAVWDYAYDRVGYLGTNTPIDRCYKCDFEGDFEPTERGFACPNCGNSDPKTVDVVKRT
FT                   CGYLGNPQARPMVNGRHKEIAARVKHMNGSTIKIAGHQVTN"
FT   gene            225028..225168
FT                   /locus_tag="SPT_0250"
FT   CDS_pept        225028..225168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0250"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23226"
FT                   /protein_id="ACO23226.1"
FT                   /translation="MVKRTCGYLGNPQARPMVNGRHKEIAARVKHMNGSTIKIAGHQVT
FT                   N"
FT   gene            225180..225320
FT                   /locus_tag="SPT_0251"
FT   CDS_pept        225180..225320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22485"
FT                   /protein_id="ACO22485.1"
FT                   /translation="MGKYQLDDKGRAQVTRYHEKHSKGGAGKKERLLSFREQFLNKNKK
FT                   K"
FT   gene            225364..225870
FT                   /locus_tag="SPT_0252"
FT   CDS_pept        225364..225870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0252"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22787"
FT                   /protein_id="ACO22787.1"
FT                   /translation="MELRRPRLADKKAVLDMMTEFEKSQSAHDGGFWDTENFVYEEWLE
FT                   SNQEQEMGINLPEGWVPAIQLVAFSEKGQAVGFLNLRLRLSNFLLEEGGHIGYSIRPSE
FT                   RGKGYAKETLRQGLQVAKEKNIKKALVTCSVNNPASRAVILANGGIFEDAHNGVERYWI
FT                   EVANE"
FT   gene            225863..226453
FT                   /gene="nrdG"
FT                   /locus_tag="SPT_0253"
FT   CDS_pept        225863..226453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="SPT_0253"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR02491"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22342"
FT                   /protein_id="ACO22342.1"
FT                   /translation="MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVSGCMFH
FT                   CEGCYNVATWSFNAGILYTAELEEQIMADLAQPYVQGLTLLGGEPFLNTGILLPLVKRI
FT                   RKELPDKDIWSWTGYTWEEMMLETPDKLELLSLIDILVDGRYDRTKRNLMLQFRGSSNQ
FT                   RIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE"
FT   gene            226450..227067
FT                   /locus_tag="SPT_0254"
FT   CDS_pept        226450..227067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0254"
FT                   /product="phosphoribulokinase / Uridine kinase family"
FT                   /note="identified by match to protein family HMM PF00485"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23961"
FT                   /protein_id="ACO23961.1"
FT                   /translation="MKKKDLVDQLVSEIETGKVRTLGIYGHGASGKSTFAQELYQALDS
FT                   TTVNLLETDPYITSGRHLVVPKDAPNQKVTASLPVAHELESLQRDILALQAGMDVLTIE
FT                   EPWKASEVLSGAKPILIVEGMSVGFLPKELFEKTICFYTDEETELKRRLARDTTVRNRD
FT                   ASFILASHQMRREQYLRYYKETESKADILVDQSEDKFDVKRT"
FT   gene            227333..227641
FT                   /gene="rpsJ"
FT                   /locus_tag="SPT_0255"
FT   CDS_pept        227333..227641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SPT_0255"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23466"
FT                   /db_xref="GOA:C1CP87"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP87"
FT                   /protein_id="ACO23466.1"
FT                   /translation="MANKKIRIRLKAYKHRTLDTAAAKIVESATRTGAQVAGPIPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            227858..228484
FT                   /gene="rplC"
FT                   /locus_tag="SPT_0256"
FT   CDS_pept        227858..228484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SPT_0256"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22567"
FT                   /db_xref="GOA:C1CP88"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP88"
FT                   /protein_id="ACO22567.1"
FT                   /translation="MTKGILGKKVGMTQIFTEAGELIPVTVIEATPNVVLQVKTVETDG
FT                   YNAIQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNVEGLEVGAEITVETFAAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLAGRMG
FT                   GDRVTIQNLEVVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
FT   gene            228509..229132
FT                   /gene="rplD"
FT                   /locus_tag="SPT_0257"
FT   CDS_pept        228509..229132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SPT_0257"
FT                   /product="ribosomal protein L4/L1 family"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23918"
FT                   /db_xref="GOA:C1CP89"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP89"
FT                   /protein_id="ACO23918.1"
FT                   /translation="MANVTLFDQTGKEAGQVVLSDAVFGIEPNESVVFDVIISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSEKVAENKFVAVDALSFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFA
FT                   ALSARNLPNVKVATATTASVLDIANSDKLLVTQAAISKIEEVLA"
FT   gene            229132..229428
FT                   /gene="rplW"
FT                   /locus_tag="SPT_0258"
FT   CDS_pept        229132..229428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SPT_0258"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23738"
FT                   /db_xref="GOA:C1CP90"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP90"
FT                   /protein_id="ACO23738.1"
FT                   /translation="MNLYDVIKKPVITESSMAQLEAGKYVFEVDTRAHKLLIKQAVEAA
FT                   FEGVKVANVNTINVKPKAKRVGRYTGFTNKTKKAIITLTADSKAIELFAAEAE"
FT   gene            229446..230279
FT                   /gene="rplB"
FT                   /locus_tag="SPT_0259"
FT   CDS_pept        229446..230279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SPT_0259"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23337"
FT                   /db_xref="GOA:C1CP91"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP91"
FT                   /protein_id="ACO23337.1"
FT                   /translation="MGIRVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNN
FT                   NGRITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLIHNIELKPGRGGELVRAAGASAQ
FT                   VLGSEGKYVLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            230383..230664
FT                   /gene="rpsS"
FT                   /locus_tag="SPT_0260"
FT   CDS_pept        230383..230664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SPT_0260"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23307"
FT                   /db_xref="GOA:C1CP92"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP92"
FT                   /protein_id="ACO23307.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
FT   gene            230676..231020
FT                   /gene="rplV"
FT                   /locus_tag="SPT_0261"
FT   CDS_pept        230676..231020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SPT_0261"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23792"
FT                   /db_xref="GOA:C1CP93"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP93"
FT                   /protein_id="ACO23792.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPN
FT                   KAAEIILKVLNSAVANAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRT
FT                   AHITVAVAEK"
FT   gene            231033..231686
FT                   /gene="rpsC"
FT                   /locus_tag="SPT_0262"
FT   CDS_pept        231033..231686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SPT_0262"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24117"
FT                   /db_xref="GOA:C1CP94"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP94"
FT                   /protein_id="ACO24117.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFVQKE
FT                   LADAAVSTIEIERAVNKVNVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGEGIARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            231690..232103
FT                   /gene="rplP"
FT                   /locus_tag="SPT_0263"
FT   CDS_pept        231690..232103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SPT_0263"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23002"
FT                   /db_xref="GOA:C1CP95"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP95"
FT                   /protein_id="ACO23002.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            232113..232319
FT                   /gene="rpmC"
FT                   /locus_tag="SPT_0264"
FT   CDS_pept        232113..232319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SPT_0264"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23542"
FT                   /db_xref="GOA:C1CP96"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP96"
FT                   /protein_id="ACO23542.1"
FT                   /translation="MKLNEVKEFVKELRGLSQEELAKRENELKKELFELRFQAATGQLE
FT                   QTARLKEVKKQIARIKTVQSEAK"
FT   gene            232344..232604
FT                   /gene="rpsQ"
FT                   /locus_tag="SPT_0265"
FT   CDS_pept        232344..232604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SPT_0265"
FT                   /product="ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24097"
FT                   /db_xref="GOA:C1CP97"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP97"
FT                   /protein_id="ACO24097.1"
FT                   /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            232630..232998
FT                   /gene="rplN"
FT                   /locus_tag="SPT_0266"
FT   CDS_pept        232630..232998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SPT_0266"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22648"
FT                   /db_xref="GOA:C1CP98"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP98"
FT                   /protein_id="ACO22648.1"
FT                   /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKSGARRADGSYIKFDENAAVIIREDKTPRGTRIFGPVAR
FT                   ELREGGFMKIVSLAPEVL"
FT   gene            233076..233381
FT                   /gene="rplX"
FT                   /locus_tag="SPT_0267"
FT   CDS_pept        233076..233381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SPT_0267"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22832"
FT                   /db_xref="GOA:C1CP99"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CP99"
FT                   /protein_id="ACO22832.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLTALPKVNKVIVEGVNIVKKHQ
FT                   RPTNELPQGGIIEKEAAIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
FT   gene            233405..233947
FT                   /locus_tag="SPT_0268"
FT   CDS_pept        233405..233947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0268"
FT                   /product="50S ribosomal protein L5 (BL6)"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22947"
FT                   /db_xref="GOA:C1CPA0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPA0"
FT                   /protein_id="ACO22947.1"
FT                   /translation="MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAV
FT                   SNAKSLEKAAEELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGLDIVIVTTANT
FT                   DEESRALLTGLGMPFAK"
FT   gene            233965..234234
FT                   /locus_tag="SPT_0269"
FT   CDS_pept        233965..234234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0269"
FT                   /product="30S ribosomal protein S14"
FT                   /note="identified by match to protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23817"
FT                   /protein_id="ACO23817.1"
FT                   /translation="MAKKSMVAREAKRQKIVDRYAEKRAALKAAGDYEGLSKLPRNASP
FT                   TRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW"
FT   gene            234519..234917
FT                   /gene="rpsH"
FT                   /locus_tag="SPT_0270"
FT   CDS_pept        234519..234917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SPT_0270"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23658"
FT                   /db_xref="GOA:C1CPA2"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPA2"
FT                   /protein_id="ACO23658.1"
FT                   /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEIIEDDKQGVIRVFLKYGPNGEKVITNLKRVSKPGLRVYKKREDLPKVLNGLGIA
FT                   ILSTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            235109..235645
FT                   /locus_tag="SPT_0271"
FT   CDS_pept        235109..235645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0271"
FT                   /product="50S ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23084"
FT                   /db_xref="GOA:C1CPA3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPA3"
FT                   /protein_id="ACO23084.1"
FT                   /translation="MSRIGNKVIVLPAGVELANNDNVVTVKGPKGELTREFSKDIEIRV
FT                   EGTEVTLHRPNDSKEMKTIHGTTRALLNNMVVGVSEGFKKELEMRGVGYRAQLQGSKLV
FT                   LAVGKSHPDEVEAPEGITFELPNPTTIVVSGISKEVVGQTAAYVRSLRSPEPYKGKGIR
FT                   YVGEFVRRKEGKTGK"
FT   gene            235729..236085
FT                   /gene="rplR"
FT                   /locus_tag="SPT_0272"
FT   CDS_pept        235729..236085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SPT_0272"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23115"
FT                   /db_xref="GOA:C1CPA4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPA4"
FT                   /protein_id="ACO23115.1"
FT                   /translation="MISKPDKNKLRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKEVSKGTKTEQAVAVGKLVAERANAKGISEVVFDRGGYLYHGRV
FT                   KALADAARENGLKF"
FT   gene            236103..236597
FT                   /gene="rpsE"
FT                   /locus_tag="SPT_0273"
FT   CDS_pept        236103..236597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SPT_0273"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22519"
FT                   /protein_id="ACO22519.1"
FT                   /translation="MAFKDNAVELEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGRV
FT                   GFGTGKAQEVPEAIRKAVDDAKKNLIEVPMVGTTIPHEVLSEFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVVELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEIAALRGISVSDL
FT                   A"
FT   gene            236611..236793
FT                   /gene="rpmD"
FT                   /locus_tag="SPT_0274"
FT   CDS_pept        236611..236793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SPT_0274"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by match to protein family HMM PF00327;
FT                   match to protein family HMM TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23514"
FT                   /db_xref="GOA:C1CPA6"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPA6"
FT                   /protein_id="ACO23514.1"
FT                   /translation="MAQIKITLTKSPIGRIPSQRKTVVALGLGKLNSSVIKEDNAAIRG
FT                   MITAVSHLVTVEEVN"
FT   gene            236938..237378
FT                   /gene="rplO"
FT                   /locus_tag="SPT_0275"
FT   CDS_pept        236938..237378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SPT_0275"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22871"
FT                   /db_xref="GOA:C1CPA7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPA7"
FT                   /protein_id="ACO22871.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINAKEYAIVNLDQLNVFEDGAEVTPVVLIEAGIVKA
FT                   EKSGIKILGNGELTKKLTVKAAKFSKSAEEAITAKGGSVEVI"
FT   gene            237391..238701
FT                   /locus_tag="SPT_0276"
FT   CDS_pept        237391..238701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0276"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23847"
FT                   /protein_id="ACO23847.1"
FT                   /translation="MFFKLLREALKVKQVRSKILFTIFIVLVFRIGTSITVPGVNANSL
FT                   NALSGLSFLNMLSLVSGNALKNFSIFALGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYIALVLAFVQSIGITAGFNTLAGAQLIKTALTPQVFLTIGIILTAGSM
FT                   IVTWLGEQITDKGYGNGVSMIIFAGIVSSIPEMIQGIYVDYFVNVPSSRITSSIIFVII
FT                   LIITVLLIIYFTTYVQQAEYKIPIQYTKVAQGAPSSSYLPLKVNPAGVIPVIFASSITA
FT                   APAAILQFLSATGHDWAWVRVAQEMLATTSPTGIAMYALLIILFTFFYTFVQINPEKAA
FT                   ESLQKSGAYIHGVRPGKGTEEYMSKLLRRLATVGSLFLGVISILPIAAKDVFGLSDVVA
FT                   FGGTSLLIIISTGIEGIKQLEGYLLKRKYVGFMDRTE"
FT   gene            238852..239490
FT                   /locus_tag="SPT_0277"
FT   CDS_pept        238852..239490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0277"
FT                   /product="adenylate kinase (ATP-AMP transphosphorylase)
FT                   (AK)(Superoxide-inducible protein 16) (SOI16)"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23352"
FT                   /db_xref="GOA:C1CPA9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPA9"
FT                   /protein_id="ACO23352.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTEM
FT                   GVLAKSYIDKGELVPDEVTNGIVKERLSQDDIKETGFLLDGYPRTIEQAHALDKTLAEL
FT                   GIELEGIINIEVNPDSLLERLSGRIIHRVTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNIAQGEPIIAHYRAKGLVHDIEGNQDINDVFSDIEKVLTNLK"
FT   gene            239607..239825
FT                   /gene="infA"
FT                   /locus_tag="SPT_0278"
FT   CDS_pept        239607..239825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SPT_0278"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF01176; match to protein
FT                   family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22903"
FT                   /protein_id="ACO22903.1"
FT                   /translation="MAKDDVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYI
FT                   RILAGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            239850..239966
FT                   /gene="rpmJ"
FT                   /locus_tag="SPT_0279"
FT   CDS_pept        239850..239966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SPT_0279"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23536"
FT                   /db_xref="GOA:C1CPB1"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPB1"
FT                   /protein_id="ACO23536.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG"
FT   gene            239984..240313
FT                   /locus_tag="SPT_0280"
FT   CDS_pept        239984..240313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0280"
FT                   /product="ribosomal protein S13p/S18e, unverified
FT                   frameshift"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22948"
FT                   /protein_id="ACO22948.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVRV
FT                   RDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   KRSHS"
FT   gene            240368..240751
FT                   /gene="rpsK"
FT                   /locus_tag="SPT_0281"
FT   CDS_pept        240368..240751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SPT_0281"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24024"
FT                   /db_xref="GOA:C1CPB3"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPB3"
FT                   /protein_id="ACO24024.1"
FT                   /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSA
FT                   GALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKSVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   gene            240794..241729
FT                   /gene="rpoA"
FT                   /locus_tag="SPT_0282"
FT   CDS_pept        240794..241729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SPT_0282"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22558"
FT                   /protein_id="ACO22558.1"
FT                   /translation="MIEFEKPNITKIDENKDYGKFVIEPLERGYGTTLGNSLRRVLLAS
FT                   LPGAAVTSINIDGVLHEFDTVPGVREDVMQIILNIKGIAVKSYVEDEKIIELDVEGPAE
FT                   VTAGDILTDSDIEIVNPDHYLFTIGEGSSLKATMTVNSGRGYVPADENKKDNAPVGTLA
FT                   VDSIYTPVTKVNYQVEPARVGSNDGFDKLTLEILTNGTIIPEDALGLSARILTEHLDLF
FT                   TNLTEIAKSTEVMKEADTESDDRILDRTIEELDLSVRSYNCLKRAGINTVHDLTEKSEA
FT                   EMMKVRNLGRKSLEEVKLKLIDLGLGLKDK"
FT   gene            241741..242127
FT                   /gene="rplQ"
FT                   /locus_tag="SPT_0283"
FT   CDS_pept        241741..242127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SPT_0283"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23182"
FT                   /db_xref="GOA:C1CPB5"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPB5"
FT                   /protein_id="ACO23182.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   gene            242392..242658
FT                   /locus_tag="SPT_0284"
FT   CDS_pept        242392..242658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0284"
FT                   /product="ACT domain protein"
FT                   /note="identified by match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23736"
FT                   /protein_id="ACO23736.1"
FT                   /translation="MKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMM
FT                   AVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFEAMYNI"
FT   gene            242668..244005
FT                   /locus_tag="SPT_0285"
FT   CDS_pept        242668..244005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05167"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22682"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPB7"
FT                   /protein_id="ACO22682.1"
FT                   /translation="MDIRQVTETIAMIEEQNFDIRTITMGISLLDCIDPNINRAAEKIY
FT                   QKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAK
FT                   EIGVDFIGGFSALVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVAD
FT                   MGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVKRA
FT                   LEKVRGQSFDVVAETVKKTAFKITRIGQLVGQMASERLGVEFGIVDLSLAPTPAVGDSV
FT                   ARVLEEMGLETVGTHGTTAALALLNDQVKKGGVMACNQVGGLSGAFIPVSEDEGMIAAV
FT                   QNGSLNLEKLEAMTAICSVGLDMIAIPEDTPAETIAAMIADEAAIGVINMKTTAVRIIP
FT                   KGREGDMIEFGGLLGTAPVMKVNGASSVDFISRGGQIPAPIHSFKN"
FT   gene            244192..244941
FT                   /locus_tag="SPT_0286"
FT   CDS_pept        244192..244941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0286"
FT                   /product="phosphoglycerate mutase 2 paralog"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23197"
FT                   /protein_id="ACO23197.1"
FT                   /translation="MGGFYFIIHDIIEANGGRKMVKVRLYLVRHGKTMFNTIGRAQGWS
FT                   DTPLTAEGERGIQELGIGLRESDLQFERAYSSDSGRTIQTMGIILEELGLQGKIPYRMD
FT                   KRIREWCFGSFDGAYDGDLFMGIIPRIFNVDHVHQLSYAELAEGLVEVDTAGWAEGWEK
FT                   LSGRIKEGFEMIAKEMEDQGGGNALVVSHGMTIGTIVYLINGMHPHGLDNGSVTILEYE
FT                   DGQFRVEVVGDRSYRELGREKMEEGSI"
FT   gene            complement(245044..246689)
FT                   /pseudo
FT                   /locus_tag="SPT_0287"
FT                   /note="ABC transporter membrane-spanning permease - iron
FT                   transport, degenerate; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            complement(246679..247770)
FT                   /locus_tag="SPT_0289"
FT   CDS_pept        complement(246679..247770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0289"
FT                   /product="Fe(3+) ions import ATP-binding protein FbpC"
FT                   /EC_number="3.6.3.30"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22414"
FT                   /protein_id="ACO22414.1"
FT                   /translation="MSEIEIINAKKIYHDVPVIENLNITIPKGSLFTLLGASGCGKTTL
FT                   LRMIAGFNSIKDGEFYFDDTKINNMEPSKRNIGLVFQNYAIFPHLTVRDNVAFGLMQKK
FT                   VPKEELIQQTNKYLGLMQIAQYADRKPDKLSGGQQQRVTLACALAVNPSVLLMDEPLSN
FT                   LEAKLRLDMRQAIREIQHEVGITTVYVTHDQEEAMAISDQIAVMKDGVIQQIGRPKELY
FT                   HKPANEFVATFIGRTNIIPANLEKRSDGAYIVFSDGYALRMLALDQVEEQAIHVSIRPE
FT                   EFIKDESGDIEGTISDSVYLGLNTEYFIETGFASKIQVSEESTFEEELQKGNRIRLRIN
FT                   TQKLNIFSADGSQNLIKGVNHGT"
FT   gene            complement(247783..248889)
FT                   /pseudo
FT                   /locus_tag="SPT_0290"
FT                   /note="iron ABC transporter, iron-binding protein,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts"
FT   gene            complement(249121..249318)
FT                   /locus_tag="SPT_0292"
FT   CDS_pept        complement(249121..249318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0292"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22448"
FT                   /protein_id="ACO22448.1"
FT                   /translation="MTLNEYILQYRLKQAIDKMAESPNSPLSAISDQVGFSDYKYFAKV
FT                   FKKYLHISPKKLKSLGRIVK"
FT   gene            complement(249393..250169)
FT                   /locus_tag="SPT_0293"
FT   CDS_pept        complement(249393..250169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0293"
FT                   /product="pyruvate formate-lyase 3"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR02494"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23361"
FT                   /protein_id="ACO23361.1"
FT                   /translation="MEISKGIIFNIQHFSIHDGPGIRTTVFLKGCPLRCPWCSNPESQR
FT                   MKPEKMKDAQREKFTLVGEEKTVEEIITEVLKDKEFYEESGGGLTLSGGEIFAQFEFAK
FT                   AILKSAKEHHIHTAIETTAFVDHEKFIDLIQYVDFIYTDLKHYNSIKHKKVTGVFNQMI
FT                   IKNIHYAFSQNKTIVLRIPVIPNFNNSLEDAEKFATLFNSLNIDQVQLLPFHQFGENKY
FT                   RLLNRKYEMDEINALHPEDLIDYQKVFLNHHINCYF"
FT   gene            250291..251037
FT                   /locus_tag="SPT_0294"
FT   CDS_pept        250291..251037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0294"
FT                   /product="putative HTH-type transcriptional regulator YciT"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220; match to protein
FT                   family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22886"
FT                   /protein_id="ACO22886.1"
FT                   /translation="MKRLEQIIKLVSEYEKIDVNTLSEKLNVSKVTIRKDLDKLESKGL
FT                   LHREHGYAVLNSGDDLNVRLSINYEIKRKIVQEAVKLVSDNETIMIESGSTCALLAEEI
FT                   CKQKRNVTIVTNSFFIANFVRAYDSCRIIVLGGEFQKDSQVTVGPLLKEMIQTFHVHQA
FT                   FVGTDGYDKEMGFTGKDLMRSEVVQYISAASDKVIVLTDSSKFDKRGTVRRFALSQVYE
FT                   VITDEKLSKQNIATLENAGIMVKVVS"
FT   gene            251050..252030
FT                   /locus_tag="SPT_0295"
FT   CDS_pept        251050..252030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0295"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF04198"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22453"
FT                   /protein_id="ACO22453.1"
FT                   /translation="MNQDRNKLLSKIAYLYYIENLNQSQIAAKLGIYRTSISRMLTEAR
FT                   NAGIVKIEIENFDTNMFKLENYVKEKYGLESLEIIPNEFDDNPTILSERISQVAAGVLR
FT                   NLIDDNMKIGFSWGKSLSNLVDLIHSKSVRNVHFYPLAGGPSHIHAKYHVNTLIYEMSR
FT                   KFHGECTFMNATIVQENKLLADGILQSRYFENLKNSWKDLDIAVVGIGDFSNKGKHQWL
FT                   DMLTEDDFKELTKVKTVGEICCRFFDSKGKEVYENLQERTIAISLEDLKNIPQSLAVAY
FT                   GDTKVSSILSVLRANLVNHLITDKNTILKVLEEDGDLTFREILGE"
FT   gene            252225..252545
FT                   /locus_tag="SPT_0296"
FT   CDS_pept        252225..252545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0296"
FT                   /product="phosphotransferase system sugar-specific eiia
FT                   component"
FT                   /note="identified by match to protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23953"
FT                   /protein_id="ACO23953.1"
FT                   /translation="MEIIVPDQIIMGLILYAGDAKQHIYKALDYIKNGTCERCEEEIQL
FT                   ADAALLEAHNLQTKFLAQEASGTKTEITALFVHSQDHLMTSMTEINLIKEIISLRKELH
FT                   KK"
FT   gene            252591..252899
FT                   /locus_tag="SPT_0297"
FT   CDS_pept        252591..252899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0297"
FT                   /product="PTS system, IIB component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23050"
FT                   /protein_id="ACO23050.1"
FT                   /translation="MVKIGLFCAAGFSTGMLVNNMKIAAQSSGVEAEIEAFSQSKLADY
FT                   APNIDVALLGPQVAYTLDKSKEICDKCDVPIAVIPMMDYGMLDGKKVLDLALSLISG"
FT   gene            252916..254214
FT                   /locus_tag="SPT_0298"
FT   CDS_pept        252916..254214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0298"
FT                   /product="lichenan permease iic component (pts system
FT                   lichenan-specific eiiccomponent) (eiic-lic)"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22572"
FT                   /protein_id="ACO22572.1"
FT                   /translation="MSKMDVQKIIAPMMKFVNMRGIIALKDGMLAILPLTVVGSLFLIM
FT                   GQLPFEGLNKSIASVFGANWTEPFMQVYSGTFAIMGLISCFSIAYSYAKNSGVEALPAG
FT                   VLSVSAFFILLRSSYIPKQGEAIGDAISKVWFGGQGIIGAIIIGLVVGSIYTFFIKRKI
FT                   VIKMPEQVPQAIAKQFEAMIPAFVIFLSSMIVYILAKSLTNGGTFIEMIYSAIQVPLQG
FT                   LTGSLYGAIGIAFFISFLWWFGVHGQSVVNGVVTALLLSNLDANKAMLASGNLSLENGA
FT                   HIVTQQFLDSFLILSGSGITFGLVVAMLFAAKSKQYQALGKVAAFPAIFNVNEPVVFGF
FT                   PIVMNPVMFVPFILVPVLAAVIVYGAIATGFMQPFSGVTLPWSTPAILSGFLVGGWQGV
FT                   VTQLLVLAMSTMVYFPFFKIQDRLACQNEIKQS"
FT   gene            254365..256803
FT                   /locus_tag="SPT_0299"
FT   CDS_pept        254365..256803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0299"
FT                   /product="pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF02901; match to protein
FT                   family HMM TIGR01774"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24179"
FT                   /protein_id="ACO24179.1"
FT                   /translation="MVNTEVARTTIKTEYFGSLTERMNKYREDVLNKKPYIDAERAVLA
FT                   TRAYERYKEQPNVLKRAYMLKEILENMSIYIEEESMIAGNQASSNKDAPIFPEYTLEFV
FT                   LNELDLFEKRDGDVFYITEETKEQLRSIAPFWENNNLRARAGALLPEEVSVYMETGFFG
FT                   MEGKMNSGDAHLAVNYQKLLQFGLRGFEERARKAKVALDLTDPASIDKYHFYDSIFIVI
FT                   DAIKVYAKRFVALAKSLAENANPKRKKELLEIADICSRVPYEPATTFAEAIQSVWFIQC
FT                   ILQIESNGHSLSYGRFDQYMYPYMKADLESGKETEDSIVERLTNLWIKTITINKVRSQS
FT                   HTFSSAGSPLYQNVTIGGQTRDKKDAVNPLSYLVLKSVAQTHLPQPNLTVRYHAGLDAR
FT                   FMNECIEVMKLGFGMPAFNNDEIIIPSFIAKGVLEDDAYDYSAIGCVETAVPGKWGYRC
FT                   TGMSYMNFPKVLLITMNDGIDPASGKRFAPSFGHFKDMKNFSELENAWDKTLRYLTRMS
FT                   VIVENSIDLSLEREVPDILCSALTDDCIGRGKHLKEGGAVYDYISGLQVGIANLSDSLA
FT                   AIKKLVFEEERISPSQLWHALETDYAGEEGKVIQEMLIHDAPKYGNDDDYADKLVTAAY
FT                   DIYVDEIAKYPNTRYGRGPIGGIRYSGTSSISANVGQGRGTLATPDGRNAGTPLAEGCS
FT                   PSHNMDQHGPTSVLKSVSKLPTDEIVGGVLLNQKVNPQTLAKEEDKLKLIALLRTFFNR
FT                   LHGYHIQYNVVSRETLIDAQKHPEKHRDLIVRVAGYSAFFNVLSKATQDDIIGRTEHTL
FT                   "
FT   gene            256822..257490
FT                   /locus_tag="SPT_0300"
FT   CDS_pept        256822..257490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0300"
FT                   /product="fructose-6-phosphate aldolase"
FT                   /note="identified by match to protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23400"
FT                   /protein_id="ACO23400.1"
FT                   /translation="MEFMLDTLNLDEIKKWSEILPLAGVTSNPTIAKREGSINFFERIK
FT                   DVRELIGSTPSIHVQVISQDFEGILKDAHEIRRQAGDDIFIKVPVTPAGLRAIKVLKKE
FT                   GYHITATAIYTVIQGLLAIEAGADYLAPYYNRMENLNIDSNSVIRQLALAIDRQNSPSK
FT                   ILAASFKNVAQVNNALAAGAHAVTAGADVFESAFAMPSIQKAVDDFSDDWFVTQNSRSI
FT                   "
FT   gene            257508..258596
FT                   /locus_tag="SPT_0301"
FT   CDS_pept        257508..258596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0301"
FT                   /product="glycerol dehydrogenase (gldh)"
FT                   /EC_number="1.1.1.6"
FT                   /note="identified by match to protein family HMM PF00465;
FT                   match to protein family HMM PF01761"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22833"
FT                   /protein_id="ACO22833.1"
FT                   /translation="MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGK
FT                   RFEDYLHRYGFHIVLALFNGEASDNEINRVVALAEKENCDSIIGLGGGKTIDSAKAIAD
FT                   LIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYLFYSKNPDLVLVDTKVISQAPKRL
FT                   LASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLFADGLQAMAACEA
FT                   KVVTPALENIVEANTLLSGLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLV
FT                   QLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMP
FT                   FKISPSDVAQAIIAVDAYVNSK"
FT   gene            259051..261552
FT                   /gene="leuS"
FT                   /locus_tag="SPT_0302"
FT   CDS_pept        259051..261552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="SPT_0302"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22249"
FT                   /db_xref="GOA:C1CPD0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPD0"
FT                   /protein_id="ACO22249.1"
FT                   /translation="MSFYNHKEIEPKWQGYWAEHHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLNDLDELDWSESIKDMQRN
FT                   WIGKSTGANVTFKVKGTDKEFTVFTTRPDTLFGATFTVLAPEHELVDAITSSEQAEAVA
FT                   DYKHQASLKSDLVRTDLAKEKTGVWTGAYAINPVNGKEMPIWIADYVLASYGTGAVMAV
FT                   PAHDQRDWEFAKQFDLPIVEVLEGGNVEEAAYTEDGLHVNSDFLDGLNKEDAIAKIVAY
FT                   LEEKGCGQEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPETELPLVLPVTKDIR
FT                   PSGTGESPLANLTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADED
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DHRGALVTTDKVEKRDGSFFHVETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITSKEILAENNGALDKAYNETVKAVTE
FT                   QIESLKFNTAIAQLMVFVNAANKEDKLYIDYAKGFIQLIAPFAPHLAEELWQTVAETGE
FT                   SISYVAWPTWDESKLVEDEIEIVVQIKGKVRAKLMVAKDLSREELQEIALADEKVKAEI
FT                   DGKEIVKVISVPNKLVNIVVK"
FT   gene            261691..262533
FT                   /locus_tag="SPT_0303"
FT   CDS_pept        261691..262533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0303"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24074"
FT                   /protein_id="ACO24074.1"
FT                   /translation="MNRLVNDSRKCEILLFKISIIVVSVIVLVMSIVGAYYFKNCLWDK
FT                   ESLNLTLTLDTLFAVFITFFSFSNDKSSNIFGISPNEIIRTQSEVYQFLFTKSFATLLI
FT                   VTNLLSIIHYFGAKNLIVSFNETYPRIQSSVGIMWLPLFGILIIYFIWLLIEGLKYIRK
FT                   INYIIQNREIIYFYSQVKVVDKLTDSESKKYGEYIDLYESCRQNNLSVLLNFLQNSDDK
FT                   RGVIASNSVRIMFESLDKADQIAALNICRNYVARENVLNKEDAEKLLNEIDKKLEISR"
FT   gene            262589..263284
FT                   /locus_tag="SPT_0304"
FT   CDS_pept        262589..263284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0304"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23392"
FT                   /protein_id="ACO23392.1"
FT                   /translation="MPVNEYGQMIGESMEGYTPGALPSIDFLEGRYARIEALSVEKHAE
FT                   DLLAVYGPDTPREMWTYLFQEPVADMGELVSLLNQMLARKDRFYYAIIDKATGKALGTF
FT                   SLMRIDQNNRVIEVGAVTFSPELRGTRIGTEAQYLLARYIFEELNYRRYEWKCDALNLP
FT                   SRRVAERLGFVYEGTFRQAVVYKGRTRDTDWLSMIDMDWPQVKDRLETWLRPENFDKNG
FT                   QQYKSLREL"
FT   gene            263296..263712
FT                   /locus_tag="SPT_0305"
FT   CDS_pept        263296..263712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0305"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23187"
FT                   /protein_id="ACO23187.1"
FT                   /translation="MITIKKQEIVKLEDVLHLYQAVGWTNYTHQPEMLEHALSHSLVIY
FT                   LALDGDAVVGLIRLVGDGFSSVFVQDLIVLPIYQRQGIGSALMKEALKDYKDAYQVQLV
FT                   TEETEKNVGFYRSMGFEILSTYNCIGMTWANREK"
FT   gene            264753..265751
FT                   /gene="ruvB"
FT                   /locus_tag="SPT_0306"
FT   CDS_pept        264753..265751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SPT_0306"
FT                   /product="holliday junction DNA helicase RuvB"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05491; match to protein
FT                   family HMM PF05496; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22496"
FT                   /db_xref="GOA:C1CPD4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPD4"
FT                   /protein_id="ACO22496.1"
FT                   /translation="MSRILDNEIMGDEELVERTLRPQYLREYIGQDKVKDQLQIFIEAA
FT                   KMRDEALDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPVIEKAGDLVAILNELEPG
FT                   DVLFIDEIHRLPMSVEEVLYSAMEDFYIDIMIGAGEGSRSVHLELPPFTLIGATTRAGM
FT                   LSNPLRARFGITGHMEYYAHADLTEIVERTADIFEMEITHEAASELALRSRGTPRIANR
FT                   LLKRVRDFAQIMGNGVIDDIITDKALTMLDVDHEGLDYVDQKILRTMIEMYSGGPVGLG
FT                   TLSVNIAEERETVEDMYEPYLIQKGFIMRTRSGRVATAKAYEHLGYEYSEK"
FT   gene            265732..266304
FT                   /pseudo
FT                   /locus_tag="SPT_0307"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF06042"
FT   gene            266535..267293
FT                   /gene="uppS"
FT                   /locus_tag="SPT_0308"
FT   CDS_pept        266535..267293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="SPT_0308"
FT                   /product="di-trans,poly-cis-decaprenylcistransferase"
FT                   /EC_number="2.5.1.31"
FT                   /note="identified by match to protein family HMM PF01255;
FT                   match to protein family HMM TIGR00055"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23684"
FT                   /protein_id="ACO23684.1"
FT                   /translation="MFGFFKKDKAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQPRVFGH
FT                   KAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPELHA
FT                   NNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQD
FT                   VLDAKINPGDITEELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYF
FT                   TDTLWPDFDEAALQEAILAYNRRHRRFGGV"
FT   gene            267302..268105
FT                   /gene="cdsA"
FT                   /locus_tag="SPT_0309"
FT   CDS_pept        267302..268105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="SPT_0309"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="identified by match to protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22386"
FT                   /protein_id="ACO22386.1"
FT                   /translation="MTQDLQKRTLFAGIALAIFLPILMIGGLLLQIAIGIIAMLAMHEL
FT                   LKMRGLETMTMEGLLTLFATFALTIPLENYLTFLPVDGNVVAYSVLISIMLGTTVFSKS
FT                   YTIEDAVFPLAMSFYVGFGFNALLDARVAGLDKALLALCIVWATDSGAYLVGMNYGKRK
FT                   LAPRVSPNKTLEGALGGILGAILVTIIFMIVDSTVALPYGIYKMSVFAIFFSIAGQFGD
FT                   LLESSIKRHFGVKDSGKFIPGHGGVLDRFDSMLLVFPIMHLFGLF"
FT   gene            268127..269386
FT                   /gene="rseP"
FT                   /locus_tag="SPT_0310"
FT   CDS_pept        268127..269386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /locus_tag="SPT_0310"
FT                   /product="RIP metalloprotease RseP"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF02163;
FT                   match to protein family HMM TIGR00054"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24069"
FT                   /protein_id="ACO24069.1"
FT                   /translation="MLGILTFILVFGIIVVVHEFGHFYFAKKSGILVREFAIGMGPKIF
FT                   AHIGKDGTAYTIRILPLGGYVRMAGWGDDTTEIKTGTPVSLTLADDGKVKRINLSGKKL
FT                   DQTALPMQVTQFDFEDKLFIKGLVLEEEKTFAVDHDATVVEADGTEVRIAPLDVQYQNA
FT                   TIWGKLITNFAGPMNNFILGVVVFWVLIFMQGGVRDVDTNQFHIMPQGALAKVGVPETA
FT                   QITKIGSHEVSNWESLIQAVETETKDKTAPTLDVTISEKGSDKQVTVTPEDSQGRYLLG
FT                   VQPGVKSDFLSMFVGGFTTAADSALRILSALKNLIFQPDLNKLGGPVAIFKASSDAAKN
FT                   GIENILYFLAMISINIGIFNLIPIPALDGGKIVLNILEAIRRKPLKQEIETYVTLAGVV
FT                   IMVVLMIAVTWNDIMRLFFR"
FT   gene            269399..271252
FT                   /gene="proS"
FT                   /locus_tag="SPT_0311"
FT   CDS_pept        269399..271252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="SPT_0311"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF04073; match to protein family HMM TIGR00409"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23045"
FT                   /db_xref="GOA:C1CPD8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPD8"
FT                   /protein_id="ACO23045.1"
FT                   /translation="MKQSKMPIPTLREMPSDAQVISHALMLRAGYVRQVSAGVYSYLPL
FT                   ANRVIEKAKNIMRQEFEKIGAVEMLAPALLSAELWRESGRYETYGEDLYKLKNREKSDF
FT                   ILGPTHEETFTAIVRDSVKSYKQLPLNLYQIQPKYRDEKRPRNGLLRTREFIMKDAYSF
FT                   HANYDSLDSVYDEYKAAYERIFTRSGLDFKAIIGDGGAMGGKDSQEFMAITSARTDLDR
FT                   WVVLDKSVASFDEIPAEVQEEIKAELLKWIVSGEDTIAYSSESSYAANLEMATNEYKPS
FT                   NRVVAEEEVTRVATPDVKSIDEVAAFLNVPEEQTIKTLFYIADGELVAALLVGNDQLNE
FT                   VKLKNHLGADFFDVASEEEVANVVQAGFGSLGPVGLPENIKIIADRKVQDVRNAVVGAN
FT                   EDGYHLTGVNPGRDFTAEYVDIREVREGEISPDGQGVLNFARGIEIGHIFKLGTRYSAS
FT                   MGADVLDENGRAVPIIMGCYGIGVSRLLSAVMEQHARLFVNKTPKGEYRYAWGINFPKE
FT                   LAPFDVHLITVNVKDEEAQALTEKLEASLMGAGYEVLTDDRNERVGVKFSDSDLIGLPI
FT                   RITVGKKAADGIVEVKIKATGDTIEVHADNVLETLEILSKK"
FT   gene            271352..272731
FT                   /locus_tag="SPT_0312"
FT   CDS_pept        271352..272731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0312"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23460"
FT                   /protein_id="ACO23460.1"
FT                   /translation="MLRFPKDFVWGSSTSGPQTEGRVAGDGKGDNLWDYWFQVEPNRYY
FT                   NGIGSDKTSTFYENWERDIELLLETGHTVFRTSIQWSRIFPQGCGKVNPQGVDFYRKVF
FT                   EAIKAKGICLLVNLYHFDLPFALQEDGDGWENKATVSAYEDYARFCFETYGDLVDQWIT
FT                   FNEPIVPVEFGYFYDAHYPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLN
FT                   LTPAYPRSQHPADVKAARIAALFQAQSFLDPSVLGTYPQELVEILHEHGLLPDATEEEL
FT                   ELIRDNTVDFLGVNYYQPLRVMAPRFAKHPESPLLPEHFYEPYVMPGRKINSHRGWEIY
FT                   EQGIYDIAQNIKENYGNIEWMLTENGMGVEGEEKFRQDGMIQDDYRIDFVKGHLRELHR
FT                   AIEDGANCKGYLIWTFIDCWSWLNSYKNRYGLVELDLETQERRLKKSGHWFKKLSDNNG
FT                   F"
FT   gene            272923..274731
FT                   /gene="glmS"
FT                   /locus_tag="SPT_0313"
FT   CDS_pept        272923..274731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="SPT_0313"
FT                   /product="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23947"
FT                   /protein_id="ACO23947.1"
FT                   /translation="MCGIVGVVGNTNATDILIQGLEKLEYRGYDSAGIFVLDGADNHLV
FT                   KAVGRIAELSAKTAGVEGTTGIGHTRWATHGKPTEDNAHPHRSETERFVLVHNGVIENY
FT                   LEIKEEYLAGHHFKGQTDTEIAVHLIGKFAEEEGLSVLEAFKKALHIIRGSYAFALVDS
FT                   QDPEVIYVAKNKSPLLIGLGEGYNMVCSDAMAMIRETNQYMEIHDQELVIVKADSVEVQ
FT                   DYDGNRRERASYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLIQAYTDDAGQVVVDP
FT                   AIIKAVQDADRIYILAAGTSYHAGFASKKMLEELTDTPVELGISSEWGYGMPLLSKKPL
FT                   FIFISQSGETADSRQVLVKANEMGIPSLTVTNVPGSTLSREANYTMLLHAGPEIAVAST
FT                   KAYTAQIAALAFLAKAVGEANGNAKAQAFDLIHELSIVAQSIESTLSEKETIEAKVREL
FT                   LETTRNAFYIGRGQDYYVAMEASLKLKEISYIQCEGFAAGELKHGTIALIEEGTPVLAL
FT                   LSDPVLANHTRGNIQEVAARGAKVLTIAEENVAKDTDDIVLTTVHPYLSPISMVVPTQL
FT                   VAYFATLHRGLDVDKPRNLAKSVTVE"
FT   gene            274850..275899
FT                   /locus_tag="SPT_0314"
FT   CDS_pept        274850..275899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0314"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22326"
FT                   /protein_id="ACO22326.1"
FT                   /translation="MVELGISTFGEITELEGTGQTYSHAERIRQLVAEIELADKVGLDV
FT                   YGIGEHHRADFAVSAPEIVLAAGAVNTKKIRLTSAVSILSSMDPIRLFQQYATIDALSN
FT                   GRAEIMAGRGSFTESFPLFGYDLKDYDSLFDEKLDLLQLVNEKTKLDWQGRLTQTIAGK
FT                   EVYPRPVQDKLPLWIATGGHVESTVKIAQAGLPIVYAIIDGNPRYFKKLIQAYREIGSE
FT                   AGHADKDLKVGAHSWGWIAEDGEQAVKDYFHPTKQVVDAISKDRPHWQELRYEQYLDQV
FT                   GSNGAMFVGNPDQVAEKLIRMIEDLGLDCFMLHLPLGSMPHDQVLRAIELFGTQVAPKV
FT                   RAYFAMKEA"
FT   gene            complement(275999..279796)
FT                   /locus_tag="SPT_0315"
FT   CDS_pept        complement(275999..279796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0315"
FT                   /product="pullulanase, extracellular"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF02922; match to protein family HMM PF03714;
FT                   match to protein family HMM PF04650; match to protein
FT                   family HMM TIGR01167; match to protein family HMM
FT                   TIGR01168; match to protein family HMM TIGR02102"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23327"
FT                   /protein_id="ACO23327.1"
FT                   /translation="MRKTPSHTEKKMVYSIRSLKNGTGSVLIGASLVLLAMATPTISSD
FT                   ESTPTTNEPNNRNTTTLAQPLTDTAAGSGKNESDISSPRNANASLEKTEEKPATEPTTS
FT                   TSPVTTETKAEEPIEDNYFRIHVKKLPEENKDAQGLWTWDDVEKPSENWPNGALSFKDA
FT                   KKDDYGYYLDVKLKGEQAKKISFLINNTAGKNLTGDKSVEKLVPKMNEAWLDQDYKVFS
FT                   YEPQPAGTVRVNYYRTDGNYDKKSLWYWGDVKNPSSAQWPDGTDFTATGKYGRYIDIPL
FT                   NEAAREFGFLLLDESKQGDDVKIRKENYKFTDLKNHSQIFLKDDDESIYTNPYYVHDIR
FT                   MTGAQHVGTSSIESSFSTLVGAKKEDILKHSNITNHLGNKVTITDVAIDEAGKKVTYSG
FT                   DFSDTKHPYTVSYNSDQFTTKTSWRLKDETYSYDGKLGADLKEEGKQVDLTLWSPSADK
FT                   VSVVVYDKNDPDKVVGTVALEKGERGTWKQTLDSTNKLGITDFTGYYYQYQIERQGKTV
FT                   LALDPYAKSLAAWNSDDAKIDDAHKVAKAAFVDPAKLGPQDLTYGKIHNFKTREDAVIY
FT                   EAHVRDFTSDPAIAKDLTKPFGTFEAFIEKLDYLKDLGVTHIQLLPVLSYYFVNELKNH
FT                   ERLSDYASSNSNYNWGYDPQNYFSLTGMYSSDPKNPEKRIAEFKNLINEIHKRGMGAIL
FT                   DVVYNHTAKVDIFEDLEPNYYHFMDADGTPRTSFGGGRLGTTHHMTKRLLVDSIKYLVD
FT                   TYKVDGFRFDMMGDHDAASIEEAYKAARALNPNLIMLGEGWRTYAGDENMPTKAADQDW
FT                   MKHTDTVAVFSDDIRNNLKSGYPNEGQPAFITGGKRDVNTIFKNLIAQPTNFEADSPGD
FT                   VIQYIAAHDNLTLFDIIAQSIKKDPSKAENYAEIHRRLRLGNLMVLTAQGTPFIHSGQE
FT                   YGRTKQFRDPAYKTPVAEDKVPNKSHLLRDKDGNPFDYPYFIHDSYDSSDAVNKFDWTK
FT                   ATDGKAYPENVKSRDYMKGLIALRQSTDAFRLKSLQDIKDRVHLITVPGQNGVEKEDVV
FT                   IGYQITAPNGDIYAVFVNADEKAREFNLGTAFAHLRNAEVLADENQAGSVEIANPKGLE
FT                   WTEKGLKLNALTATVLRVSQNGTSHESTAEEKPDSIPSKPEHQNEASHPAYQDPAPEAR
FT                   PDSTKPDAKVADAENKPSQATADSQAEQPAQEAQASSVKEAVQNESVENSSKKNIPATP
FT                   DRQAELPNTGIKNENKLLFAGISLLALLGLGFLLKNKKEN"
FT   gene            280213..280626
FT                   /gene="rpsL"
FT                   /locus_tag="SPT_0316"
FT   CDS_pept        280213..280626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SPT_0316"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23747"
FT                   /db_xref="GOA:C1CPE3"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPE3"
FT                   /protein_id="ACO23747.1"
FT                   /translation="MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLP
FT                   GVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA"
FT   gene            280646..281116
FT                   /gene="rpsG"
FT                   /locus_tag="SPT_0317"
FT   CDS_pept        280646..281116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SPT_0317"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24176"
FT                   /db_xref="GOA:C1CPE4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPE4"
FT                   /protein_id="ACO24176.1"
FT                   /translation="MSRKNRAPKRDVLPDPLYNSQLVTRLINRVMLDGKRGTAASIVYG
FT                   AFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW"
FT   gene            281541..283622
FT                   /gene="fusA"
FT                   /locus_tag="SPT_0318"
FT   CDS_pept        281541..283622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="SPT_0318"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22559"
FT                   /db_xref="GOA:C1CPE5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPE5"
FT                   /protein_id="ACO22559.1"
FT                   /translation="MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQ
FT                   LPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLDQAQEYREKLIEAVAETD
FT                   EELMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSP
FT                   LDIPAIKGINPDTDAEETRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLQSGSYV
FT                   LNTSKGKRERIGRILQMHANSRQEIDTVYSGDIAAAVGLKDTTTGDSLTDEKSKIILES
FT                   INVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLD
FT                   VLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLSLKEAAKSAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGED"
FT   gene            283726..288117
FT                   /gene="polC"
FT                   /locus_tag="SPT_0319"
FT   CDS_pept        283726..288117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polC"
FT                   /locus_tag="SPT_0319"
FT                   /product="DNA polymerase III, alpha subunit, Gram-positive
FT                   type"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM PF02811; match to protein family HMM PF07733;
FT                   match to protein family HMM TIGR00573; match to protein
FT                   family HMM TIGR01405"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23611"
FT                   /protein_id="ACO23611.1"
FT                   /translation="MSNSFEILMNQLGMPAEMRQAPALAQANIERVVVHKISKVWEFHF
FT                   VFSNILPIEIFLELKKGLSEEFSKTGNKAVFEIKARSQEFSNQLLQSYYREAFSEGPCA
FT                   SQGFKFLYQNLQVRAEGNQLFIEGSEAIDKEHFKKNHLPNLAKQLEKFGFPTFNCQVEK
FT                   NDVLTQEQEEAFHAENEQIVQAANEEALRAMEQLEQMAPPPAEEKPVFDFQAKKAAAKP
FT                   KLDKAEITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVK
FT                   NEEEAQKFDLIKKNSWLRVRGNVEMNNFTRDLTMNVQDLQEVVHYERKDLMPEGERRVE
FT                   FHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKKAGIQLIYG
FT                   MEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAE
FT                   FDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNATFDVGF
FT                   MNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALEHHHMANYDAEA
FT                   TGRLLFIFIKEVAEKHGVTDLARLNIDLISPDSYKKARIKHATIYVKNQVGLKNIFKLV
FT                   SLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAKYYDFI
FT                   EVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYRE
FT                   IIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEELARKLVIENTN
FT                   ALAEIFEPVEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSI
FT                   LGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQ
FT                   YSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGED
FT                   QPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKFYRDAEVERLAQGAA
FT                   GVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVL
FT                   GHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGTPTGMLGIPEFG
FT                   TNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMV
FT                   YLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMF
FT                   PKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISE
FT                   KRKNNEASNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMD
FT                   GLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFDE
FT                   LF"
FT   gene            288219..288482
FT                   /locus_tag="SPT_0320"
FT   CDS_pept        288219..288482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0320"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="identified by match to protein family HMM PF04221;
FT                   match to protein family HMM TIGR02384"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23741"
FT                   /protein_id="ACO23741.1"
FT                   /translation="MSKMSISIRLDSEVKEQAQQVFSNLGMDMTTAINIFLRQAIQYQG
FT                   LPFDVRLDENRKLLQALTDLDQNRNMSQSFESVSDLMEDLRA"
FT   gene            288475..288753
FT                   /locus_tag="SPT_0321"
FT   CDS_pept        288475..288753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0321"
FT                   /product="DNA damage inducible protein"
FT                   /note="identified by match to protein family HMM PF05016;
FT                   match to protein family HMM TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23733"
FT                   /protein_id="ACO23733.1"
FT                   /translation="MLKIRYHKQFKKDFKLAMKRGLRAELLEEVLNFLVQEKEHPARYR
FT                   DHSLTASKHFQGVRECHTQPDWLLVYKVDKSELILNLLRTGSHSDLF"
FT   gene            288774..288926
FT                   /locus_tag="SPT_0322"
FT   CDS_pept        288774..288926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24164"
FT                   /protein_id="ACO24164.1"
FT                   /translation="MKLRIFAEDKPAKKVFEYQLELADRTILLSTALLPGAIALAGIFS
FT                   ALKEK"
FT   gene            288948..290189
FT                   /locus_tag="SPT_0323"
FT   CDS_pept        288948..290189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0323"
FT                   /product="aminopeptidase PepS"
FT                   /EC_number="3.4.11.-"
FT                   /note="identified by match to protein family HMM PF02073"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22258"
FT                   /protein_id="ACO22258.1"
FT                   /translation="MVLPNFKENLEKYAKLLVANGINVQPGHTLALSIDVEQRELAHLI
FT                   VKEAYALGAHEVIVQWTDDVINREKFLHAPMERLDNVPEYKIAEMNYLLENKASRLGVR
FT                   SSDPGALNGVDADKLSASAKAMGLAMKPMRIATQSNKVSWTVAAAAGLEWAKKVFPNAA
FT                   SDEEAVDFLWDQIFKTCRVYEADPVKAWEEHAAILKSKADMLNKEQFSALHYTAPGTDL
FT                   TLGLPKNHVWESAGAVNAQGEEFLPNMPTEEVFTAPDFRRADGYVTSTKPLSYNGNIIE
FT                   GIKVTFKDGQIVDITAEKGDQVMKDLVFENAGARALGECALVPDPSPISQSGIIFFNTL
FT                   FDENASNHLAIGAAYATSVVDGAEMSEEELEAAGLNRSDVHVDFMIGSNQMDIDGIRED
FT                   GTRVPLFRNGNWAN"
FT   gene            290199..290429
FT                   /locus_tag="SPT_0324"
FT   CDS_pept        290199..290429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0324"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF04226"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22993"
FT                   /protein_id="ACO22993.1"
FT                   /translation="MLGSMFVGLLVGFLAGAMTNRGERMGCFGKMFLGWIGAFLGHLLF
FT                   GTWGPVLSGTAIIPAILGAMIVLAIFWRRGS"
FT   gene            290652..291374
FT                   /locus_tag="SPT_0325"
FT   CDS_pept        290652..291374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0325"
FT                   /product="ribosomal small subunit pseudouridine synthase A,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23962"
FT                   /protein_id="ACO23962.1"
FT                   /translation="MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKI
FT                   DEIRFDGQVLEYEEFVYYMMNKPKGVISATEDPKHRTVLDLLDDLARSKEVFPVGRLDI
FT                   DTHGLLLLTNDGQLAHVLLSPKRHVDKTYLAQVKGIMTQEDVETFAEGIPLKDFTCQPA
FT                   ILELVSIDTEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTMGTLVLDENLERG
FT                   EWRRLTKEELEILRANII"
FT   gene            291591..292925
FT                   /locus_tag="SPT_0326"
FT   CDS_pept        291591..292925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0326"
FT                   /product="aminopeptidase C (Bleomycin hydrolase)"
FT                   /EC_number="3.4.22.40"
FT                   /note="identified by match to protein family HMM PF03051"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23120"
FT                   /protein_id="ACO23120.1"
FT                   /translation="MNAIQESFTDKLFANYEANVKYQAIENAASHNGIFAALERRQSHV
FT                   DNTPVFSLDLTKDKVTNQKASGRCWMFAALNTFRHKLISQYKLENFELSQAHTFFWDKY
FT                   EKSNWFLEQVIATSDQELTSRKVSFLLQTPQQDGGQWDMVVSLFEKYGVVPKSVYPESV
FT                   SSSSSRELNAILNKLLRQDAQILRDLLVSGADQVTVQAKKEDLLQEIFNFLAMSLGLPP
FT                   RKFDFAYRDKDNNYKSEKGITPQEFYKKYVNLPLEDYVSVINAPTADKPYGKSYTVEML
FT                   GNVVGSRAVRYINVPMERLKELAIAQMQAGETVWFGSDVGQLSNRKAGILATDVYDFES
FT                   SMDIKLTQDKAGRLDYSESLMTHAMVLTGVDLDENGKSTKWKVENSWGDKVGTDGYFVA
FT                   SDAWMDEYTYQIVVRKELLTAEEQAAYGAEPIVLAPWDPMGALAK"
FT   gene            complement(292981..293892)
FT                   /locus_tag="SPT_0327"
FT   CDS_pept        complement(292981..293892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0327"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /note="identified by match to protein family HMM PF03613;
FT                   match to protein family HMM TIGR00828"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23720"
FT                   /protein_id="ACO23720.1"
FT                   /translation="MTEKLQLTKSDRKKVWWRSTFLQGSWNFERMQNLGWAYTLIPAIK
FT                   KLYTKKEDQIAALERHLEFFNTHPYVAAPVMGVTLALEEERANGVEIDDAAIQGVKIGM
FT                   MGPLAGIGDPVFWFTVRPILGSLGASLALTGNILGPLLFFVAWNLIRMSFLWYVQEIGY
FT                   KAGSEITKDMSGGILQDITKGASILGMFILAVLVQRWVNIKFAFDVSKVQLDEKAYIHW
FT                   DKLPEGSKGIQEAFAQVGQGLSQTPEKVTTFQQNLDMLIPGLSGLLLTLLCMYLLKKKV
FT                   SPITIILALFAVGIVAHVLHIM"
FT   gene            complement(293916..294719)
FT                   /locus_tag="SPT_0328"
FT   CDS_pept        complement(293916..294719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0328"
FT                   /product="PTS system sorbose-specific IIc component"
FT                   /note="identified by match to protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24177"
FT                   /protein_id="ACO24177.1"
FT                   /translation="MSIISMVLVIVVAFFAGLEGILDQFQFHQPLVACTLIGLVTGHLE
FT                   AGIILGGSLQMIALGWSNIGAAIAPDAALASVAAAIIMVLGGDFTKTGIGVAQAVAIPL
FT                   AVAGLFLTMIVRTISVGLVHTADAAAKKGDFGAVERAHFIALLFQGLRIALPAALLLMV
FT                   PTETVQSILSAMPDWLKDGMAIGGGMVVAVGYAMVINMMATREVWPFFALGFVLAAVSD
FT                   ITLIGFGAIGVAIALIYLHLSKTGGNGGGGAATSNDPIGDILEDY"
FT   gene            complement(294747..295736)
FT                   /locus_tag="SPT_0329"
FT   CDS_pept        complement(294747..295736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0329"
FT                   /product="mannose-specific phosphotransferase system
FT                   component iiab"
FT                   /note="identified by match to protein family HMM PF03610;
FT                   match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24169"
FT                   /protein_id="ACO24169.1"
FT                   /translation="MSIGIIIASHGEFAAGIHQSGSMIFGEQEKVQVVTFMPNEGPDDL
FT                   YAKFNNAVAAFDAEDEVLVLADLWSGSPFNQASRVMGENPERKFAIITGLNLPMLIQAY
FT                   TERLMDAAAGVEKVAANIIKEAKDGIKALPEELNPVEEVASAAAAPVAQTAIPEGTVIG
FT                   DGKLKINLARLDTRLLHGQVATAWTPDSKANRIIVASDNVAKDDLRKELIKQAAPGNVK
FT                   ANVVPIQKLIEISKDPRFGETHALILFETPQDALRAIEGGVPIKTLNVGSMAHSTGKTL
FT                   VNTVLSMDKEDVATFEKMRDLGVEFDVRKVPNDSKKDLFDLINKANVK"
FT   gene            complement(295969..296988)
FT                   /locus_tag="SPT_0330"
FT   CDS_pept        complement(295969..296988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0330"
FT                   /product="alcohol dehydrogenase, propanol-preferring"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24039"
FT                   /protein_id="ACO24039.1"
FT                   /translation="MKAVVVNPESTGVAIEEKVLRPLETGEALVEVEYCGVCHTDLHVA
FT                   HGDFGQVPGRVLGHEGIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLC
FT                   RTVKNAGYSVDGGMAEQCIATADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKVEPG
FT                   QWVVLYGAGGLGNLAVQYAKKVFNAHVIAVDINNDKLTLAKEVGADIVINGLEVEDVAG
FT                   LIKEKTDGGAHSAVVTAVSKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQ
FT                   VIGSLVGTRKDLEEAFQFGAEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH"
FT   gene            complement(297097..297243)
FT                   /locus_tag="SPT_0331"
FT   CDS_pept        complement(297097..297243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0331"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23869"
FT                   /protein_id="ACO23869.1"
FT                   /translation="MKLTWFEEIFEEYDQLASWSLCSFHSLINQLIDCSTFCLQNLGKG
FT                   FLL"
FT   gene            complement(297327..298139)
FT                   /locus_tag="SPT_0332"
FT   CDS_pept        complement(297327..298139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0332"
FT                   /product="Cof family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22721"
FT                   /protein_id="ACO22721.1"
FT                   /translation="MTKKIIALDLDGTLLNSDSQISDFTKETIKKVTEKGHQVIITTGR
FT                   PYRMSKDFYRELGLDTPMINFNGSLTHLPDQVWDFEKCLTVDKKYLLDMVQRSEDIQAD
FT                   FIAGEYRKKFYITNPNEEIANPKLFGVEAFQPEDQFQPELVTKDPNCILLQTRASDKYA
FT                   LAKDMNAFYQHQLSINTWGGPLNILECTPKGVNKAFALDYLLKIMNRDKKDLIAFGDEH
FT                   NDTEMLAFAGKGYAMKNANPELLPYADEQISLTNDQDGVAKTLQDLFL"
FT   gene            298275..299747
FT                   /locus_tag="SPT_0333"
FT   CDS_pept        298275..299747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0333"
FT                   /product="inner membrane protein YicO"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22972"
FT                   /protein_id="ACO22972.1"
FT                   /translation="MINDIIQILFVKIKRRLIMDKLFKLKENGTDVRTEVLAGLTTFFA
FT                   MSYILFVNPQILSQTGMPAQGVFLATIIGAVAGTLMMAFYANLPYAQAPGMGLNAFFTF
FT                   TVVFGLGYSWQEALAMVFICGIISLIITLTNVRKMIIESIPNALRSAISAGIGVFLAYV
FT                   GIKNAGLLKFTIDPGNYTVVGEGADKAQATIAANSSAVPGLVSFNNPAVLVALAGLAIT
FT                   IFFVIKGIKGGIILSILTTTVLAIAVGLVDLSSIDFANNHVGAAFEDLKTIFGAALGSE
FT                   GLGALISDTARLPETLMAILAFSLTDIFDTIGTLIGTGEKVGIVATNGENHQSAKLDKA
FT                   LYSDLIGTSIGAIAGTSNVTTYVESAAGIGAGGRTGLTALVVAICFAISSFFSPLLAIV
FT                   PTAATAPILIIVGIMMLASLKNIHWDDMAEAVPAFFTSIFMGFSYSITQGIAVGFLTYT
FT                   LTKLVKGQAKDVHVMIWILDALFILNYISMAL"
FT   gene            299800..300507
FT                   /locus_tag="SPT_0334"
FT   CDS_pept        299800..300507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0334"
FT                   /product="caax amino protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23447"
FT                   /protein_id="ACO23447.1"
FT                   /translation="MKEKNIWKELLNRAVWLLVFLLATILYQIPIGVTAILTLNAVPLL
FT                   QSGLIVTGISIVVLVLFIIGARKTQLASFNFSFFRAKDLARLGLSYLVIICSNILGSIL
FT                   LQLSNETTTANQSQINDMVQNSSLISSFFLLALLAPICEEILCRGIVPKKIFRGKENLG
FT                   FVVGTIVFALLHQPSNLPSLLIYGGMSIVLSWTAYKTQRLEMSILLHMIVNGVAFCLLA
FT                   LVVIMSRTLGISV"
FT   gene            300601..301578
FT                   /gene="folP"
FT                   /locus_tag="SPT_0335"
FT   CDS_pept        300601..301578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="SPT_0335"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24021"
FT                   /protein_id="ACO24021.1"
FT                   /translation="MVKSLEGVTDMLSKANRAKTAICGIINVTPDSFSDGGQFFALEQA
FT                   LQQARKLIAEGASMLDIGGESTRPGSSYYVEIEEEIQRVVPVIKAIRKESDVLISIDTW
FT                   KSQVAEAALAAGANLVNDITGLMGDEKMAHVIAKDGAKVVIMFNPVMARPQHPSSLIFP
FT                   HFGFNQAFTEEELADFETLPIEELMETFFERALARANQAGIAQENILLDPGIGFGLTKK
FT                   ENLLLLRDLDKLHQKGYPIFLGVSRKRFVINILEENGFEVNPETELGFHNRDTASAHVT
FT                   SIAARQGVEVVRVHDVASHRMAVEIASAIRLADEAENLDLKQYK"
FT   gene            301580..302902
FT                   /locus_tag="SPT_0336"
FT   CDS_pept        301580..302902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0336"
FT                   /product="folylpolyglutamate synthase
FT                   (folylpoly-gamma-glutamatesynthetase) (fpgs)
FT                   (tetrahydrofolate synthase)(tetrahydrofolylpolyglutamate
FT                   synthase)"
FT                   /EC_number="6.3.2.17"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23044"
FT                   /protein_id="ACO23044.1"
FT                   /translation="MKEFENNQWIAHYRTDQPHFGLERMVELLALRGNPHLKLKVIHVG
FT                   GTNGKGSTIAFLKNMLEKMGLRVGVFSSPYLIHYTDQISINGESIPEARLEALMGDYQS
FT                   LLEGEAAANLQGTTEFEIITAIAYDYFASEQVDVAIMEVGMGGLLDSTNVCQPILTGIT
FT                   TIGLDHVALLGDTLEAIAEQKAGIIKQGIPLVTGHIAPEALAVIDCIAEGKDAPRLAYG
FT                   ANYHVSHQENVVTGEVFDYTSSLRQGRFQTGLLGLHQIENAGMAIALLDTFCKEDGREL
FT                   VSNDLLGQALEETSWPGRLEIVSRDPLMILDGAHNPHAIKALLVTLQERFADHHKEILF
FT                   TCIKTKALEDMLDLLGAMPDTELTLTHFADSRATDESVLKEAAKSRNLSYQDWHDFLDQ
FT                   NLTDKKEEKQTVRIVTGSLYFLSQVRAYLMERKNENGYTKD"
FT   gene            302883..303437
FT                   /gene="folE"
FT                   /locus_tag="SPT_0337"
FT   CDS_pept        302883..303437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="SPT_0337"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227;
FT                   match to protein family HMM TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23653"
FT                   /db_xref="GOA:C1CPG4"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPG4"
FT                   /protein_id="ACO23653.1"
FT                   /translation="MDTQKIEAAVKMIIEAVGENVNREGLQETPARVARMYQEIFSGLG
FT                   QTAEEHLSKSFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLAR
FT                   TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTV
FT                   ARGLFETDKDLRDQAYRLMGL"
FT   gene            303480..304292
FT                   /locus_tag="SPT_0338"
FT   CDS_pept        303480..304292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0338"
FT                   /product="bifunctional folate synthesis protein"
FT                   /EC_number="4.1.2.25"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM PF02152; match to protein
FT                   family HMM TIGR00525; match to protein family HMM
FT                   TIGR00526; match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24227"
FT                   /protein_id="ACO24227.1"
FT                   /translation="MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDL
FT                   DLTASVHYGELCQQWTTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPV
FT                   HLSLDTCSVTIHRRKQRAFIALGSNMGDKQVNLKQAIDKLRARGIHILKESSVLETEPW
FT                   GGVEQDSFANQVVEVETWLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQI
FT                   LYTDDLILPHPYIAERLFVLESLQEIAPHFIHPILKQPIRNLYDALKK"
FT   gene            complement(304337..304654)
FT                   /locus_tag="SPT_0339"
FT   CDS_pept        complement(304337..304654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23661"
FT                   /protein_id="ACO23661.1"
FT                   /translation="MAFTNTHMRSASFGIVTSLPDDIIDSFWYIIDHFLKNVFELEEEL
FT                   EFQLLNNQGKITFHFSSQHLPTAIDFDFNHPFDPRYPPRVLVLDMDGRETILLPEENDL
FT                   F"
FT   gene            305010..305456
FT                   /gene="rplM"
FT                   /locus_tag="SPT_0340"
FT   CDS_pept        305010..305456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SPT_0340"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by match to protein family HMM PF00572;
FT                   match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23238"
FT                   /protein_id="ACO23238.1"
FT                   /translation="MNKTTFMAKPGQVERKWYVVDATDVPLGRLSAVVASVLRGKNKPT
FT                   FTPHTDTGDFVIVINAEKVKLTGKKATDKIYYTHSNHPGGLKQISAGELRSKNAVRLIE
FT                   KSVKGMLPHNTLGRAQGMKLKVFVGAEHTHAAQQPEVLDISGLI"
FT   gene            305475..305867
FT                   /gene="rpsI"
FT                   /locus_tag="SPT_0341"
FT   CDS_pept        305475..305867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SPT_0341"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23029"
FT                   /db_xref="GOA:C1CPG8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPG8"
FT                   /protein_id="ACO23029.1"
FT                   /translation="MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLR
FT                   LVINQPFAVTSTVGSYDVFVNVIGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLL
FT                   TRDSRKVERKKPGLKKARKASQFSKR"
FT   gene            complement(305976..307196)
FT                   /locus_tag="SPT_0342"
FT   CDS_pept        complement(305976..307196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0342"
FT                   /product="integrase/recombinase, phage integrase family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23580"
FT                   /protein_id="ACO23580.1"
FT                   /translation="MTVTKTNSNTYNLKVYIPKEIRPKMGIKGNHFVKRYKTRKEAKEA
FT                   ELEILTKIHQLENGEDILLSKTNDILFSEFFNNIWWDSYKAGQTTSTTRPPTQVTIDNT
FT                   KTVFRKHILPMFGNYSINFLNQNKQVVLNLMTAKAEEYANFKVIRSYVNSIFDWAEELE
FT                   YIESNRLSKTIKRIKATKKLKLQESKNEEDLYLSSEELQDWFDAFREDLENDKLSLKDY
FT                   VLFFTTFILSDRKSESYALHWKNIDLENAQIDLRHALDKYKNVKSTKGNKKTIFSIPSY
FT                   LVSLLSEWKKQQKYELAKFGIMQTSDQLVFTYIDTKGNVNSPLHVDYLNNKMNSVKRRH
FT                   PKLKHATPHKLRHTGATLAKKAGMSLEAISEALTHSDTITTKTYVNTSNIVPLSAGQVA
FT                   YQHLKNK"
FT   gene            complement(307238..307507)
FT                   /locus_tag="SPT_0343"
FT   CDS_pept        complement(307238..307507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0343"
FT                   /product="transcriptional regulator, AlpA family"
FT                   /note="identified by match to protein family HMM PF05930;
FT                   match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24072"
FT                   /protein_id="ACO24072.1"
FT                   /translation="MQVILPTEQVQEIQSMITNLLQNEISHFKEDLGLDSPYLNKGQTC
FT                   KYLGISNNTLDGWIQKGLPVIKIGKTVRFNKNEIDKWLCRKAML"
FT   gene            complement(307515..308309)
FT                   /locus_tag="SPT_0344"
FT   CDS_pept        complement(307515..308309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0344"
FT                   /product="Rep protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22461"
FT                   /protein_id="ACO22461.1"
FT                   /translation="MSYNRKIIRTSSYLEIWEYESPIFSNDTTQIDEEHISLKEKKKRR
FT                   TFEELTTAEQDERIKRISNTRKNSKWKLQRLIDTNFDDRTSFLTLTTKENIQNRYEFNL
FT                   LFDKFIKRLNYHMYHSKKRLIKYIAVLERQKRGAWHAHILLFSFPFIPHKELLTIWGLG
FT                   AVRINKLHNLDDSSNAGRYVGKYMEKGIGQELLESLGKKAFYSSRNLQKPEEIKLFTSE
FT                   SLDNLVKNEDILYESNYISKVFRKGHLIDNKVKYKKIKLSKE"
FT   gene            complement(308481..309254)
FT                   /locus_tag="SPT_0345"
FT   CDS_pept        complement(308481..309254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0345"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23171"
FT                   /protein_id="ACO23171.1"
FT                   /translation="MKTLLIGDLHLKSQLILPIVDRIIQTHNIKRVIFLGDYVDLHGQT
FT                   NNIQLYAKDLTFLYSWKIDKEQNGIEVINLIGNHDAYYLLGDQAPFSIQNLEVFFAVQG
FT                   LLQDLKLQVAYQLDDYLISHAGFNQIFDPQKWHFTPYTKEHEEELDILAYTIGPMRGGE
FT                   ALGGSPLWAHFRELELLPNQDFPKQIVGHTPKESIDISKNVIGIDTFSLYIDKDNKYQF
FT                   IGNGDLLVYDQGHLEIISTNWATDETLKQLPKPQI"
FT   gene            complement(309329..310057)
FT                   /locus_tag="SPT_0346"
FT   CDS_pept        complement(309329..310057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0346"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23622"
FT                   /protein_id="ACO23622.1"
FT                   /translation="MAKLFAISDIHGHLDEFLSALSKVDLSDKNNRLILIGDYIDNGHQ
FT                   SFQVISKIIELEELHPNQIITLLGNHEEWFYDWLILENPTSSSFSETIKSFFSPEELTY
FT                   ILKSNVNNFEAGVRNEIKNNIKFNPFINWFKKRYRDKRYYETDTQIFVHAGIDEEAGKL
FT                   WKDLTSSEMFTNKFPITTGGFFKDIVSGHIASWEVAKDKTYQGKIYFDGKNHYFIDGDV
FT                   YHSKTIPVICYDTVTKSYQY"
FT   gene            complement(310484..311803)
FT                   /locus_tag="SPT_0347"
FT   CDS_pept        complement(310484..311803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0347"
FT                   /product="putative otitis media-associated H10"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22301"
FT                   /protein_id="ACO22301.1"
FT                   /translation="MFKLKKEANLKRNYFITSSRLKLLHLIIIIFSIFVLLGLIVSIRA
FT                   PAFIQILCIVFGVLAIYKINNKLKDFRYELDFDLIIRESLLFVLYTNHLYTSEKDNSGY
FT                   EKIIRSAILKYELDNQNGRIIIKALIRGDEFSKKVQTLDDVLAGVLELELEEKITHPNI
FT                   VEYHFYYKKPDRLILSPHDHKKEIDSLDIDLGYDITYNPIKCPHILVSGGTGSGKSIFI
FT                   SFLIIELLKRNSTLYIADPKNSDLGSLSHYLSDKYVATTPNSIARIVRLVVEQMQARYQ
FT                   TMRDNFHYGSNFADHGFKPVWLIFDEMGAFQASATDKKSKEVITEVMDGIKQIILLGRQ
FT                   AGVFILISAQQMRAETLNTDLRDNLGLRIALGANSIEGYRMVFGTATPDKFKSIEEKGA
FT                   GYLYMQGSGKEKAQYWESPYLDTTQFDFIKELQLYVTKSK"
FT   gene            complement(311880..312350)
FT                   /locus_tag="SPT_0348"
FT   CDS_pept        complement(311880..312350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22758"
FT                   /protein_id="ACO22758.1"
FT                   /translation="MVRVYKSVRLAYEAKVWIDELIQNKERKIKELSQNNFLSTLEQTL
FT                   LSNHYDELNGVSFNIVLKASIGSVIEESYRNTKHYSIDEWQKLRQEMEKDIKNVNPSLE
FT                   TSVTPRLYLDENVLNGLDEFRYHLMKEDGATRLPRLSYIIKLVVYSYWKTQQ"
FT   gene            complement(312363..312950)
FT                   /locus_tag="SPT_0349"
FT   CDS_pept        complement(312363..312950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22347"
FT                   /protein_id="ACO22347.1"
FT                   /translation="MNSFITIFKEAIGNSSNFDEESTKLGITKKKIPISVLCEHQNYLK
FT                   FETIQNNLENFKLFARTTHTIGNFTVFPNWMNCGRGLRLGDYWDITLISLQEFLNILSP
FT                   EAWENFIKMYHLQPYVNSDYSVELFWDNHNNNAIRPTKEENFQIFLKKVNERIEERGKF
FT                   IIKQICDQLDQKDFNFYKEIENMDKIKFSNEF"
FT   gene            complement(313508..314119)
FT                   /locus_tag="SPT_0350"
FT   CDS_pept        complement(313508..314119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0350"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23071"
FT                   /protein_id="ACO23071.1"
FT                   /translation="MGTWKPSREERVKIGIETFKNHPIDKSFNEYYLEVRKHVETCLKP
FT                   LSELPGYEASNIKYHILDVDLSKQKDFTTKVGECLFVQFTEDGHIVVIGAGHDYGMPTS
FT                   NKYIGANIINKLGNKWSKNAILIFITGIRQVGSYGKGSGIGGLEHKFQSRNMIEMYIGE
FT                   YILKQGIAILDKYSHKNYKLTPDEWDDETDKIFNYYNINN"
FT   gene            complement(314166..314561)
FT                   /locus_tag="SPT_0351"
FT   CDS_pept        complement(314166..314561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22482"
FT                   /protein_id="ACO22482.1"
FT                   /translation="MEIYTYSDFLKDKTALTFEEAGEIYNNLVSSLNTKDPDFLENWTT
FT                   LIELAAQYTELRVRSETIPLPKREQNDISRKSTHKAFISQLKVIKYFSENDGKNTNWFD
FT                   QITNDRQRQGDFANYLAYIYSVNTRKK"
FT   gene            315334..315516
FT                   /locus_tag="SPT_0352"
FT   CDS_pept        315334..315516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0352"
FT                   /product="Spn1, transposase Orf2"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24260"
FT                   /protein_id="ACO24260.1"
FT                   /translation="MGKLELLCEEFGYKLLPLPPYSPEYNPIEKTWAHIKKHLKKVLPS
FT                   CNTFYEALLSCSCFN"
FT   gene            315672..316010
FT                   /locus_tag="SPT_0353"
FT   CDS_pept        315672..316010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0353"
FT                   /product="antibiotic biosynthesis monooxygenase"
FT                   /note="identified by match to protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23799"
FT                   /protein_id="ACO23799.1"
FT                   /translation="MTLTIHVYYKDDGDSAIKFAREMLDSGLVEEIRNQKGNLKYEYFL
FT                   PIEKEGTILLIDQWINQETLDKHYQSKTMQKILDLRKKYHLQMQVERYIEDDSGMPESD
FT                   KSFIDTGN"
FT   gene            316200..317636
FT                   /locus_tag="SPT_0354"
FT   CDS_pept        316200..317636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0354"
FT                   /product="6-phospho-beta-glucosidase BglA"
FT                   /EC_number="3.2.1.86"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23333"
FT                   /protein_id="ACO23333.1"
FT                   /translation="MTTFKDGFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAR
FT                   EITSGVLEGKYYPNHEAIDFYHRYKEDIALFAEMGFKCFRTSLAWTRIFPKGDELEPNE
FT                   EGLQFYDNLFDECLKNGIEPVITLSHFEMPYHLVTEYGGWKNRKLIDFFARFAEVVFKR
FT                   YKDKVKYWMTFNEINNQANYQEDFAPFTNSGIVYEEGDNREAIMYQAAHYELVASARAV
FT                   KIGHEINPDFQIGCMIAMCPIYPATCNPKDILMAMKAMQKRYYFADVHVLGKYPEHIFK
FT                   YWERKGISVDFTAQDKEDLLGGTVDYIGFSYYMSFAIDFHRENNPYFDYLETEDLVKNN
FT                   YVKASEWEWQIDPEGLRYALNWFTDHYHLPLFIVENGFGAIDQVAADGMIHDDYRIEYL
FT                   GAHIREMKKAVVEDGVDLMGYTPWGCIDLVSAGTGEMRKRYGFIYVDKDDNGKGSYNRS
FT                   PKKSFGWYKEVISSNGESVE"
FT   gene            317688..317927
FT                   /locus_tag="SPT_0355"
FT   CDS_pept        317688..317927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0355"
FT                   /product="glutathione synthetase"
FT                   /note="identified by match to protein family HMM PF03083"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23977"
FT                   /protein_id="ACO23977.1"
FT                   /translation="MIGSIAAILTTFAFLPQVFRVVKTKDTGSIALGMYVMQVIGIALW
FT                   LAHGIRIGDLPLILANSVSFLLSGIILFYKLKYK"
FT   gene            318057..318371
FT                   /locus_tag="SPT_0356"
FT   CDS_pept        318057..318371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0356"
FT                   /product="PTS system, IIB component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23358"
FT                   /protein_id="ACO23358.1"
FT                   /translation="MAKALIICAAGMSSSLMAQKTTEFLKGKGKDIVVDAISATEGGKA
FT                   IAAAAFDLYLVSPQTKMYFKQFEEAGSKAGKPVVQIPPQAYIPIPMGIEKMANLILENI
FT                   "
FT   gene            318495..320468
FT                   /locus_tag="SPT_0357"
FT   CDS_pept        318495..320468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0357"
FT                   /product="transcription antiterminator BglG family"
FT                   /note="identified by match to protein family HMM PF00874;
FT                   match to protein family HMM PF05043; match to protein
FT                   family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23073"
FT                   /protein_id="ACO23073.1"
FT                   /translation="MLNIKEKDILQFLIKNKERFVTSKELAEYLSCSDRTVRNVLKLIE
FT                   KTMIIQGVRLISKQGQGYQIFFENQGAYQEFRQTYELEEDYTKTAVSKGDDRLVFILNK
FT                   LLFEQVPVLFDDLADELYVSRSTLSHDFRKIRVMLSEYNLSIESRANKGVYVSGEERDK
FT                   RRFIINYFLENQFFKTIHCYVKFNFFDQTVPLEEFARIVLDECQEANLKLSDFVLQNLV
FT                   VHIALSVIRLKSGFEIKNIDCQMTDDAIERKVAQRILSKVREVTNQEFPVQEIDYITLH
FT                   LLAKSQQCQKNQKNISEEVLKKSLFKTFQNLGLDDMYNFSSDFQLIEGLITHLMTLQVR
FT                   LESRITLNNPLVDEIKQNYSDIFFMTREILANMDKFLEWTISDDEVAYVSLHFLAAMER
FT                   SKESTKFNILAICATGFGAAQMLRNRLETEFGKRVEVVDVIGYYELNQEKLKGIDFIVS
FT                   AVDLSNLYFQIPVFKVSVFLKSDEMEMIRKAMDQMQVSSYVQSSKINKFENNSFRQYFS
FT                   KENFLICTESDKVNLLEKMVEGLSVGESNEFEQSLLYGIKQREELSSVVFSEKIAVPHP
FT                   IQPFGTEGKVSVAICKDSLLWDNQSSHVQLVFLLSPSIYGNEGLATVTKKIVSLTENDE
FT                   LQNQLISCNNFEDFINIFEKIK"
FT   gene            320478..320792
FT                   /locus_tag="SPT_0358"
FT   CDS_pept        320478..320792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0358"
FT                   /product="lichenan-specific phosphotransferase enzyme iia
FT                   component (pts system lichenan-specific eiia component)
FT                   (eiia-lic) (eiii-lic)"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22472"
FT                   /protein_id="ACO22472.1"
FT                   /translation="MNQEELQVAAFEIILHSGNARSEIHEAFAKMREGSFDDAESKLNQ
FT                   SNEIILEAHHAQTKLLQEYASGVEIKIEIIMVHAQDHLMTTMTLLEVAKEMLALYKKVN
FT                   "
FT   gene            320823..321329
FT                   /locus_tag="SPT_0359"
FT   CDS_pept        320823..321329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24217"
FT                   /protein_id="ACO24217.1"
FT                   /translation="MDKKERQKIEQQRREMALTNTFFNRYLLLRYSIALFFFGNIYWLL
FT                   NQFISPSPIIIFPIMLIVFSILATVEQFKLYGNRKEKLGITLMFVRIQMLISIGLLVLT
FT                   WTSWFKNLFPIFENNQVARLFVFVVLLLGLVLSLLDIRRIKKIYKRTDKAYQQFVQLEK
FT                   NSLSL"
FT   gene            321409..322755
FT                   /locus_tag="SPT_0360"
FT   CDS_pept        321409..322755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0360"
FT                   /product="PTS system, IIC component"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23499"
FT                   /protein_id="ACO23499.1"
FT                   /translation="MDQQNGLFGFLENHVMGPMGKLAQFKVVRAITAAGMAAVPFTIVG
FT                   SMFLVFSILPQAFSFWPIVADIFSASFDKFTSLYMVANYATMGSLSLYFVLSLAYELTK
FT                   IYAEEEELNMNPLNGALLALMAFVMTVPQIIFDGGMMKTVTSLKEGAVIADGWAMGNGV
FT                   ARFGTTGIFTAIIMAIVTVLIYRMCVKHNWVIKMPEAVPEGVSRGFTALVPGFVVAFVV
FT                   IFINGLLVAMGTDIFKVIAIPFGFVSNLTNSWIGLMIIYLLTQLLWIVGIHGANIVFAF
FT                   VSPIALANMAENAAGGHFAVAGEFSNMFVIAGGSGATLGLCLYIAFASKSEQLKAIGRA
FT                   SVVPALFNINEPLIFGLPIIYNPALAIPFILAPMVTATIYYVANSLNFIKPIIAQVPWP
FT                   TPVGIGAFLGTADLRAVLVALVCAFAAFLVYLPFIRVYDQKLVKEEQGI"
FT   gene            323136..323312
FT                   /locus_tag="SPT_0361"
FT   CDS_pept        323136..323312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24148"
FT                   /protein_id="ACO24148.1"
FT                   /translation="MSLDIDKEKMTIMGIAFENRSVFKSVWYALSTNMIEGWRPTVSDV
FT                   EKLRDEALALGMT"
FT   gene            323713..325926
FT                   /locus_tag="SPT_0362"
FT   CDS_pept        323713..325926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0362"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /note="identified by match to protein family HMM PF01055"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23532"
FT                   /protein_id="ACO23532.1"
FT                   /translation="MKIFKGEFYRISVLTDKLVRLEYSRTGNFEDRTTQLIYNRDFGQV
FT                   SLDYIETSNVLDIMTDYFHLHFNKGEFNAENLFIELKGNFAVYGSRWYFGESIETLKGT
FT                   ARTLDKADGAISLEDGIISRNGIALLDDSQGFIWDEQSGYIERENQIDLYFFAYGHDYR
FT                   GAIRDFYHLTGSIPLLPRYALGNWWSRYWPYTSDEYLDLIDRFETEKIPLSIGVLDMDW
FT                   HITDIPARFGSGWTGYSWNRNLIPNPEQLLQQLHDRKLKLSLNVHPADGIRAYEEAYPQ
FT                   IAKRLGLNVELEEPAIFDFFNPSFREAYFKDVHYELEKQGVDFWWIDWQQGTQGMLDPL
FT                   WLLNHYHYQDSCKNAEGGLILSRYAGPGSHRYPVGFSGDTIISWNSLRFQPYFTATASN
FT                   IGYSWWSHDIGGHMLGDYDEELQTRWLQFGVFSPITRLHSSRSPFNSKEPWFFSETTSK
FT                   IMKKYLRLRHQMIPYLYTMNVQTHEEGAPLISPIYYFYPENDESYNVPNQYFFGTELMV
FT                   APIVEKMDLTFQSAKVDVWFPEGEWYDFFSEKKYTGGVKLSVYRDISTTPVFAKSGAII
FT                   PLVGSEIDMGVDLPEVVDWYVFPGKQHYFEMLEDQNGQRYKTRLSIDWEMGMVELALQG
FT                   DSSIVPSNRKHRIHFKGTNVSIIELPNKNDTAKFEWKDNKRTSLNDEVFRLLKTASLPY
FT                   ELKDRLLNQFINAKNSHDLMNILHHQDKELRGRLLEMIFTSQN"
FT   gene            complement(326148..326624)
FT                   /locus_tag="SPT_0363"
FT   CDS_pept        complement(326148..326624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0363"
FT                   /product="peroxiredoxin Hyr1 (hydrogen peroxide
FT                   resistanceprotein 1) (oxidant receptor peroxidase 1)
FT                   (glutathione peroxidase 3)(phospholipid hydroperoxide
FT                   glutathione peroxidase 3) (phgpx3)"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by match to protein family HMM PF00255"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23214"
FT                   /protein_id="ACO23214.1"
FT                   /translation="MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTTTGCGLMPQYQGL
FT                   QELYERYQDQGFEILDFPCNQFMGQAPGSAEEINAFCSLHFQTTFPRFAKIKVNGKEAD
FT                   PLYVWLKDHKSGPLGKRIEWNFAKFLISRDGQVFERFSSKTDPKQIEEAIQTLL"
FT   gene            326847..330050
FT                   /locus_tag="SPT_0364"
FT   CDS_pept        326847..330050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0364"
FT                   /product="hyaluronate lyase"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF02018; match to protein
FT                   family HMM PF02278; match to protein family HMM PF02884;
FT                   match to protein family HMM PF08124; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22630"
FT                   /protein_id="ACO22630.1"
FT                   /translation="MQTKTKKLIVSLSSLVLSGFLLNHYMTVGAEETTTNTIQQSQKEV
FT                   QYQQRDTKNLVENGDFGQTEDGSSPWTGSKAQGWSAWVDQKNSSADASTRVIEAKDGAI
FT                   TISSPEKLRVAVHRMVPIEAKKKYKLRFKIKTDNKVGIAKVRIIEESGKDKRLWNSATT
FT                   SGTKDWQTIEADYSPTLDVDKIKLELFYETGTGTVSFKDIELVEVADQPSEDSQTDKQL
FT                   EEKIDLPIGKKHVFSLADYTYKVENPDVASVKNGILEPLKEGTTNVIVSKDGKEVKKIP
FT                   LKILASVKDAYTDRLDDWNGIIAGNQYYDSKNEQMAKLNQELEGKVADSLSSISSQADR
FT                   IYLWEKFSNYKTSANLTATYRKLEEMAKQVTNPSSRYYKDETVVRTVRDSMEWMHKHVY
FT                   NSEKSIVGNWWDYEIGTPRAINNTLSLMKEYFSDEEIKKYTDVIEKFVPDPEHFRKTTD
FT                   NPFKALGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGEGFYQDGSYIDH
FT                   TNVAYTGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWIDKSFAPLLVNGELMDM
FT                   SRGRSISRANSEGHVAAVEVLRGIHRIADMSEGETKQRLQSLVKTIVQSDSYYDVFKNL
FT                   KTYKDISLMQSLLSDAGVASVPRTSYLSAFNKMDKTAMYNAEKGFGFGLSLFSSRTLNY
FT                   EHMNKENKRGWYTSDGMFYLYNGDLSHYSDGYWPTVNPYKMPGTTETDAKRADSDTGKV
FT                   LPSAFVGTSKLDDANATATMDFTNWNQTLTAHKSWFMLKDKIAFLGSNIQNTSTDTAAT
FT                   TIDQRKLESGNPYKVYVNDKEASLTEQEKDYPETQSVFLESSDSKKNIGYFFFKKSSIS
FT                   MSKALQKGAWKDINEGQSDKEVENEFLTISQAHKQNGDSYGYMLIPNVDRATFNQMIKE
FT                   LESSLIDNNETLQSVYDAKQGVWGIVKYDDSVSTISNQFQVLKRGVYIIRKEGDEYKIA
FT                   YYNPETQESAPDQEVFKKLEQATQPQVQNSKEKEKSEEEKNHSDQKNLPQTGEGQSILA
FT                   SLGFLLLGAFYLFRRGKNN"
FT   gene            330433..330774
FT                   /pseudo
FT                   /locus_tag="SPT_0365"
FT                   /note="transposase of family; this region contains one or
FT                   more premature stops and/or frameshifts"
FT   gene            complement(331151..331780)
FT                   /locus_tag="SPT_0366"
FT   CDS_pept        complement(331151..331780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0366"
FT                   /product="keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate
FT                   aldolase"
FT                   /note="identified by match to protein family HMM PF01081;
FT                   match to protein family HMM TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22659"
FT                   /protein_id="ACO22659.1"
FT                   /translation="MTKSDTIIELKKQKIVAVIRGNTKEEGLQASIACIKGGIKAIEIA
FT                   YTNQYAGQIIKQLVDLYQDDQSVCIGAGTVIDAVTARDAILAGANYVVSPSFHAETAKM
FT                   CNLYSTPYIPGCITLTEITTALEAGSEIIKLFPGSALSPAYISAVKAPIPQVSVMVTGG
FT                   VGLNNIPQWFAAGADAVGIGGELNKLASQGDFDRISEIAQQYVTLR"
FT   gene            complement(331790..332791)
FT                   /locus_tag="SPT_0367"
FT   CDS_pept        complement(331790..332791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0367"
FT                   /product="2-keto-3-deoxygluconate kinase"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23897"
FT                   /protein_id="ACO23897.1"
FT                   /translation="MTKILLFGEPLIRISPLDATSIGDHVASSTYFGGSEINIACNLQA
FT                   LGISTKVFTALPANEIGDRFLTFLKQHQIDTSSICRLGDRIGLYFLENGFGCRQSEVFY
FT                   DRKHTSISQIRPNMLDMGSLFQGISHFHFSGITVAIGQEVRTLLLLLLEEAKRRGIIVS
FT                   MDLNLRTKMISVLEAKYEFSKFARFADYCFGIDPLMIDDQNLEMFPRDRASLKEVENRM
FT                   RQLKEAYGFKAIFHTLRSSDEQDKNVYQAYALGERFEESVQLKTAVYQRVGSGDAFISG
FT                   VLYQLLHHSYLKTTIDFAVASATLKCTLPGDHLSTSETSIEKLLANAQDIIR"
FT   gene            complement(332822..333463)
FT                   /locus_tag="SPT_0368"
FT   CDS_pept        complement(332822..333463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0368"
FT                   /product="ribose 5-phosphate isomerase RpiB"
FT                   /note="identified by match to protein family HMM PF02502"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23463"
FT                   /protein_id="ACO23463.1"
FT                   /translation="MKIALINENSQASKNHIIYDSLKEATDKKGYQLFNYGMRGEEGEN
FT                   PLTYVQNGLMAAILLNTKAVDFVVTGCGTGVGAMLALNSFPGVVCGLAVDPTDAYLYSQ
FT                   INGGNALSIPYAKGFGWGAELTLKLMFERLFAEEMGGGYPRERVIPEQRNARILNEVKQ
FT                   ITYNDLMTILKTIDQDFLKDTISGKYFQEYFFENCQDDEVAAYLKEVLAK"
FT   gene            complement(333482..334297)
FT                   /locus_tag="SPT_0369"
FT   CDS_pept        complement(333482..334297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0369"
FT                   /product="gluconate 5-dehydrogenase (5-keto-D-gluconate
FT                   5-reductase)"
FT                   /EC_number="1.1.1.69"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22984"
FT                   /protein_id="ACO22984.1"
FT                   /translation="MTNTSFSIEQFSLKGKIALITGASYGIGFAIAKSYAEAGATIVFN
FT                   DINQDLVNKGIEAYREVGIEAHGYVCDVTDEDGIQAMVKQIEQEVGVIDILVNNAGIIR
FT                   RVPMCEMSAADFRKVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSA
FT                   YAAAKGGLKMLTRNIASEYGGANIQCNGIGPGYIATPQTAPLRELQEDGSRHPFDQFII
FT                   AKTPAARWGNPEDLMGPAVFLASDASDFVNGHILYVDGGILAYIGKQPE"
FT   gene            334569..335003
FT                   /locus_tag="SPT_0370"
FT   CDS_pept        334569..335003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0370"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22521"
FT                   /protein_id="ACO22521.1"
FT                   /translation="MKIVLVGHGHFATGIYSSLQLIAGNQENVEAIDFVEGMSADELKQ
FT                   KILLAISNEEEVLILSDLLGGSPFKVSSTIMGENPAKTMNVLSGLNLAMLMEAVFARMA
FT                   HSFDEVVNKSVVAAQGGVVNGKELFSTDAEEEEEDFESGI"
FT   gene            335015..336205
FT                   /locus_tag="SPT_0371"
FT   CDS_pept        335015..336205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0371"
FT                   /product="unsaturated glucuronyl hydrolase (UGL)
FT                   (Glycuronidase)(Unsaturated uronic acid hydrolase)
FT                   (Glycosaminoglycan hydrolase)"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF07470"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24243"
FT                   /protein_id="ACO24243.1"
FT                   /translation="MIKKVTIEEIKSPERFLEVPLLTKEEVGQAIDKVIRQLELNLDYF
FT                   KENFPTPATFDNVYPIMDNTEWTNGFWTGELWLAYKYSQQDEFKNIAHKNVLSFLDRVN
FT                   KRVELAHHDLGFLYTPSCMAEYKINGDGEAREAALKAADKLIERYQEKGGFIQAWGDLG
FT                   KKEHYRLIIDCLLNIQLLFFAYQETGDQKYYDIAESHFYASANNVIRDDASSFHTFYFD
FT                   PETGQPFKGVTRQGYSDDSCWARGQSWGVYGIPLTYRHLKDESCFDLFKGVTNYFLNRL
FT                   PKDHVSYWDLIFNDGSAQSRDSSATAIAVCGIHEMLKHLPEVDADKDIYKHAMHAMLRS
FT                   LIEHYANDQFTPGGTSLLHGVYSWHSGKGVDEGNIWGDYYYLEALIRFYKDWNLYW"
FT   gene            336216..336707
FT                   /locus_tag="SPT_0372"
FT   CDS_pept        336216..336707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0372"
FT                   /product="N-acetylgalactosamine-specific phosphotransferase
FT                   enzyme iib component2 (pts system
FT                   n-acetylgalactosamine-specific eiibcomponent 2)
FT                   (eiib-aga')"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22794"
FT                   /protein_id="ACO22794.1"
FT                   /translation="MTTPNIIMTRIDERLIHGQGQLWVKYLGCNTVIVANDEVSTDKMQ
FT                   QTLMKTVVPDSVAMRFFPLQKVIDIIHKANPAQTIFIVVKDVKDALTLVEGGVPIKEIN
FT                   IGNIHNAPGKEQVTRSIFLGEEDKAALKELSQTHQVTFNTKTTPTGNDGAVEVNIMDYI
FT                   "
FT   gene            336722..337501
FT                   /locus_tag="SPT_0373"
FT   CDS_pept        336722..337501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0373"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="identified by match to protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23102"
FT                   /protein_id="ACO23102.1"
FT                   /translation="MSINVFQAILIGLWTAFCFSGMLLGIYTNRCIVLSFGVGIILGDL
FT                   PTALAMGAIGELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVSPEAALALSTPI
FT                   AVAIQFLQTFAYTVRAGAPETAMKHLKNHNLKKFKFTLNATIWLFAFIGFTLGCLGALS
FT                   MDTLLKLVDYIPPVLLTGLTVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAAYLNI
FT                   PTIGIAIVGTIFALIEFYNKPKTANHVVEEEAHDDWI"
FT   gene            337488..338306
FT                   /locus_tag="SPT_0374"
FT   CDS_pept        337488..338306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0374"
FT                   /product="PTS system, IID component"
FT                   /note="identified by match to protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23685"
FT                   /protein_id="ACO23685.1"
FT                   /translation="MTGSNKLTKRDYLKTSLRAFFCQNGFNYSNYQGLGYANVMYPALK
FT                   KHYGEDQEGFYQALEENCEFYNTNPHFLPFITSLHLVMLENGRPAKETRSIKMALMGPL
FT                   AGIGDSLSQFCLAPLFSTIAASFAQEGLVVGPILFFLAMNTILTAIKLSTGLYGYKLGT
FT                   TVIDKLSEQMATISRIANIIGVTVIAGLAATSVKIMVPITFAAGEVKADAKQSIVSIQG
FT                   MLDKVAPALLPALFTLLVYYLIKEKKWTTYKLVILTVIIGIIGSWLKILA"
FT   gene            338306..338599
FT                   /locus_tag="SPT_0375"
FT   CDS_pept        338306..338599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0375"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22452"
FT                   /protein_id="ACO22452.1"
FT                   /translation="MDTTLFYGIVIVLAVSPLLLSSFHSIRQQKLLRKQMEQRKEYLAS
FT                   LTSGDEVLLLSGIHGKIISIKDDLVSLQIAKGVVIYVEKESVMGKTKELLFK"
FT   gene            338621..340522
FT                   /locus_tag="SPT_0376"
FT   CDS_pept        338621..340522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0376"
FT                   /product="oligohyaluronate lyase"
FT                   /note="identified by match to protein family HMM PF07940"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23038"
FT                   /protein_id="ACO23038.1"
FT                   /translation="MKEERRQFFERIDGDQYRDYILSHCSKDYEKVKSSLERLMDNRFM
FT                   FDSPWDMEPCSKIHQIQPMVWDQVFEDDPEWAYMLNRQEYLLQFMIGYLVEGDKGYIQK
FT                   CKFFLFDWIDQVREFRPQSLMTRTLDTGIRSFTWLKLLLLLLKFDLLEEEELENILVSL
FT                   EKQIDFMKSHYRAKYTLSNWGILQTIPILATYHFFSDKMDLEEAYHFASKELKQQIETQ
FT                   ILEDGSQFEQSILYHVEVYKALLDLCLLLPDLQDSFQELLEKMATYIQMMTGLDGRTLA
FT                   FGDSDSTETTEILSLSAMVLNKEDLLNGLDVKVDLLSLLFLGREKVKRLQEFEKRAWQP
FT                   KFRSFEDSGHVCIKDEHRYLFFKNGPLGSAHSHSDENSFCLQYQGQPIFIDAGRYSYRE
FT                   VDERYLLKSAWSHSTCIVDGKAPERIVGSWEYEYYPHSLFCHHKEREGVHYIEGAYLSA
FT                   EPDLPYLHRRKILMLAEDVWLLVDDIRCQGQHEVLTQFILDKDVTYQDGKINQLKLWSE
FT                   VDFDLEATIISPKYNELEKSSKLTKHQFFENQMLDYTIIAHESFEIIRHSVYQTDGHQV
FT                   ENALAFEVKNDETDKLILLLSEDICVGEKLCLVDGTKMRGKCLVYDKINERMIRLQC"
FT   gene            340582..341583
FT                   /locus_tag="SPT_0377"
FT   CDS_pept        340582..341583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0377"
FT                   /product="sugar binding transcriptional regulator RegR"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23375"
FT                   /protein_id="ACO23375.1"
FT                   /translation="MEKKLTIKDIAEMAQTSKTTVSFYLNGKYEKMSQETREKIEKVIH
FT                   ETNYKPSIVARSLNSKRTKLIGVLIGDITNSFSTQIVKGIEDIASQNGYQVMIGNSNYS
FT                   QESEDRYIESMLLLGVDGFIIQPTSNFRKYSRIIDEKKKKMVFFDSRLYEHRTSWVKTN
FT                   NYDAVYDMTQSCIEKGYEHFLLITADTSRLSTRIERASGFVDALTDANMRHARLTIEDK
FT                   HTNLEQIKEFLQKEINPDEKTLVFVPNCWALPPVFTVIKELNYNLPQVGLIGFDNTEWT
FT                   CFSSPSVSTLVQPAFEEGQQATKILIDQIEGLNQEERQQVLDCSVSWKESTF"
FT   gene            341640..341762
FT                   /locus_tag="SPT_0378"
FT   CDS_pept        341640..341762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0378"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23911"
FT                   /protein_id="ACO23911.1"
FT                   /translation="MNWMGLFVYKMRNYGSNLLNQLFLIYFFNYLIKVIEVDQT"
FT   gene            complement(341854..342432)
FT                   /locus_tag="SPT_0379"
FT   CDS_pept        complement(341854..342432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0379"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22713"
FT                   /protein_id="ACO22713.1"
FT                   /translation="MNKEDLTTRLLRNLFHIQGPFDECRQEIIYKACARSMVQIVYSSF
FT                   FLFLFYLLFGRFIEAVRYAMPYVYSGLIFFITLKTQRAVKELHLEKDDKSEIILKTYSK
FT                   AQIKFRSWVVFIGIQIGLFTLLIFHKVFVQQMSFSDFGKLLMQFDKSGPFLMYGLIIGS
FT                   IFGTLTYGFLSLQEEKTPKNTKQKEKSKQ"
FT   gene            complement(342459..342590)
FT                   /locus_tag="SPT_0380"
FT   CDS_pept        complement(342459..342590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23004"
FT                   /protein_id="ACO23004.1"
FT                   /translation="MILSFPQLMLISSDWKYYLLLTIASLSSITYLYYLYQFVKESQ"
FT   gene            complement(342658..342792)
FT                   /locus_tag="SPT_0381"
FT   CDS_pept        complement(342658..342792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23525"
FT                   /protein_id="ACO23525.1"
FT                   /translation="MPYEIITNFTYLSSFVQFSAHLHHHFRELANRRDIPRASLYSSP"
FT   gene            complement(342796..343338)
FT                   /locus_tag="SPT_0382"
FT   CDS_pept        complement(342796..343338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23457"
FT                   /protein_id="ACO23457.1"
FT                   /translation="MKKETFTEKLIKRIYGISGPLDEHKRREADRIGNQVFIILFYLMI
FT                   FGNLIPLLLAYKYPQEVALIYPPLILVIALIAAGYVTYKMKKTGITAIDPDMLSEKESK
FT                   QLYYPGLKAGLFFGLWMFFITPLLSILIGEGQDYFHSLLTIRNGVSSILGSIFFGASIQ
FT                   FLISRRIAKAKEDQDED"
FT   gene            complement(343354..343548)
FT                   /locus_tag="SPT_0383"
FT   CDS_pept        complement(343354..343548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0383"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22651"
FT                   /protein_id="ACO22651.1"
FT                   /translation="MNRVKEFRKELGISQLELAKDIGVSRQTINMIENDKYNPTLELCL
FT                   NLARSLQTDLNSLFWEDNF"
FT   gene            343714..344664
FT                   /gene="mraW"
FT                   /locus_tag="SPT_0384"
FT   CDS_pept        343714..344664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="SPT_0384"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23088"
FT                   /db_xref="GOA:C1CPL0"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPL0"
FT                   /protein_id="ACO23088.1"
FT                   /translation="MTKEFHHVTVLLHETIDMLDVKPDGIYVDATLGGAGHSEYLLSKL
FT                   SEKGHLYAFDQDQNAIDNAQKRLAPYIEKGMVTFIKDNFRHLQARLREAGVQEIDGICY
FT                   DLGVSSPQLDQRERGFSYKKDAPLDMRMNQDASLTAYEVVNHYDYHDLVRIFFKYGEDK
FT                   FSKQIARKIEQAREVKPIETTTELAEIIKSAKPAKELKKKGHPAKQIFQAIRIEVNDEL
FT                   GAADESIQQAMDMLALDGRISVITFHSLEDRLTKQLFKEASTVEVPKGLPFIPDDLKPK
FT                   MELVARKPILPSAEELEANNRSHSAKLRVARKIHK"
FT   gene            344677..344994
FT                   /gene="ftsL"
FT                   /locus_tag="SPT_0385"
FT   CDS_pept        344677..344994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SPT_0385"
FT                   /product="cell division protein FtsL"
FT                   /note="identified by match to protein family HMM TIGR02209"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23305"
FT                   /protein_id="ACO23305.1"
FT                   /translation="MAERMEKTGQILQMQLKRFSRVEKAFYFSIAVTTLIVAISIIFMQ
FT                   TKLLQVQNDLTKINAQIEEKKTELDDAKQEVNELLRAERLKEIANSHDLQLNNENIRIA
FT                   E"
FT   gene            344998..347250
FT                   /locus_tag="SPT_0386"
FT   CDS_pept        344998..347250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0386"
FT                   /product="penicillin-binding protein 2x"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717; match to protein
FT                   family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24263"
FT                   /protein_id="ACO24263.1"
FT                   /translation="MKWTKRVIRYATKNRKSPAENRRRVGKSLSLLSVFVFAVFLVNFA
FT                   VIIGSGSKFGTDLVKEAKKVHQITRTVPAKRGTIYDRNGVPIAEDATSYNVYAVIDKKY
FT                   KSATGKILYVEDAQFNKVAEVFHKYLDMDEAYVKEQLSQPNLTQVSFGAKGNGITYANM
FT                   MAIKKELETAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESS
FT                   LNSILAGKDGIITYEKDRLGNIVPGTEQVSQQTVDGKDVYTTLSSPLQSFMETQMDAFL
FT                   EKVKGKYMTATLVSAKTGEILATTQRPTFNADTKEGITEDFVWRDILYQSNYEPGSAMK
FT                   VMTLASSIDNNTFPSGEYFNSSEFKIADATTRDWDVNDGLTTGGMMTFLQGFAHSSNVG
FT                   MSLLEQKMGDATWLDYLKRFKFGVPTRFGLTDEYAGQLPADNIVSIAQSSFGQGISVTQ
FT                   TQMLRAFTAIANDGVMLEPKFISAIYDTNNQSVRKSQKEIVGNPVSKEAASTTRNHMIL
FT                   VGTDPLYGTMYNHYTGKPIITVPGQNVAVKSGTAQIADEKNGGYLVGSTNYIFSVVTMN
FT                   PAENPDFILYVTVQQPEHYSGIQLGEFATPILERASAMKESLNLQSPAKNLDKVTTESS
FT                   YAMPSIKDISPGELAEALRRNIVQPIVVGTGTKIKETSVEEGTNLAPNQQVLLLSDKVE
FT                   EIPDMYGWKKETAETFAKWLDIELEFEGSGSVVQKQDVRTNTAIKNIKKIKLTLGD"
FT   gene            347252..348232
FT                   /gene="mraY"
FT                   /locus_tag="SPT_0387"
FT   CDS_pept        347252..348232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SPT_0387"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="identified by match to protein family HMM PF00953;
FT                   match to protein family HMM TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22228"
FT                   /db_xref="GOA:C1CPL3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPL3"
FT                   /protein_id="ACO22228.1"
FT                   /translation="MFISISAGIVTFLLTLVGIPAFIQFYRKAQITGQQMHEDVKQHQA
FT                   KAGTPTMGGLVFLIAAVVVSFLVALFSKQLTNNVGMILFILVLYGLVGFLDDFLKVFRK
FT                   INEGLNPKQKLALQLLGGVIFYLFYERGGDMLSVFGYQVHLGIFYIIFALFWLVGFSNA
FT                   VNLTDGIDGLASISVVISLSAYGVIAYVQGQMDILLVIFAMIGGLLGFFVFNHKPAKVF
FT                   MGDVGSLALGGMLAAISMALHQEWTLLIIGIVYVFETTSVMMQVSYFKLTGGKRIFRMT
FT                   PVHHHFELGGLSGKGNPWSEWKVDFFFWGVGLLASLLTFAILYLM"
FT   gene            348796..350901
FT                   /locus_tag="SPT_0388"
FT   CDS_pept        348796..350901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0388"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpL"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22863"
FT                   /protein_id="ACO22863.1"
FT                   /translation="MNNNFNNFNNMDDLFNQLMGGMRGYSSENRRYLINGREVTPEEFA
FT                   HYRATGQLPGNAETDVQMPQQASGMKQDGVLAKLGRNLTAEAREGKLDPVIGRNKEIQE
FT                   TSEILSRRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGLEAG
FT                   TQYRGSFEENVQNLVNEVKEAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKPALSR
FT                   GELTVIGATTQDEYRNTILKNAALARRFNEVKVNAPSAENTFKILQGIRDLYQQHHNVI
FT                   LPDEVLKAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDVHAVEREIETEKDK
FT                   QEKAVEAEDFEAALNYKTRIAELERKIENHTEDMKVTASVNDVAESVERMTGIPVSQMG
FT                   ASDIERLKDMAHRLQDKVIGQDKAVEVVARAIRRNRAGFDEGNRPIGNFLFVGSTGVGK
FT                   TELAKQLALDMFGTQDAIIRLDMSEYSDRTAVSKLIGTTAGYVGYDDNSNTLTERVRRN
FT                   PYSIILLDEIEKADPQVITLLLQVLDDGRLTDGQGNTVNFKNTVIIATSNAGFGYEANL
FT                   TEDADKPELMDRLKPFFRPEFLNRFNAVIEFSHLTKEDLSKIVDLMLAEVNQTLAKKDI
FT                   DLVVSQAAKDYITEEGYDEVMGVRPLRRVVEQEIRDKVTDFHLDHLDAKHLEADMKDGV
FT                   LVIREKA"
FT   gene            351129..351194
FT                   /locus_tag="SPT_2268"
FT   ncRNA           351129..351194
FT                   /locus_tag="SPT_2268"
FT                   /product="group II catalytic intron"
FT                   /ncRNA_class="autocatalytically_spliced_intron"
FT   gene            complement(351196..351678)
FT                   /gene="luxS"
FT                   /locus_tag="SPT_0389"
FT   CDS_pept        complement(351196..351678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="SPT_0389"
FT                   /product="S-ribosylhomocysteinase LuxS"
FT                   /EC_number="4.4.1.21"
FT                   /note="identified by match to protein family HMM PF02664"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22927"
FT                   /db_xref="GOA:C1CPL5"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPL5"
FT                   /protein_id="ACO22927.1"
FT                   /translation="MSKEVIVESFELDHTIVKAPYVRLIGEETGPKGDIISNYDIRLVQ
FT                   PNEDSIPTAGLHTIEHLLAKLIRTRIDGMIDCSPFGCRTGFHMIMWGRHTSAKIAAVIK
FT                   DSLKEIAETTTWEDVPGTTIESCGNYKDHSLFSAKEWAKLILEQGISDDAFERHVI"
FT   gene            complement(351773..353257)
FT                   /locus_tag="SPT_0390"
FT   CDS_pept        complement(351773..353257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08903"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23801"
FT                   /db_xref="InterPro:IPR014999"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPL6"
FT                   /protein_id="ACO23801.1"
FT                   /translation="MKKQAFSSEQYLNLQRDHILERINQFDGKLYLEFGGKMLEDFHAA
FT                   RVLPGYEPDNKIKLLQELKEQVEVVIAINASNIEHSKARGDLGISYDQEVLRLIDKFNE
FT                   LGIFVGSVVITQYAGQPAADAFRNQLEKNGIDSYLHYPIKGYPTDMDHIISPEGMGKND
FT                   YIKTSRNLIVVTAPGPGSGKLATCMSNMYHDQINVIKSGYAKFETFPVWNLPLHHPVNL
FT                   AYEAATADLDDVNMIDPFHLQTYGETTVNYNRDIEIFPVLKRMLERILGKSPYASPTDM
FT                   GVNMVGFAITDDEAAVEASKQEIIRRYYQTVLDFKAEKVGEAAVKKIELLMNDLGITPA
FT                   DRKVAVVARQKAEETGGPALAFELPNGEIVTGKNSELFGPTAAALINAIKKSADIAKEV
FT                   KLIEPEVVKPIQGLKIDHLGSRNPRLHSNEILIALAITATENPDAARAMEELGNLKGSE
FT                   AHSTIILTDEDKNVLRKLGINVTFDPYYQYDRLYRK"
FT   gene            353410..355017
FT                   /locus_tag="SPT_0391"
FT   CDS_pept        353410..355017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0391"
FT                   /product="trehalose-6-phosphate hydrolase
FT                   (Alpha,alpha-phosphotrehalase)"
FT                   /EC_number="3.2.1.93"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23839"
FT                   /protein_id="ACO23839.1"
FT                   /translation="MQEKWWHNAVVYQVYPKSFMDSNEDGIGDLPGITSKLDYLAKLGI
FT                   TAIWLSPVYDSPMDDNGYDIADYQAIAAIFGTMEDMDQLIAEAKKRDIRIIMDLVVNHT
FT                   SDEHAWFVEACENPNSPERDYYIWRDEPNDLDSIFSGSAWEYDEKSGQYYLHFFSKKQP
FT                   DLNWENEKLRQKIYEMMNFWIDKGIGGFRMDVIDMIGKIPDEKVVNNGPMLHPYLKEMN
FT                   QATFGDKDLLTVGETWGATPEIAKLYSDPKGQELSMVFQFEHIGLQYQEGQPKWHYQKE
FT                   LNIAKLKEIFNKWQTELGVEDGWNSLFWNNHDLPRIVSIWGNDQEYREKSAKAFAILLH
FT                   LMRGTPYIYQGEEIGMTNYPFETLDQVEDIESLNYAREALEKGVPIEEIMDSIRVIGRD
FT                   NARTPMQWDESKNAGFSTGQPWLAVNPNYEMINVQEALANPDSIFYTYQKLVQIRKENS
FT                   WLIRADFELLDTADKVFAYIRKDGDRRFLVVANLSNEEQDLTVEGKVKSVLIENTLAQE
FT                   VFEKQILVPWDAFCVELL"
FT   gene            356437..357882
FT                   /locus_tag="SPT_0392"
FT   CDS_pept        356437..357882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0392"
FT                   /product="integral membrane regulatory protein Wzg"
FT                   /note="identified by match to protein family HMM PF02916;
FT                   match to protein family HMM PF03816; match to protein
FT                   family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22479"
FT                   /protein_id="ACO22479.1"
FT                   /translation="MSRRFKKSRSQKVKRSVNIVLLTIYLLLVCFLLFLIFKYNILAFR
FT                   YLNLVVTALVLLVALVGLLLIIYKKAEKFTIFLLVFSILVSSVSLFAVQQFVGLTNRLN
FT                   ATSNYSEYSISVAVLADSDIENVTQLTSVTAPTGTDNENIQKLLADIKSSQNTDLTVNQ
FT                   SSSYLAAYKSLIAGETKAIVLNSVFENIIESEYPDYASKIKKIYTKGFTKKVEAPKTSK
FT                   NQSFNIYVSGIDTYGPISSVSRSDVNILMTVNRDTKKILLTTTPRDAYVPIADGGNNQK
FT                   DKLTHAGIYGVDSSIHTLENLYGVDINYYVRLNFTSFLKMIDLLGGVDVHNDQEFSALH
FT                   GKFHFPVGNVHLDSEQALGFVRERYSLADGDRDRGRNQQKVIVAIIQKLTSTEVLKNYS
FT                   SILQGLQDSLQTNMPIETMIDLVNTQLESGGNYKVNSQDLKGTGRMDLPSYAMPDSNLY
FT                   VMEIDDSSLAVVKAAIQDMMEGR"
FT   gene            357884..358615
FT                   /locus_tag="SPT_0393"
FT   CDS_pept        357884..358615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0393"
FT                   /product="tyrosine-protein phosphatase CpsB"
FT                   /EC_number="3.1.3.48"
FT                   /note="identified by match to protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22931"
FT                   /protein_id="ACO22931.1"
FT                   /translation="MIDIHSHIVFDVDDGPKSREESKALLAESYRQGVRTIVSTSHRRK
FT                   GMFETPEEKIAENFLQVREIAKEVADDLVIAYGAEIYYTLDALEKLEKKEIPTLNDSRY
FT                   ALIEFSMHTSYRQIHTGLSNILMLGITPVIAHIERYDALENNEKRVRELIDMGCYTQIN
FT                   SYHVSKPKFFGEKYKFMKKRARYFLERDLVHVVASDMHNLDSRPPYMQQAYDIIAKKYG
FT                   AKKAKELFVDNPRKIIMDQLI"
FT   gene            358624..359316
FT                   /locus_tag="SPT_0394"
FT   CDS_pept        358624..359316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0394"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   CpsC"
FT                   /note="identified by match to protein family HMM PF02706;
FT                   match to protein family HMM TIGR01006"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23650"
FT                   /protein_id="ACO23650.1"
FT                   /translation="MKEQNTLEIDVLQLFRALWKRKLVILLVAIITSSVAFAYSTFVIK
FT                   PEFTSMTRIYVVNRDQGEKSGLTNQDLQAGSSLVKDYREIILSQDVLEEVVSDLKLDLT
FT                   PKDLANKIKVTVPVDTRIVSVSVSDRVPEEASRIANSLREVAAQKIISITRVSDVTTLE
FT                   EARPATSPSSPNIKRSTLIGFLAGVIGTSVIVLILELLDTRVKRPKDIEDTLQMTLLGI
FT                   VPNLNKLK"
FT   gene            359326..360009
FT                   /locus_tag="SPT_0395"
FT   CDS_pept        359326..360009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0395"
FT                   /product="tyrosine-protein kinase CpsD"
FT                   /EC_number="2.7.10.2"
FT                   /note="identified by match to protein family HMM TIGR01007"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23634"
FT                   /protein_id="ACO23634.1"
FT                   /translation="MPTLEIAQKKLEFVKKAEEYYNALCTNIQLSGDKLKVISVTSVNP
FT                   GEGKTTTSVNIARSFARAGYKTLLIDGDIRNSVMSGFFKSREKITGLTEFLSGTADLSH
FT                   GLCDTNIENLFVVQSGTVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVIDAA
FT                   IITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVFNKLDISVDKYGVYGFYG
FT                   NYGKK"
FT   gene            360394..361392
FT                   /locus_tag="SPT_0396"
FT   CDS_pept        360394..361392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0396"
FT                   /product="galactosyl transferase CpsE"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by match to protein family HMM PF02397;
FT                   match to protein family HMM TIGR03025"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24078"
FT                   /protein_id="ACO24078.1"
FT                   /translation="MFFNLKNSKKILLLTVTKNMEKVLDKLLESDELSWKLVAVSVLDK
FT                   SDFQHDKIPVIEKEKIIEFATHEVVDEVFVNLPGESYDIGEIISRFETMGIDVTVNLKA
FT                   FDKNLGRNKQIHEMVGLNVVTFSTNFYKTSHVIAKRIIDIMGALVGLILCGLVSIVLVP
FT                   LIRKDGGSAIFAQTRIGKNGRQFTFYKFRSMCVDAEAKKRELMEQNTMQGGMFKVDDDP
FT                   RITKIGRFIRKTSLDELPQFYNVLKGDMSLVGTRPPTVDEYVQYTSEQKRRLSFKPGIT
FT                   GLWQVSGRSKITDFDDVVKLDVAYIDNWTIWKDIEILLKTVKVVFMRDGAK"
FT   gene            361396..362139
FT                   /locus_tag="SPT_0397"
FT   CDS_pept        361396..362139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0397"
FT                   /product="UDP-N-acetyl-D-mannosamine transferase"
FT                   /note="identified by match to protein family HMM PF03808;
FT                   match to protein family HMM TIGR00696"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22865"
FT                   /protein_id="ACO22865.1"
FT                   /translation="MRDRIQLLGVTIDLLTMNETIDIVEQYVLEKRPLHLMGVNADKIN
FT                   QCHTDEKIKKIVNESGIINADGASVVLASKFLGTPVPERVAGIDLMQCLLELSNKKGYS
FT                   VYFFGAKEEVLQDMLKVFKRDYPNLIVIGHRNGYFSEEDEQAIQEDIREKNPDFVFIGI
FT                   TSPKKEYIIQKFMDSGVNSVFMGVGGSFDVLSGHIQRAPLWMQKSNLEWLFRVANEPKR
FT                   LFKRYFVGNISFIGKVLKAKRGVKY"
FT   gene            362136..362960
FT                   /locus_tag="SPT_0398"
FT   CDS_pept        362136..362960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0398"
FT                   /product="31.6 kDa cps19fG gene product"
FT                   /note="identified by match to protein family HMM PF04991"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23168"
FT                   /protein_id="ACO23168.1"
FT                   /translation="MNQTEMIRLIQKVELDAIKEFKKICEENDIDFFLRGGSVLGAVKY
FT                   DGFIPWDDDMDIAVPREAYDKLPSVFKDRIIAGKYQVLTYQYCDTLHCYFPRLFLLEDE
FT                   RKRLGLPRNTNLGLHLIDIIPLDGAPNHSVLRKIYFGKVYWYRFLASLGTTYVGDHVDM
FT                   HSTKQKLIIGFFKKLGFAKLFPQNSVYRRLDNLYRKYDWKKQKYAGTINASLFAKEVMP
FT                   VEIWGEGVEKPFEDTFFKVPTEYDRYLKRLYGENYLYEEPSDDEKKSHLGGH"
FT   gene            362962..363840
FT                   /locus_tag="SPT_0399"
FT   CDS_pept        362962..363840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0399"
FT                   /product="putative rhamnosyl transferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23300"
FT                   /protein_id="ACO23300.1"
FT                   /translation="MFCYIILHYKVLEETISCVKSIKEGNYNAKQIVIIDNFSNNGTGE
FT                   KLQELYESDLEIDVLINHENAGFARGNNVAYQFAKEKYNPDFMVIMNNDIEIETENFEK
FT                   IVTDIYREEKFHLLGPDIFSTTYQLHQNPKRLTHYTYGEVKALNEKFKKGSQVSLALKI
FT                   KCWLKASKVLRTAIYQNRRKKGSVDYRKQVENPILHGSFIVYSRDFIEKEEYAFNPNTF
FT                   FYYETEILDYEAELKGYKRIYTPKIRVLHHQNVATNQVYTNLLEKTLFSNKCNFKSTSY
FT                   FLKLMKENEDV"
FT   gene            363841..365178
FT                   /locus_tag="SPT_0400"
FT   CDS_pept        363841..365178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0400"
FT                   /product="polysaccharide polymerase Cps19aI"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22615"
FT                   /protein_id="ACO22615.1"
FT                   /translation="MSYLFLLCLTLFLLTIFYFFAFIQDLIAPPVVMSVMFLISSVFAL
FT                   VNSKNWNIEYSGIAYILIISGIIIFSIPLMALKSPNFNTEVKIADRLIDIQFWKIALTI
FT                   IIDLFILYLYRKEIYNLVLSNGYTGSNIQWFFRNATSYEGELTVRTFIRVLIRVIDVSA
FT                   YIFGYTFINNFLIYRHKRPKDILLLVPLLIFISKTLISGGRQDIIKILIAYVIMMYIQQ
FT                   KRKVGWNRVISHKYIHLGFVGLIAGIPAFYYSLFLAGRSTTRTLFESVSTYLGGSIQHF
FT                   NQYIENPLDPGEVFGSETLVPILNILGEMGLVNYRSTIHLEFRTLGVTVGNVYTFFRRP
FT                   LHDFGLVGMYVFVFAVGAFFAIYYLVLRKKQVGFNLDIHTIIYSYVFYWIFLSSIEQYS
FT                   FTMISLYTLVFIVLVYFMAIFYWCTDFKRGKLIFKISDSSIKLKEE"
FT   gene            365201..366622
FT                   /locus_tag="SPT_0401"
FT   CDS_pept        365201..366622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0401"
FT                   /product="flippase Wzx"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23695"
FT                   /protein_id="ACO23695.1"
FT                   /translation="MNTKIKNIITSFSYVISSNLLIVLTSSLVVLIFPKIMGVTEYSYW
FT                   QLYIFYLTYIGFFHLGWIDGIYLKYGGLEYTNLDRKQFYSQMILFSSFLMLISLVLFTL
FT                   NLITVRDENARYIYNMAIISMIVTNLRTLYVYILQMTNRLKDSSVILISDRVLYVLLLF
FT                   MFIVFGWHEYKVMIWADILGRTFSLMLSFWICKDIVFQSLSKFILDFKESLDNIRVGIN
FT                   LMLSNIASSMIIGIVRMGIQWNWNIETFGKVSLTLSISNLLMTFINAIGLVIFPLIKRT
FT                   KTENLPKIYSNLRNALMLVMFAILLFYYPLKFILDIWLPAYKDALVFMALIFPMSVYEG
FT                   KMALVINTYLKAMRMEKDILKINALVMLTSMVVTLVTTLLLNNLGLTVVSIVILLALRS
FT                   IIAELILSKKLKISVKQDIALELLMTIIFISSSWYLSIWIAVIIYLLAYTLYLYLKHKD
FT                   IRMYIEYFKNHKKIS"
FT   gene            366686..367774
FT                   /locus_tag="SPT_0402"
FT   CDS_pept        366686..367774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0402"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="identified by match to protein family HMM PF02350;
FT                   match to protein family HMM TIGR00236"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24054"
FT                   /protein_id="ACO24054.1"
FT                   /translation="MKKIMLVFGTRPEAIKMCSLVNELRKQEDMKTVVCVTGQHKEMVS
FT                   PVLDLFGVQPDYDLEIMKANQNLFSITISILEKIKPVLEKEQPDIVLVHGDTTTTYAAA
FT                   LAAFYLGIKVGHVEAGLRTYNLQSPFPEEFNRQSTSIIANYHFAPTELAKENLIKEGRN
FT                   NIYVTGNTVIDALTTTVQKDYTHPDLDLNDGNRLILLTAHRRENLGEPMRHMFRAVKRV
FT                   LNEYDDVKVIYPIHKNPLVRETATEIFGDTERIQIIEPLDVLDFHNFMNHSYMILTDSG
FT                   GVQEEAPSLGKPVLVMRDTTERPEGVAAGTLKLVGTDEETIYQNFKMLLDDPEEYKKMS
FT                   QASNPYGNGDASKQIVRILRGI"
FT   gene            367813..368682
FT                   /gene="rfbA"
FT                   /locus_tag="SPT_0403"
FT   CDS_pept        367813..368682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="SPT_0403"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01207"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22551"
FT                   /protein_id="ACO22551.1"
FT                   /translation="MKGIILAGGSGTRLYPLTRAASKQLMPVYDKPMIYYPLSTLMLAG
FT                   IKDILIISTPQDLHRFQELLQDGSEFGLKLSYAEQPSPDGLAQAFIIGEEFISDDSVAL
FT                   ILGDNIYHGSGLSKMLQKAASKESGATVFGYHVKDPERFGVVEFDQDMKAISIEEKPEQ
FT                   PRSNYAVTGLYFYDNDVVEIAKSIKPSPRGELEITDVNKAYLDRGDLSVELMGRGFAWL
FT                   DTGTHESLLEASQYIETVQRMQNVQVANLEEIAYRMGYISREDVLALAQPLKKNEYGQY
FT                   LLRLIGEA"
FT   gene            368683..369279
FT                   /locus_tag="SPT_0404"
FT   CDS_pept        368683..369279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0404"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /note="identified by match to protein family HMM PF00908"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22353"
FT                   /protein_id="ACO22353.1"
FT                   /translation="MTDNFFGKTLAARKVEAIPGMLEFDIPVHRDNRGWFKENFQKEKM
FT                   LPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREGET
FT                   FGNTYQTVIDASKGIFVPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPS
FT                   LGIEWENIAEAEVSEADKHHPLLKDVKPLKKEDLE"
FT   gene            369289..370338
FT                   /gene="rfbB"
FT                   /locus_tag="SPT_0405"
FT   CDS_pept        369289..370338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="SPT_0405"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF04321; match to protein family HMM PF07993;
FT                   match to protein family HMM TIGR01181"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22393"
FT                   /protein_id="ACO22393.1"
FT                   /translation="MTEYKNIIVTGGAGFIGSNFVHYVYENFPDVHVTVLDKLTYAGNR
FT                   ANIEEILGNRVELVVGDIADAELVDKLAAQADAIVHYAAESHNDNSLNDPSPFIHTNFI
FT                   GTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETKYNPSSPYSS
FT                   TKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILSGIKPKLYGEGK
FT                   NVRDWIHTNDHSSGVWTILTKGQIGETYLIGADGEKNNKEVLELILKEMGQAADAYDHV
FT                   TDRAGHDLRYAIDASKLRDELGWKPEFTNFEAGLKATIKWYTDNQEWWKTEKEAVEANY
FT                   AKTQEIITV"
FT   gene            370404..371255
FT                   /gene="rfbD"
FT                   /locus_tag="SPT_0406"
FT   CDS_pept        370404..371255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="SPT_0406"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01214"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23627"
FT                   /protein_id="ACO23627.1"
FT                   /translation="MILITGANGQLGTELRYLLDERNEEYVAVDVAEMDIIDAEMVEKV
FT                   FEEVKPTLVYHCAAYTAVDAAEDEGKELDFAINVTGTKNVAKASEKHGATLVYISTDYV
FT                   FDGKKPVGQEWEVDDRPDPQTEYGRTKRMGEELVEKHVSNFYIIRTAWVFGNYGKNFVF
FT                   TMQNLAKTHKTLTVVNDQYGRPTWTRTLAEFITYLAENRKEFGYYHLSNDATEDTTWYD
FT                   FAVEILKDTDVEVKPVDSSQFPAKAKRPLNSTMSLAKAKATGFVIPTWQDALQEFYKQE
FT                   VR"
FT   gene            371296..372403
FT                   /pseudo
FT                   /locus_tag="SPT_0409"
FT                   /note="UDP-galactopyranose mutase, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts"
FT   gene            complement(372400..372522)
FT                   /locus_tag="SPT_0408"
FT   CDS_pept        complement(372400..372522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22710"
FT                   /protein_id="ACO22710.1"
FT                   /translation="MFILFENLFKPRQLPSATSKQYFEQPVASFLVCSLIFIEY"
FT   gene            372724..374706
FT                   /locus_tag="SPT_0410"
FT   CDS_pept        372724..374706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0410"
FT                   /product="oligopeptide binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23730"
FT                   /protein_id="ACO23730.1"
FT                   /translation="MKSSKLFALAGVTLLAATTLAACSGSGSSTKGEKTFSYIYETDPD
FT                   NLNYLTTAKAATANITSNVVDGLLENDRYGNFVPSMAEDWSVSKDGLTYTYTIRKDAKW
FT                   YTSEGEEYAAVKAQDFVTGLKYAADKKSDALYLVQESIKGLDAYVKGEIKDFSQVGIKA
FT                   LDDQTVQYTLNKPESFWNSKTTMGVLAPVNEEFLNSKGDDFAKATDPSSLLYNGPYLLK
FT                   SIVTKSSVEFAKNPNYWDKDNVHIDKVKLSFWDGQDTSKPAENFKDGSLTAARLYPTSA
FT                   SFAELEKSMKDNIVYTQQDSITYLVGTNIDRQSYKYTSKTSDEQKASTKKALLNKDFRQ
FT                   AIAFGFDRTAYASQLNGQTGASKILRNIFVPPTFVQADGKNFGDMVKEKLVTYGDEWKD
FT                   VNLADSQDGLYNPEKAKAEFAKAKSALQAEGVTFPIHLDMPVDQTATTKVQRVQSMKQS
FT                   LEATLGADNVVIDIQQLQKDEVNNITYFAENAAGEDWDLSDNVGWGPDFADPSTYLDII
FT                   KPSVGESTKTYLGFDSGEDNVAAKKVGLYDYEKLVTEAGDETTDVAKRYDKYAAAQAWL
FT                   TDSALIIPTTSRTGRPILSKMVPFTIPFALSGNKGTSEPVLYKYLELQDKAVTVDEYQK
FT                   AQEKWMKEKEESNKKAQEDLAKHVK"
FT   gene            375007..380310
FT                   /locus_tag="SPT_0411"
FT   CDS_pept        375007..380310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0411"
FT                   /product="endo-alpha-N-acetylgalactosaminidase"
FT                   /note="identified by match to protein family HMM PF00754;
FT                   match to protein family HMM PF04650; match to protein
FT                   family HMM TIGR01167; match to protein family HMM
FT                   TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22384"
FT                   /protein_id="ACO22384.1"
FT                   /translation="MNKGLFEKRCKYSIRKFSLGVASVMIGAAFFGTSPVLADSVQSGS
FT                   TANLPADLATALATAKENDGRDFEAPKVGEDQGSPEVTDGPKTEEELLALEKEKPAEEK
FT                   PKEDKPAAAKPETPKTVTPEWQTVEKKEQKGTVTIREEKGVRYNQLSSTAQNDNAGKPA
FT                   LFEKKGLTVDANGNATVDLTFKDDSEKGKSRFGVFLKFKDTNNNVFVGYDKDGWFWEYK
FT                   SPTTSTWYRGSRVAAPETGSTNRLSITLKSDGQLNASNNDVNLFDTVTLPAAVNDHLKN
FT                   EKKILLKAGSYGNDRTVVSVKTDNQEGVKADDTPAQKETGSVVDDSKVTYDTIQSKVLK
FT                   AVIDQAFPRVKEYTLNGHTLPGQVQQFNQVFINNHRITPEVTYKKINETTAEYLMKIRD
FT                   DAHLINAEMTVRLQVVDNQLHFDVTKIVNHNQVTPGQKIDDERKLLSSISFLGNALVSV
FT                   SSDQTGAKFDGATMSNNTHVSGDDHIDVTNPMKDLAKGYMYGFVSTDKLAAGVWSNSQN
FT                   SYGGGSNDWTRLTAYKETVGNANYVGIHSSEWQWEKAYKGIVFPEYTKELPRAKVVITE
FT                   DANADKKVDWQDGAIAYRSIMNNPKGWEKVKDITAYRIAMNFGSQAQNPFLMTLDGIKK
FT                   INLHTDGLGQGVLLKGYGSEGHDSGHLNYADIGKRIGGVEDFKTLIEKAKKYGAHLGIH
FT                   VNASETYPESKYFNEKILRKNPDGSYSYGWNWLDQGINIDAAYDLAHGRLARWEDLKKK
FT                   LGDGLDFIYVDVWGNGQSGDNGAWATHVLAKEINKQGWRFAIEWGHGGEYDSTFHHWAA
FT                   DLTYGGYTNKGINSAITRFIRNHQKDAWVGDYRSYGGAANYPLLGGYSMKDFEGWQGRS
FT                   DYNGYVTNLFAHDVMTKYFQHFTVSKWENGTPVTMTDNGSTYKWTPEMRVELVDADNNK
FT                   VVVTRKSNDVNSPQYRERTVTLNGRVIQDGSAYLTPWNWDANGKKLPTDKEKMYYFNTQ
FT                   TGATTWTLPSDWAESKVYLYKLTDQGKTEEQELTVKDGKITLDLLANQPYVLYRSKQTN
FT                   PEMSWSEGMHIYDQGFNSGTLKHWTISGDASKAEIVKSQGANDMLRIQGNKEKVSLTQK
FT                   LTGLKPNTKYAVYVGVDNRSNAKASITVNTGEKEVTTYTNKSLALNYVKAYAHNTRRDN
FT                   ATVDDTSYFQNMYAFFTTGSDVSNVTLTLSREAGDQATYFDEIRTFENNSSMYGDKHDT
FT                   GKGTFKQDFENVAQGIFPFVVGGVEGVEDNRTHLSEKHDPYTQRGWNGKKVDDVIEGNW
FT                   SLKTNGLVSRRNLVYQTIPQNFRFEAGKTYRVTFEYEAGSDNTYAFVVGKGEFQSGRRG
FT                   TQASNLEMHELPNTWTDSKKAKKATFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANF
FT                   RGYNDFMMDNLQIEEITLTGKMLTENALKNYLPTVAMTNYTKESMDALKEAVFNLSQAD
FT                   DDISVEEARAEIAKIEALKNALVQKKTALVADDFESLDAPAQPGEGLENAFDGNLSSLW
FT                   HTSWGGGDVGKPATMVLKEPTEITGLRYVPRGSGSNGNLRDVKLVVTDESGKEHTFTTT
FT                   DWPDNNKSKDIDFGKTIKAKKIVLTGTKTYGDGGDKYQSAAELIFTRPQVAETPLDLSG
FT                   YEAALAKAQKLTDKDNQEEVASVQASMKYATDNHLLTERMVEYFADYLNQLKDSATKPD
FT                   APTVEKPEFKLSSLASDQGKTPDYKQEIDRPETPEQILPATGESQSDTALFLAGVSLAL
FT                   SALFVVKTKKD"
FT   gene            complement(380476..382635)
FT                   /locus_tag="SPT_0412"
FT   CDS_pept        complement(380476..382635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0412"
FT                   /product="penicillin-binding protein 1a"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912; match to protein
FT                   family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23867"
FT                   /protein_id="ACO23867.1"
FT                   /translation="MNKQTILRIAKYVSICFLTLFITAVMLGGGIFLYYVSKAPALSES
FT                   KLVATTSSKIFDSKNELIADLGSERRVNAQANEIPTDLVKAIVSIEDHRFFDHRGVDTI
FT                   RIIGAFLRNLQNNSLQGGSTLTQQLIKLTYFSTSTSDQTISRKAQEAWLAVQLEQKATK
FT                   QEILTYYVNKVYMSNGNYGMQTAAQNYYGKDLRELSLPQLALLAGMPQAPNQYDPYSHP
FT                   EAALDRRNLVLSEMKGQGYISAEQYEKAINTPITDGLQSLKSVNSYPAYMDNYLKEVID
FT                   QVEQETGYNLLTTGMDVYTNVDQEAQKHLWDIYNSDQYVSYPDDDLQVASTVVDVSNGK
FT                   VIAQLGARHQASNVSFGTNQAVETNRDWGSSMKPITDYAPALEYGVYDSTASIVHDVPY
FT                   NYPGTDTPLYNWDHVYFGNITIQYALQQSRNVTAVETLNKVGLDRAKTFLNGLGIDYPS
FT                   MHYANAISSNTTESNKKYGASSEKMAAAYAAFANGGIYHKPMYINKIVFSDGSEKEFSD
FT                   AGTRAMKETTAYMMTEMMKTVLTYGTGRGAYLPWLPQAGKTGTSNYTDEEIEKYIKNTG
FT                   YVAPDEMFVGYTRKYSMAVWTGYSNRLTPIVGDGFLVAAKVYRSMMTYLSEGSNPEDWN
FT                   IPEGLYRNGEFVFKNGARSTWSSPAPQQPPSTESSSSSSDSSTSQSSSTTPSTNNSTTT
FT                   NPNNNTQQSNTTPDQQNQNPQPAQP"
FT   gene            complement(382632..383228)
FT                   /gene="recU"
FT                   /locus_tag="SPT_0413"
FT   CDS_pept        complement(382632..383228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="SPT_0413"
FT                   /product="recombination protein U"
FT                   /note="identified by match to protein family HMM PF03838;
FT                   match to protein family HMM TIGR00648"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23541"
FT                   /db_xref="GOA:C1CPN7"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPN7"
FT                   /protein_id="ACO23541.1"
FT                   /translation="MVNYPHKLSSQKRQPSLSQPKNFANRGMSFEKMINATNDYYLSQG
FT                   LAVIHKKPTPIQIVRVDYPQRSRAKIVEAYFRQASTTDYSGVYNGYYIDFEAKETKQKR
FT                   AIPMKNFHPHQIQHMEQILAQQGICFVLLHFSSQQETYLLPAYDLIRFYHQDKGQKSMP
FT                   LGYIREYGYEIKAGAFPQIPYLNVIKEHLLGGKTR"
FT   gene            383295..383822
FT                   /locus_tag="SPT_0414"
FT   CDS_pept        383295..383822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06908"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24133"
FT                   /protein_id="ACO24133.1"
FT                   /translation="MATALVLGYSAFDLGLFSDKDPRLKLIKKAIRKDLEAMAADGVSW
FT                   LVFTGTLGFEYWVLEVAQEMKTEYGFQLATIFAFETHGENWNEGNQMKLSRFKQVDFVK
FT                   YAYPRYEHKGQLRDYQQFLLENTTSSYLFYDEENETKLAYFYQKMKNQEDYFIKRLTFD
FT                   QLNELAENFSEN"
FT   gene            383892..384233
FT                   /locus_tag="SPT_0415"
FT   CDS_pept        383892..384233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0415"
FT                   /product="cell division initiation protein"
FT                   /note="identified by match to protein family HMM PF05103"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22366"
FT                   /db_xref="GOA:C1CPN9"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPN9"
FT                   /protein_id="ACO22366.1"
FT                   /translation="MTSIIFSAKDIFEQEFGREVRGYSKVEVDEFLDDVIKDYETYAAL
FT                   VKSLRQEIADLKEELTRKPQVSSAPSPSHPDPIDVAASSSMTNFDILKRLNRLEKEVFG
FT                   KQILDNTDL"
FT   gene            384291..384629
FT                   /locus_tag="SPT_2269"
FT   ncRNA           384291..384629
FT                   /locus_tag="SPT_2269"
FT                   /product="bacterial RNase P, class B"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            384719..385876
FT                   /locus_tag="SPT_0416"
FT   CDS_pept        384719..385876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0416"
FT                   /product="methyltransferase"
FT                   /note="identified by match to protein family HMM PF01170"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22511"
FT                   /protein_id="ACO22511.1"
FT                   /translation="MKKEFNLIATVAAGLEAVVGREVRELGYDCQVENGRVRFQGDVRA
FT                   IIETNLWLRAADRIKIIVGTFPAKTFEELFQGVFALDWENYLPLGARFPISKAKCVKSK
FT                   LHNEPSVQAISKKAVVKKLQKHYARPEGVPLMENGPEFKIEVSILKDVATVMIDTTGSS
FT                   LFKRGYRTEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAVMIARKMAPG
FT                   LRRSFAFEEWNWVSDRLIQEVRTEAAKKVDRELELDIMGCDIDARMVEIAKANAQAAGV
FT                   AGDITFKQMRVQDLRSDKINGVIISNPPYGERLSDDAGVTKLYSEMGQVFAPLKTWSKF
FT                   ILTSDEAFESKYGSQADKKRKLYNGTLKVDLYQYFGQRVKRQEVK"
FT   gene            385889..387283
FT                   /locus_tag="SPT_0417"
FT   CDS_pept        385889..387283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22637"
FT                   /protein_id="ACO22637.1"
FT                   /translation="MSKKRRNRHKKEGQEPQFDFDEAKELTVGQAIRKNEEVEAGVLSE
FT                   DSILDKYVKQHRDEIEADKFATRQYKKEELVETQSLDDLIQEMREAVEESEAYSEEVPS
FT                   SEDILPPLPLDDEEQGLDPLLLEDENPTEMTEEVEEEQNLSRLEQEESEKKSKKGFVLT
FT                   ALALVSVIICVSAYYVYRQVNRSTKEIETSQSTTANQSDVDDFNTLYDAFYTDSNKTAL
FT                   KNSQFDKLSQLKTLLDKLEGSREHTLAKSKYDSLATQIKAIQDVNAQFEKPAIVDGVLD
FT                   TNAKAKSDAKFTDIKTGNTELDKVLDKAISLGKSQQTSTSSSSSSETSSSSTSQTSSNT
FT                   TSETSPSSSNETRSSRSEVNMGLSSAGVAVQRSASRVAYNQSAIDDSNNSAWDFADGVL
FT                   EQILATSRSRGYITGDQYILERVNIVNGNGYYNLYKPDGTYLFTLNCKTGYFVGNGAGH
FT                   ADDLDY"
FT   gene            387359..388783
FT                   /gene="gnd"
FT                   /locus_tag="SPT_0418"
FT   CDS_pept        387359..388783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="SPT_0418"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="identified by match to protein family HMM PF00393;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM TIGR00873"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24153"
FT                   /protein_id="ACO24153.1"
FT                   /translation="MTKANFGVVGMAVMGRNLALNIESRGYTVAIYNRSKEKTEDVIAC
FT                   HPEKNFVPSYDVESFVNSIEKPRRIMLMVQAGPGTDATIQALLPHLDKGDILIDGGNTF
FT                   YKDTIRRNEELANSGINFIGTGVSGGEKGALEGPSIMPGGQKEAYELVADVLEEVSAKA
FT                   PEDGKPCVTYIGPDGAGHYVKMVHNGIEYGDMQLIAESYDLMQHLLGLSAEDMAEIFTE
FT                   WNKGELDSYLIEITADILSRKDDEGQDGPIVDYILDAAGNKGTGKWTSQSSLDLGVPLS
FT                   LITESVFARYISTYKEERVHASKVLPKPAAFNFEGDKAELIEKIRQALYFSKIISYAQG
FT                   FAQLRVASKENNWNLPFADIASIWRDGCIIRSRFLQKITDAYNRDADLANLLLDEYFLD
FT                   VTAKYQQAVRDIVALAVQAGVPVPTFSAAITYFDSYRSADLPANLIQAQRDYFGAHTYQ
FT                   RKDKEGTFHYSWYDEK"
FT   gene            388795..389484
FT                   /locus_tag="SPT_0419"
FT   CDS_pept        388795..389484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0419"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22773"
FT                   /protein_id="ACO22773.1"
FT                   /translation="MGKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQT
FT                   DYDLILLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKP
FT                   VLIENLVARISAIFRGRDFIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALTRREY
FT                   DLLATLMGSKKVLTREQLLESVWKYESATETNIVDVYIRYLRSKLDVKGQKSYIKTVRG
FT                   VGYTMQE"
FT   gene            389582..390544
FT                   /locus_tag="SPT_0420"
FT   CDS_pept        389582..390544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0420"
FT                   /product="choline-binding protein F"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23455"
FT                   /protein_id="ACO23455.1"
FT                   /translation="MKILKKMMQVLLAVFFFGLLATNTVFANTTGGRFVDKDNRKYYVK
FT                   DDHKAIYWHKIDGKTYYFGDGGEMVVGWQYLEIPGTGYRDNLFDNQPVNEIGLQEKWYY
FT                   FGQDGALLEQTDKQVLEAKTSENTGKVYGEQYPLSAEKRTYYFDNNYVVKTGWIYEDGN
FT                   WYYLNKLGNFGDDSYNPLPIGEVAKGWTQDFHVTIDIDRSKPAPWYYLDASGKMLTDWQ
FT                   KVNGKWYYFGSSGSMATGWKYVRGKWYYLDNKNGDMKTGWYQDGSTWYYLDPSNGDMKI
FT                   GWTKVNGKWYYLNSNGAMVTGSQTIDGKVYNFASSGEWI"
FT   gene            390563..391561
FT                   /locus_tag="SPT_0421"
FT   CDS_pept        390563..391561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0421"
FT                   /product="choline binding protein J"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24231"
FT                   /protein_id="ACO24231.1"
FT                   /translation="MKLLKKTMQAGLTVIFFGLLATNTVFADNSEGWQFVQENGRTYYK
FT                   KGDLKETYWLVIDGKYYYFDSLSGEMVVGWQYIPFPSKGSTIGPYPNGIRLEGFPKSEW
FT                   YYFDKNGVLQEFVGWKTLEIKTKDSVGRKYGEKREDSEDKEEKRYYTNYYFNQNHSLET
FT                   GWLYDQSNWYYLAKTEINGENYLGGERRAGWINDDSTWYYLDPTTGIMQTGWQYLGNKW
FT                   YYLRSSGAMATGWYQEGTTWYYLDQPNGDMKTGWQNLGNKWYYLRSSGAMATGWYQDGS
FT                   TWYYLNAGNGDMKTGWFQVNGNWYYAYSSGALAVNTTVDGYSVNYNGEWVR"
FT   gene            complement(391679..392911)
FT                   /locus_tag="SPT_0422"
FT   CDS_pept        complement(391679..392911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0422"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22495"
FT                   /protein_id="ACO22495.1"
FT                   /translation="MKLFWTNNIYRQLLLNSCFSSFGDSIFYLAIINYVAQYNFAPLAI
FT                   LLISISEMVPLLSQLFLGILGDFQENRVKHALCIAKIKILLYAILTVFLVLSPFSLVSV
FT                   IMIVIINLISDTLSYLSAYMMNALYISVIKDNLHDAMGFRQSLMRVVRIVANLAGVFLI
FT                   NVMSIQTISLINTLTFVIAFLGLYVIRHTLYEVEKKIEMSHTALSFKKYFQHLKQSLAV
FT                   LLRLKDTVILLFLTTSMIAILDVSPRLIALRFIQQTLAQLSIGQLLALLSIIISCGAIL
FT                   GNMTSSNLFKNIRFTHLLVFCEISLLALITSILCQTYIVIFMTSFISSTIIGILSPRLQ
FT                   AAVFAHIPSDKMGTVGSALSTVDILAPSLLSLLALSIASGVSVQLALIFLYLILIALIF
FT                   CQWLVTFNTHN"
FT   gene            complement(392954..393373)
FT                   /locus_tag="SPT_0423"
FT   CDS_pept        complement(392954..393373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0423"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22274"
FT                   /protein_id="ACO22274.1"
FT                   /translation="MFYNDLHTFHTELKKLLEKVTSNTENLGNLQLSWCKGISGIILYL
FT                   CMYDCDGNKDIISKYQEFVFNHHLKMMTGYCHGITSLLQTTVYNQNKLLMKKIQQVILA
FT                   CSERDDHGLLMFQGDSGKADLFDFGIGSMGYIGVY"
FT   gene            complement(393441..393779)
FT                   /locus_tag="SPT_0424"
FT   CDS_pept        complement(393441..393779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0424"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22859"
FT                   /protein_id="ACO22859.1"
FT                   /translation="MTIRTTHTYEYQYSLLFGDAGYLWLLLHLFSISKNQYYLQLANVT
FT                   SKKLIENYDTLEEIDFALGKSDVLLSLIKYYQFTNDNTLKTFIHNSIWGNLSLFPTKRY
FT                   SQRKHFRL"
FT   gene            394649..394771
FT                   /locus_tag="SPT_0425"
FT   CDS_pept        394649..394771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0425"
FT                   /product="choline-binding protein F"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23416"
FT                   /protein_id="ACO23416.1"
FT                   /translation="MTTGWFQVNGRWYYAYSSGALAVNTTVDGYSVNYNGEWVQ"
FT   gene            394893..395771
FT                   /gene="mvk"
FT                   /locus_tag="SPT_0426"
FT   CDS_pept        394893..395771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvk"
FT                   /locus_tag="SPT_0426"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00549"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23987"
FT                   /protein_id="ACO23987.1"
FT                   /translation="MTKKVGVGQAHSKIILIGEHAVVYGYPAISLPLLEVEVTCKVVSA
FT                   ESPWRLYEEDTLSMAVYASLEYLDITEACVRCEIDSAIPEKRGMGSSAAISIAAIRAVF
FT                   DYYQADLPHDVLEILVNRAEMIAHMNPSGLDAKTCLSDQPIRFIKNVGFTELEMDLSAY
FT                   LVIADTGVYGHTREAIQVVQNKGKDALPFLHALGELTQQAEVAISQKDAEGLGQILSQA
FT                   HLHLKEIGVSSPEADFLVETTLSHGALGAKMSGGGLGGCIIALVTNLTHAQELAERLEE
FT                   KGAVQTWIESL"
FT   gene            395753..396706
FT                   /gene="mvaD"
FT                   /locus_tag="SPT_0427"
FT   CDS_pept        395753..396706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="SPT_0427"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR01240"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22701"
FT                   /protein_id="ACO22701.1"
FT                   /translation="MDREPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTE
FT                   TTLSPLPANVTADEFYINGQLQNEVEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGL
FT                   SSSSSGLSALVKACNAYFKLGLDRSQLAQEAKFASGSSSRSFYGPLGAWDKDSGEIYPV
FT                   ETDLKLAMIMLVLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDF
FT                   AKIGELTEKNALAMHATTKTASPAFSYLTDASYEAMAFVRQLREKGEACYFTMDAGPNV
FT                   KVFCQEKDLEHLSEIFGQRYRLIVSKTKDLSQDDCC"
FT   gene            396693..397700
FT                   /locus_tag="SPT_0428"
FT   CDS_pept        396693..397700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0428"
FT                   /product="phosphomevalonate kinase"
FT                   /EC_number="2.7.4.2"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR01220"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23172"
FT                   /protein_id="ACO23172.1"
FT                   /translation="MIAVKTCGKLYLAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYR
FT                   IYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQNLRPFSLAIYGKMEREGKKFGL
FT                   GSSGSVVVLVVKALLALYNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIAAEDLVLYQ
FT                   SFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQ
FT                   NINQNFLTSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEAS
FT                   QDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERIGHDDKS"
FT   gene            397684..398694
FT                   /gene="fni"
FT                   /locus_tag="SPT_0429"
FT   CDS_pept        397684..398694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fni"
FT                   /locus_tag="SPT_0429"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 2"
FT                   /EC_number="5.3.3.2"
FT                   /note="identified by match to protein family HMM PF01070;
FT                   match to protein family HMM TIGR02151"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22876"
FT                   /protein_id="ACO22876.1"
FT                   /translation="MTTNRKDEHILYALEQKSSYNSFDEVELIHSSLPLYNLDEIDLST
FT                   EFAGRKWDFPFYINAMTGGSNKGREINQKLAQVAETCGILFVTGSYSAALKNPTDDSFS
FT                   VKSSHPNLLLGTNIGLDKPVELGFQTVEEMNPVLLQVHVNVMQELLMPEGERKFRSWQS
FT                   HLADYSKQIPVPIVLKEVGFGMDAKTIERAYEFGVRTVDLSGRGGTSFAYIENRRSGQR
FT                   DYLNQWGQSTMQALLNAQEWKDKVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELV
FT                   ETYTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKVDYLLYGKLKEANDQMKKA"
FT   gene            398772..399470
FT                   /locus_tag="SPT_0430"
FT   CDS_pept        398772..399470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23555"
FT                   /protein_id="ACO23555.1"
FT                   /translation="MRKFKIFLFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYYT
FT                   GKEGNNLLLVAATILFFFIVMLNPFVILAIFVAVIYSLFLLYPMMNQEKEQTNLVFEEV
FT                   VTVKKEKNRWFGNLHHFSSYQTCQFDDINLFRFMGKDTIHLERVILTNHDNVIILRKIV
FT                   GTTKIIVPVDVEVSLSVNCLYGDLTFFNQPKRALRNEHYHQETKDYLKSNKSVKIFLTT
FT                   MIGDVEVVRG"
FT   gene            399467..400462
FT                   /locus_tag="SPT_0431"
FT   CDS_pept        399467..400462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0431"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22986"
FT                   /protein_id="ACO22986.1"
FT                   /translation="MKKQAYVIIALTSFLFVFFFSHSLLEILDFDWSIFLHDVEKTEKF
FT                   VFLLLVFSMSITCLLALFWRGIEELSLRKMQANLKRLLAGQEVVQVADPDLDASFKSLS
FT                   GKLNLLTEALQKAENHSLAQEEEIIEKERKRIARDLHDTVSQELFAAHMILSGISQQAL
FT                   KLDREKMQIQLQSVTAILETAQKDLRVLLLHLRPVELEQKSLIEGIQILLKELEDKSDL
FT                   RVSLKQNMTKLPKKIEEHIFRILQELISNTLRHAQASCLDVYLYQTDVELQLKVVDNGI
FT                   GFRLGSLDDLSYGLRNIKERVEDMAGTVQLLTAPKQGLAVDIRIPLLDKE"
FT   gene            400476..401108
FT                   /locus_tag="SPT_0432"
FT   CDS_pept        400476..401108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0432"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22390"
FT                   /protein_id="ACO22390.1"
FT                   /translation="MKILLVDDHEMVRLGLKSYFDLQDDVEVVGEASNGSQGIDLALEL
FT                   RPDVIVMDIVMPEMNGIDATLAILKEWPEAKILIVTSYLDNEKIMPVLDAGAKGYMLKT
FT                   SSADELLHAVSKVAAGELAIEQEVSKKVEYHRNHMELHEELTARERDVLQLIAKGYENQ
FT                   RIADDLFISLKTVKTHVSNILAKLEVSDRTQAAVYAFQHHLVGQDEF"
FT   gene            401109..401255
FT                   /locus_tag="SPT_0433"
FT   CDS_pept        401109..401255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0433"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23874"
FT                   /protein_id="ACO23874.1"
FT                   /translation="MSLADLLEELEAAKDSKKARSMEAYMRHQFSFLGIAVPERNKLYK
FT                   NIY"
FT   gene            401333..401587
FT                   /pseudo
FT                   /locus_tag="SPT_0434"
FT                   /note="DNA alkylation repair enzyme; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            401702..401878
FT                   /locus_tag="SPT_0435"
FT   CDS_pept        401702..401878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0435"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23240"
FT                   /protein_id="ACO23240.1"
FT                   /translation="MEKILLHNLNQTEFFINKAIGWTLRDYSKTNPTWVTCFIEKNKER
FT                   MAELSIKEASKYL"
FT   gene            402028..402942
FT                   /locus_tag="SPT_0436"
FT   CDS_pept        402028..402942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0436"
FT                   /product="choline binding protein G"
FT                   /note="identified by match to protein family HMM PF00089"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22693"
FT                   /protein_id="ACO22693.1"
FT                   /translation="MKKTVYKKLGISIIASTLLASQLSTVSALSVISSTGEEYEVSETL
FT                   QDSPGTNNFSLPNVSPTYGQYYTNQSEVIIGKNDLVKVKNTLQYPYSTSAYVESEFRGV
FT                   KNGKDVTYRGSANFIKDNVLITAAHNIYKHEFGKDAEELYVTPARTPNSVPFGRIKVKE
FT                   VRYLKEFRNLNSKDAREYDLALLILEEPIGAKLGTLGLPTSQKNLTGITVTITGYPSYN
FT                   FKIHQMYTDKKQVLSDDGMFLDYQVDTLEGASGSTVYDASNRVVGVHTLGDGANQINSA
FT                   VKLNERNLPFIYSVLKGYSLEGW"
FT   gene            403235..403600
FT                   /locus_tag="SPT_0437"
FT   CDS_pept        403235..403600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0437"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22321"
FT                   /protein_id="ACO22321.1"
FT                   /translation="MFLDSPKSLASYRVIGISDRVLEILKEYLLLEEGDYIFTNNGSPL
FT                   MITCFNYFLKNRFRKSEIKKDDFVLTAHVFRYSHISLLAELEVPITAIMDRVDYTNETK
FT                   ILSVYTHVTEKMKSNIT"
FT   gene            403794..405077
FT                   /gene="tig"
FT                   /locus_tag="SPT_0438"
FT   CDS_pept        403794..405077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SPT_0438"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24159"
FT                   /db_xref="GOA:C1CPR1"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPR1"
FT                   /protein_id="ACO24159.1"
FT                   /translation="MSVSFENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFR
FT                   KGHLPRPIFDKKFGEESLYQDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSMEKGQDW
FT                   VIAAEVVTKPEVKLGDYKNLEVSVDVEKEVTDADVEERIERERNNLAELVIKEAAAEDG
FT                   DTVVIDFVGSIDGVEFDGGKGENFSLGLGSGQFIPGFEDQLVGHSAGETVDVIVTFPED
FT                   YQAEDLAGKEAKFVTTIHEVKAKEVPALDDELAKDIDEEVETLADLKEKYRKELAAAKE
FT                   EAYKDAVEGAAIDTAVENAEIVELPEEMIHEEVHRSVNEFLGNLQRQGINPDMYFQITG
FT                   TTQEDLHNQYQAEAESRTKTNLVIEAVAKAEGFDASEEEIQKEVEQLAADYNMEVAQVQ
FT                   NLLSADMLKHDITIKKAVELITSTATVK"
FT   gene            complement(405125..407491)
FT                   /locus_tag="SPT_0439"
FT   CDS_pept        complement(405125..407491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0439"
FT                   /product="helicase, RecD/TraA family"
FT                   /note="identified by match to protein family HMM TIGR01448"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23606"
FT                   /protein_id="ACO23606.1"
FT                   /translation="MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTG
FT                   TMADVIEGEDYTFWGQIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLKTA
FT                   QKIVDTYGENTIDEILQHPEKLEGIVGLSAKNREAFVSTLRLNYGTEMILAKLANYGIP
FT                   NKLAFQIQDFYKEETLDVVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGL
FT                   VHSLFQACMETGDTYVEVRDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQID
FT                   TKIFDNSLFFAEEGIRSHLVRILEKGKQKSHDLETIQKHITTIEEELGIEYDNIQKQAI
FT                   CDAIQNKVFILTGGPGTGKTTVINGIIAVYALLEGLDLRKKSNLPILLAAPTGRAARRM
FT                   NELTGLPSATIHRHLGMTGDDDTSHLEDYLDTDFIIVDEFSMVDTWLANQLFSNISSNS
FT                   KILIVGDSDQLPSVSPGQVLADLLHIPLIPQTRLEKIYRQSEESTIVTLASQIRQGILP
FT                   ADFTQKKADRSYFEIASGHIPATIEKILGAALRNGIPARDIQVLAPMYRGTAGIDAINQ
FT                   LMQDLLNPPQKDQLSFEAPQCHYRKGDKVIHLVNDTEINVFNGDLGAITDLIPGKYTES
FT                   KQDEIVIDFDGNEVSYPRNEWYKIRLAYAMSIHKSQGSEFPVVILPITSASRRMLERNL
FT                   IYTAITRAKSKLILLGELQAFDHATQHIGTARKTYLVERFSDLLKNVEEKQQAVSETVT
FT                   SSASEQSYILTEENWDRIPAMIGITDTDLKEIFGK"
FT   gene            complement(407619..408233)
FT                   /gene="lepB1"
FT                   /locus_tag="SPT_0440"
FT   CDS_pept        complement(407619..408233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB1"
FT                   /locus_tag="SPT_0440"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22490"
FT                   /protein_id="ACO22490.1"
FT                   /translation="MNSFKNFLKEWGLFLLILSLLALSRIFFWSNVRVEGHSMDPTLAD
FT                   GEILFVVKHLPIDRFDIVVAHEEDGNKDIVKRVIGMPGDTIRYENDKLYINDKETDEPY
FT                   LADYIKRFKDDKLQSTYSGKGFEGNKGTFFRSIAQKAQAFTVDVNYNTNFSFTVPEGEY
FT                   LLLGDDRLVSSDSRHVGTFKAKDITGEAKFRFWPITRIGTF"
FT   gene            complement(408237..409118)
FT                   /gene="rnhC"
FT                   /locus_tag="SPT_0441"
FT   CDS_pept        complement(408237..409118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhC"
FT                   /locus_tag="SPT_0441"
FT                   /product="ribonuclease hiii"
FT                   /EC_number="3.1.26.-"
FT                   /note="identified by match to protein family HMM PF01351;
FT                   match to protein family HMM TIGR00716"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23076"
FT                   /db_xref="GOA:C1CPR4"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR024568"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPR4"
FT                   /protein_id="ACO23076.1"
FT                   /translation="MASITLTPSEKDIQAFLEHYQTSLAPSKNPYIRYFLKLPQATVSI
FT                   YTSGKILLQGEGAEKYASFFGYQAVEQTSGQNLPLIGTDEVGNGSYFGGLAVVAAFVTP
FT                   DQHDFLRKLGVGDSKTLTDQKIRQIAPILKEKIQHQALLLSPSKYNEVIGNRYNAVSVK
FT                   VALHNQAIYLLLQKGVQPEKIVIDAFTSAKNYDKYLAQETNRFSNPISLEEKAEGKYLA
FT                   VAVSSVIARDLFLENLENLGRELGYQLPSGAGTASDKVASQILQAYGMQGLNFCAKLHF
FT                   KNTEKAKKRLER"
FT   gene            409283..409507
FT                   /locus_tag="SPT_0442"
FT   CDS_pept        409283..409507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22851"
FT                   /protein_id="ACO22851.1"
FT                   /translation="MEEIAKVATEKYQAIKEQMPSADDETIALLLAVNCLSTQLSREIE
FT                   FDDKEQELEELRHKLVTCKQEQSKIEDSL"
FT   gene            409504..410052
FT                   /gene="cvpA"
FT                   /locus_tag="SPT_0443"
FT   CDS_pept        409504..410052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /locus_tag="SPT_0443"
FT                   /product="CvpA family protein"
FT                   /note="identified by match to protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23433"
FT                   /protein_id="ACO23433.1"
FT                   /translation="MISFLLLLVLVWGFYIGYRRGLLLQVYYLISAMASAFMAGQFYKG
FT                   LGEQFHLLLPYANSQEGQGTFFFPSDQLFQLDKVFYAGIGYLLVFGIVYSIGRLLGLLL
FT                   HLIPSKKLGGKLFQVSAGILSMLVTLFVLQMALTILATIPMAVIQNPLEKSIVAKHIIQ
FT                   SIPITTSWLKQIWVTNLIG"
FT   gene            410156..412492
FT                   /locus_tag="SPT_0444"
FT   CDS_pept        410156..412492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0444"
FT                   /product="MutS2 family protein"
FT                   /note="identified by match to protein family HMM PF00488;
FT                   match to protein family HMM PF01713; match to protein
FT                   family HMM TIGR01069"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24218"
FT                   /db_xref="GOA:C1CPR7"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPR7"
FT                   /protein_id="ACO24218.1"
FT                   /translation="MNKKILETLEFDKVKALFEPHLLTEQGLEQLRQLAPTAKADKIKQ
FT                   AFAEMKEMQALFVEQPHFTILSTKEIAGVCKRLEMGADLNIEEFLLLKRVLLASRELQS
FT                   FYANLENVSLEELALWFEKLHDFPQLQGNLQAFNDAGFIENFASEELARIRRKIHDSES
FT                   QVRDVLQDLLKQKAQMLTEGIVASRNGRQVLPVKNTYRNKIAGVVHDISASGNTVYIEP
FT                   REVVKLSEEIASLRADERYEMLRILQEISERVRPHATEIANDAWIIGHLDLIRAKVRFI
FT                   QERQAVVPQLSENQEIQLLHVCHPLVKNAVANDVHFGQDLTAIVITGPNTGGKTIMLKT
FT                   LGLTQVMAQSGLPILADRGSRVGIFEEIFADIGDEQSIEQSLSTFSSHMTNIVDILGKV
FT                   NQHSLLLLDELGAGTDPQEGAALAMAILEDLRLRQIKTMATTHYPELKAYGIETAFVQN
FT                   ASMEFDTATLRPTYRFMQGVPGRSNAFEIAKRLGLSEVIVGDASQQIDQDNDVNRIIEQ
FT                   LEEQTLESRKRLDNIREVEQENLKMNRALKKLYNELNREKETELNKAREQAAEIVDMAL
FT                   SESDQILKNLHSKSQLKPHEIIEAKAKLKKLAPEKVDLSKNKVLQKAKKKRAPKVGDDI
FT                   VVLSYGQRGTLTSQLKDGRWEAQVGLIKMTLEEKEFDLVQAQQEKPVKKKQVNVVKRTS
FT                   GRGPQARLDLRGKRYEEAMNELDIFIDQALLNNMAQVDIIHGIGTGVIREGVTKYLQRN
FT                   KHVKSFGYAPQNAGGSGATIVTFKG"
FT   gene            412835..414151
FT                   /locus_tag="SPT_0445"
FT   CDS_pept        412835..414151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0445"
FT                   /product="sodium:alanine symporter family protein"
FT                   /note="identified by match to protein family HMM PF01235;
FT                   match to protein family HMM TIGR00835"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22224"
FT                   /protein_id="ACO22224.1"
FT                   /translation="MLELLKSIDAFAWGPPLLILLVGTGIYLTIRLGLLQVLRLPKAFQ
FT                   LIFIQDKGHGDVSSFAALCTALASTVGTGNIIGVATAIKVGGPGALFWMWMAAFFGMAT
FT                   KYAEGLLAIKYRTKDDHGAVAGGPMHYILLGMGEKWRPLAVLFAVAGVLVALLGIGTFT
FT                   QVNSIAESIQNTTTISPAITALVLSVFVAIAVFGGLKSISKVSTTVVPFMAIIYILGTL
FT                   TVIFFNIGKIPGTIALVFTSAFSPLAAVGGFAGASVRMAIQNGVARGVFSNESGLGSAP
FT                   IAAAKTNEPVEQGLISMTGTFIDTLIICTLTGLTILVTGVWSGDLNGVALTQSAFSTVF
FT                   SHFGPALLTIFLVLFAFTTILGWNYYGERCFEFLFGVRFIWLYRVVFVLMVLLGGFIEL
FT                   DMVWIIADIVNALMALPNLIALLVLSPVVIAETKKYFDK"
FT   gene            414369..414917
FT                   /locus_tag="SPT_0446"
FT   CDS_pept        414369..414917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0446"
FT                   /product="macrophage infectivity potentiator protein"
FT                   /note="identified by match to protein family HMM PF02627;
FT                   match to protein family HMM TIGR00778"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23208"
FT                   /protein_id="ACO23208.1"
FT                   /translation="MTTFTIHTVESAPAEVKEILETVEKDNNGYIPNLIGLLANAPTVL
FT                   EAYQIVSSIHRRNSLTPVEREVVQITAAVTNGCAFCVAGHTAFSIKQIQMNDDLIQALR
FT                   NRTPIETDPKLDTLAKFTLAVINTKGRVGDEALSEFLEAGYTQQNALDVVFGVSLAILC
FT                   NYANNLANTPINPELQPYA"
FT   gene            415027..415926
FT                   /locus_tag="SPT_0447"
FT   CDS_pept        415027..415926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0447"
FT                   /product="exfoliative toxin A"
FT                   /note="identified by match to protein family HMM PF03595"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23632"
FT                   /protein_id="ACO23632.1"
FT                   /translation="MKKLPLVFSGCLLGLAGAGNLILDTLPVLSHLFSLTGLVLWIYFL
FT                   ILHLFNWKETKQELTKPPLLSGMATFPMAGMILSTYVFRVFSYLPLVAQGIWWFSFLLD
FT                   LTLIAGFTIKFACPGRRVHATPSWTVLYVGIAVAALTYPLVGIIEIAYATLSFGFLLTF
FT                   YLYPLIYSDLKKHPLPLALLGQEGIYCAPFSLLLASLVRVGGTSLPTWVLIVMILASQS
FT                   FFFFVLTRLPNILKQGFQPAFSALTFPTIITATSLKMTQGILKLPFLDYLVLAETIICL
FT                   TILFFVLGAYLIWLRKKV"
FT   gene            complement(415951..417225)
FT                   /gene="serS"
FT                   /locus_tag="SPT_0448"
FT   CDS_pept        complement(415951..417225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="SPT_0448"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23992"
FT                   /db_xref="GOA:C1CPS1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPS1"
FT                   /protein_id="ACO23992.1"
FT                   /translation="MLDIKRIRTDFEAVAEKLATRGVDAAVLNEMKEIDAKRRNILVKV
FT                   ETLKAERNTVSAEIAQAKRNKENTDDKIAAMQNLSAEVKALDAELAEIDAKLTEFTTTL
FT                   PNIPADSVPVGADEDDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARF
FT                   LFYKGLGARLERAIYNFMLDEHGKEGYTEVITPYIVNHDSMFGTGQYPKFKEDTFELSD
FT                   TNFVLIPTAEVPLTNYYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFH
FT                   KVEMVKFAKPEESYEELEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWI
FT                   PAQNNYREISSCSNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENY
FT                   QNEDGSVTIPEALRPYMGGAEVIKP"
FT   gene            complement(417439..417810)
FT                   /locus_tag="SPT_0449"
FT   CDS_pept        complement(417439..417810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0449"
FT                   /product="ManO"
FT                   /note="identified by match to protein family HMM PF06115"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24060"
FT                   /protein_id="ACO24060.1"
FT                   /translation="MAQSLNKTVLLSTTGTSYLSIAGKVGKFLVGDQALEFYPDVNVEQ
FT                   FIQIPWSHINQIGANVTGCKISRHFEVFTDKGKFLFASKDSGAILKIAREKLGNDKVVK
FT                   LPTLIQTISQKFKNLFAKK"
FT   gene            complement(417813..419177)
FT                   /locus_tag="SPT_0450"
FT   CDS_pept        complement(417813..419177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0450"
FT                   /product="aspartate kinase"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24030"
FT                   /protein_id="ACO24030.1"
FT                   /translation="MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAED
FT                   TKVTDALIKYYRDYVAGNDISKSQSWIIDRYAAMVSELGLKPAVLEKISKSIHALATLP
FT                   IEENEFLYDTFLAAGENNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARIIPSS
FT                   YDKIEELTNTNEVLVIPGFFGVTKENQICTFSRGGSDITGSIIAAGVKADLYENFTDVD
FT                   GIFAAHPGIIHQPHSIPELTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPD
FT                   HPGTRIVLKHSNDEFPVVGIAGDSGFVSINMSKYLMNREVGFGRKVLQILEELNIGWEH
FT                   MPTGIDDLSIILRSRQLTPIKEEEILRQLVQKAKVDHAEIEHDLSIIMIVGEKMKSHIG
FT                   VTATATRALSENKINIQMMSQGSSEVSIMFVVNKDQEKAAIKALYNAFFGESKED"
FT   gene            complement(419355..419510)
FT                   /locus_tag="SPT_0451"
FT   CDS_pept        complement(419355..419510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23304"
FT                   /protein_id="ACO23304.1"
FT                   /translation="MFHQGSFLFYKQFILFENLFKPRQLPSATSKQYFELTSSSFLVCS
FT                   LIFIEC"
FT   gene            419502..420287
FT                   /locus_tag="SPT_0452"
FT   CDS_pept        419502..420287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0452"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22802"
FT                   /protein_id="ACO22802.1"
FT                   /translation="MEHIIYQLEEDLAILTLNRPEVANGFHIPMCEEILEALTLAEENP
FT                   AVHFILINANGKVFSVGGDLVEMKRAVDEDDIPSLTKIAELVNTISYKIKQIAKPVLME
FT                   VDGAVAGAAANMAVAADFCLATDKAKFIQAFVGVGLAPDAGGIHLLSRSIGVTRAAQLA
FT                   MTGEALTAEKALEWGLVYRVSEAEKLEKTREQLLKKLRRASSNSYAAIKKLVWESQFKD
FT                   WQGYATLELNLQKSLAQTEDFKEGVRAHSERRRPKFTGK"
FT   gene            420381..420815
FT                   /locus_tag="SPT_0453"
FT   CDS_pept        420381..420815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0453"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01047;
FT                   match to protein family HMM PF03965"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23167"
FT                   /protein_id="ACO23167.1"
FT                   /translation="MDYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVIG
FT                   KAPDVTPSQVSKELMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGHLIHR
FT                   LHKRFHKAMVEKIIDGMSEEEIAVMGKGLTNLYQFLEDLK"
FT   gene            420815..421789
FT                   /locus_tag="SPT_0454"
FT   CDS_pept        420815..421789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0454"
FT                   /product="beta-ketoacyl-acyl carrier protein synthase III"
FT                   /note="identified by match to protein family HMM PF08541;
FT                   match to protein family HMM PF08545; match to protein
FT                   family HMM TIGR00747"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24249"
FT                   /db_xref="GOA:C1CPS7"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPS7"
FT                   /protein_id="ACO24249.1"
FT                   /translation="MAFAKISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHI
FT                   SRTESTSDLATEVAKKLMAKAGITGEELDFIILATITPDSMMPSTAARVQANIGANKAF
FT                   AFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSETLSKAVDWSDRSTAVLFGDGAGG
FT                   VLLEASEQEHFLAESLNSDGSRSECLTYGHSGLHSPFSDQESADSFLKMDGRTVFDFAI
FT                   RDVAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEYGNTS
FT                   AASIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI"
FT   gene            421849..422073
FT                   /locus_tag="SPT_0455"
FT   CDS_pept        421849..422073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0455"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23554"
FT                   /protein_id="ACO23554.1"
FT                   /translation="MAVFEKVQEIIVEELGKDASEVTLESTFDDLDADSLDLFQVISEI
FT                   EDAFDIQIEAENDLKTVGDLVAYVEEQAK"
FT   gene            422192..423166
FT                   /locus_tag="SPT_0456"
FT   CDS_pept        422192..423166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0456"
FT                   /product="putative enoyl-(acyl-carrier-protein) reductase
FT                   II"
FT                   /EC_number="1.3.-.-"
FT                   /note="identified by match to protein family HMM PF03060;
FT                   match to protein family HMM TIGR03151"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22955"
FT                   /protein_id="ACO22955.1"
FT                   /translation="MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGN
FT                   APKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKYME
FT                   RFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATAISI
FT                   PVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISA
FT                   QHFGHAVRAIKNQLTRDFELAEKDAFKQEDPDLEIFEQMGAGALAKAVVHGDVDGGSVM
FT                   AGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWTGVVRND"
FT   gene            423159..424079
FT                   /gene="fabD"
FT                   /locus_tag="SPT_0457"
FT   CDS_pept        423159..424079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="SPT_0457"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="identified by match to protein family HMM PF00698;
FT                   match to protein family HMM TIGR00128"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22361"
FT                   /protein_id="ACO22361.1"
FT                   /translation="MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLR
FT                   YLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALD
FT                   FEDAVALVAKRGAYMEEATPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPA
FT                   QIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTALLEPASQKLAETLAQVSFSDF
FT                   TCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGF
FT                   VKKIDQTAHLAHVEDQASLVALLEK"
FT   gene            424113..424844
FT                   /gene="fabG"
FT                   /locus_tag="SPT_0458"
FT   CDS_pept        424113..424844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="SPT_0458"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM PF08659; match to protein family HMM TIGR01830"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22368"
FT                   /protein_id="ACO22368.1"
FT                   /translation="MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELL
FT                   SEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEAD
FT                   FEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGF
FT                   TKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTV
FT                   FLAGQDYLTGQVIAIDGGLSM"
FT   gene            424866..426101
FT                   /gene="fabF"
FT                   /locus_tag="SPT_0459"
FT   CDS_pept        424866..426101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="SPT_0459"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 2"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801; match to protein
FT                   family HMM TIGR03150"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24123"
FT                   /protein_id="ACO24123.1"
FT                   /translation="MKLNRVVVTGYGVTSPIGNTPEEFWNSLATGKIGIGGITKFDHSD
FT                   FDVHNAAEIQDFPFDKYFVKKDTNRFDNYSLYALYAAQEAVNHANLDVEALNRDRFGVI
FT                   VASGIGGIKEIEDQVLRLHEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSINTA
FT                   CSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAIAGFQALTALSTTEDPTRASIPF
FT                   DKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQGAIK
FT                   AIKLALEEAEISPEQVAYVNAHGTSTPANEKGESGAIVAVLGKEVPVSSTKSFTGHLLG
FT                   AAGAVEAIVTIEAMRHNFVPMTAGTSEVSDYIEANVVYGQGLEKEIPYAISNTFGFGGH
FT                   NAVLAFKRWENR"
FT   gene            426104..426589
FT                   /gene="accB"
FT                   /locus_tag="SPT_0460"
FT   CDS_pept        426104..426589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="SPT_0460"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00364;
FT                   match to protein family HMM TIGR00531"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23938"
FT                   /protein_id="ACO23938.1"
FT                   /translation="MNLNDIKDLMTQFDQSSLREFSYKNGTDELQFSKNEARPVPEVAT
FT                   QVAPAPVLATPSPVAPTSAPAETVAEEVPAPAEASVATEGNLVESPLVGVVYLAAGPDK
FT                   PAFVTVGDSVKKGQTLVIIEAMKVMNEIPAPKDGVVTEILVSNEEMVEFGKGLVRIK"
FT   gene            426586..427008
FT                   /gene="fabZ"
FT                   /locus_tag="SPT_0461"
FT   CDS_pept        426586..427008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="SPT_0461"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF07977;
FT                   match to protein family HMM TIGR01750"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23353"
FT                   /db_xref="GOA:C1CPT4"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPT4"
FT                   /protein_id="ACO23353.1"
FT                   /translation="MIDIQGIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFFN
FT                   GHFPQYPVMPGVLIMEALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQLVM
FT                   TATFVKRRGTIAVVEAKAEVDGKLAASGILTFAIGN"
FT   gene            427020..428387
FT                   /gene="accC"
FT                   /locus_tag="SPT_0462"
FT   CDS_pept        427020..428387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="SPT_0462"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF02785; match to protein
FT                   family HMM PF02786; match to protein family HMM PF08443;
FT                   match to protein family HMM TIGR00514"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23223"
FT                   /protein_id="ACO23223.1"
FT                   /translation="MFRKILIANRGEIAVRIIRAARELGIATVAVYSTADKEALHTLLA
FT                   DEAVCIGPGKATESYLNINAVLSAAVLTEAEAIHPGFGFLSENSKFATMCEEVGIKFIG
FT                   PSGHVMDMMGDKINARAQMIKAGVPVIPGSDGEVHNSEEALIVAEKIGYPVMLKASAGG
FT                   GGKGIRKVEKPDDLVSAFETASSEAKANYGNGAMYIERVIYPARHIEVQILGDEHGHVI
FT                   HLGERDCSLQRNNQKVLEESPSIAIGKTLRHEIGAAAVRAAEFVGYENAGTIEFLLDEA
FT                   SSNFYFMEMNTRVQVEHPVTEFVSGVDIVKEQICIAAGQPLSVKQEDIVLRGHAIECRI
FT                   NAENPAFNFAPSPGKITNLYLPSGGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRF
FT                   DALMKMQRALYELEIEGVQTNADFQLDLISDRNVIAGDYDTSFLMETFLPKYQEKE"
FT   gene            428424..429290
FT                   /gene="accD"
FT                   /locus_tag="SPT_0463"
FT   CDS_pept        428424..429290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="SPT_0463"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM TIGR00515"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22633"
FT                   /protein_id="ACO22633.1"
FT                   /translation="MALFSKKDKYIRINPNRSVREKPQAKPEVPDELFSQCPGCKHTIY
FT                   QKDLGSERICPHCSYTFRISAQERLALTIDMGTFKELFTGIESKDPLHFPGYQKKLASM
FT                   REKTGLHEAVVTGTALIKGQTVALGIMDSNFIMASMGTVVGEKITRLFEYATVEKLPVV
FT                   LFTASGGARMQEGIMSLMQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDI
FT                   ILAEPQSLVGFAGRRVIENTVRESLPEDFQKAEFLLEHGFVDAIVKRRDLPDTIASLVR
FT                   LHGGSPR"
FT   gene            429287..430054
FT                   /gene="accA"
FT                   /locus_tag="SPT_0464"
FT   CDS_pept        429287..430054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SPT_0464"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF03255;
FT                   match to protein family HMM TIGR00513"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22652"
FT                   /db_xref="GOA:C1CPT7"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPT7"
FT                   /protein_id="ACO22652.1"
FT                   /translation="MNIAKIVREAREQSRLTTLDFATGIFDEFIQLHGDRSFRDDGAVV
FT                   GGIGWLGDQAVTVVGIQKGKSLQDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVVTFI
FT                   NTAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADRVWML
FT                   ENSIYAILSPEGFASILWKDGTRAMEAAELMKITSHELLEMDVVDKVISEVGLSSKELI
FT                   KSVKKELQTELARLSQKPLEELLEERYQRFRKY"
FT   gene            430317..430502
FT                   /locus_tag="SPT_0465"
FT   CDS_pept        430317..430502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0465"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24138"
FT                   /protein_id="ACO24138.1"
FT                   /translation="MTGTETFTVISTEDLEQTSSGLAVWEDGYSRWLYYREFAPYMRQG
FT                   ALNSYIDAWKYGFRTG"
FT   gene            430559..430693
FT                   /locus_tag="SPT_0466"
FT   CDS_pept        430559..430693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0466"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23559"
FT                   /protein_id="ACO23559.1"
FT                   /translation="MLIILLSTYLPQTIGLYVTIILGLGADVYSLILTVGLVGSFLFY"
FT   gene            430843..430971
FT                   /locus_tag="SPT_0467"
FT   CDS_pept        430843..430971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22464"
FT                   /protein_id="ACO22464.1"
FT                   /translation="MVLSNGQPTFLSTILSFVLPVIIGPVFEETLDRGYFMNTFFP"
FT   gene            complement(431270..431692)
FT                   /gene="nusB"
FT                   /locus_tag="SPT_0468"
FT   CDS_pept        complement(431270..431692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SPT_0468"
FT                   /product="transcription antitermination factor NusB"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM TIGR01951"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22327"
FT                   /db_xref="GOA:C1CPU1"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPU1"
FT                   /protein_id="ACO22327.1"
FT                   /translation="MTSPLLESRRQLRKCAFQALMSLEFGTDVETACRFAYTHDREDTD
FT                   VQLPAFLIDLVSGVQAKKEELDKQITQHLKAGWTIERLTLVERNLLRLGVFEITSFDTP
FT                   QLVAVNEAIELAKDFSDQKSARFINGLLSQFVTEEQ"
FT   gene            complement(431685..432074)
FT                   /locus_tag="SPT_0469"
FT   CDS_pept        complement(431685..432074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0469"
FT                   /product="general stress protein, Gls24 family"
FT                   /note="identified by match to protein family HMM PF03780"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23921"
FT                   /protein_id="ACO23921.1"
FT                   /translation="MGIEEQLGEIVIAPRVLEKIIAIATAKVEGVHSFSNRSVSDTLSK
FT                   LSLGRGIYLKNVDEELTADIYLYLEYGVKVPKVAVAIQKAVKDAVRNMADVELAAINIH
FT                   VAGIVPDKTPKPELKDLFDEDFLND"
FT   gene            complement(432096..432656)
FT                   /gene="efp"
FT                   /locus_tag="SPT_0470"
FT   CDS_pept        complement(432096..432656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="SPT_0470"
FT                   /product="translation elongation factor P"
FT                   /note="identified by match to protein family HMM PF01132;
FT                   match to protein family HMM PF08207; match to protein
FT                   family HMM PF09285; match to protein family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23442"
FT                   /db_xref="GOA:C1CPU3"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPU3"
FT                   /protein_id="ACO23442.1"
FT                   /translation="MIEASKLKAGMTFETADGKLIRVLEASHHKPGKGNTIMRMKLRDV
FT                   RTGSTFDTSYRPEEKFEQAIIETVPAQYLYKMDDTAYFMNTETYDQYEIPVVNVENELL
FT                   YILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSIKGATVTGSGKPATMETGLVVNV
FT                   PDFIEAGQKLVINTAEGTYVSRA"
FT   gene            432824..433009
FT                   /locus_tag="SPT_0471"
FT   CDS_pept        432824..433009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0471"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23086"
FT                   /protein_id="ACO23086.1"
FT                   /translation="MEIKEQTRKLAAGCSKHCFEVVDRTDEVSNHIYGNVTLTWSEEIF
FT                   EEYYISKGRSKFTPTC"
FT   gene            complement(433034..434077)
FT                   /locus_tag="SPT_0472"
FT   CDS_pept        complement(433034..434077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0472"
FT                   /product="L-iditol 2-dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22285"
FT                   /protein_id="ACO22285.1"
FT                   /translation="MATMKAARWHAAKDVRIQEIEVPEVLPHQVKVAVKFTGICGTDLH
FT                   EFLDGPIFIPTDEHVYSGQKAPVTLGHEFSGEIIEVGSDVTRVKVGDRVAVEPILAKNN
FT                   LVGDYNLDPNLNFVGLAADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVR
FT                   QSSLKAGDTAVVFGLGPIGLLIVEALRAAGASKIYAVELSPERQAKAEELGAIVVRPEE
FT                   GETAVEAIHRLTNGGVDVSYEVTGVPVVLGQALAAVHKAGECMVVSIWEREANINPNEF
FT                   AIQEKTLKGIIAYRHIFPKVLELMEQGYFSAEKLVTKKIKLENIVEEDFIELTQDKSQI
FT                   KILVEPE"
FT   gene            complement(434201..435643)
FT                   /locus_tag="SPT_0473"
FT   CDS_pept        complement(434201..435643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0473"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B (Asp/Glu-ADT subunit B)"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24019"
FT                   /db_xref="GOA:C1CPU6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPU6"
FT                   /protein_id="ACO24019.1"
FT                   /translation="MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFP
FT                   GVLPVLNKGVVDAGIKAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNV
FT                   RKGLEYEVQRQAEILRSGGQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDLPLFE
FT                   ISDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALGGDAK
FT                   QVSNWLQGEVAQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNG
FT                   GGAREYVEKAGMVQISDPAVLIPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATK
FT                   GQANPQVALKLLAQELAKLKEN"
FT   gene            complement(435643..437109)
FT                   /locus_tag="SPT_0474"
FT   CDS_pept        complement(435643..437109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0474"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit A
FT                   (Glu-ADTsubunit A)"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24188"
FT                   /db_xref="GOA:C1CPU7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPU7"
FT                   /protein_id="ACO24188.1"
FT                   /translation="MTFNNKTIEELHNLLVSKEISATELTQATLENIKSREEALNSFVT
FT                   IAEEQALVQAKAIDEAGIDADNVLSGIPLAVKDNISTDGILTTAASKMLYNYEPIFDAT
FT                   AVANAKTKGMIVVGKTNMDEFAMGGSGETSHYGATKNAWDHSKVPGGSSSGSAAAVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGIVGLKPTYGTVSRFGLIAFGSSLDQIGPFAPTVKENA
FT                   LLLNAIASEDAKDSTSAPVRIADFTSKIGQDIKGMKIALPKEYLGEGINPEVKETILNA
FT                   AKHFEKLGAIVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRAEDATNLDEI
FT                   YVNSRSQGFGEEVKRRIMLGTFSLSSGYYDAYYKKAGQVRTLIIQDFEKVFADYDLILG
FT                   PTAPSVAYDLDSLNHDPVAMYLADLLTIPVNLAGLPGISIPAGFSQGLPVGLQLIGPKH
FT                   SEETIYQVAAAFEATTGYHKQQPVIFGGDN"
FT   gene            complement(437109..437411)
FT                   /gene="gatC"
FT                   /locus_tag="SPT_0475"
FT   CDS_pept        complement(437109..437411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="SPT_0475"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22860"
FT                   /db_xref="GOA:C1CPU8"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPU8"
FT                   /protein_id="ACO22860.1"
FT                   /translation="MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVD
FT                   TTGVAPTTTMADRKTVLRPDVAEEGIDRDRLFKNVPEKDNYYIKVPAILDNGGDA"
FT   gene            437624..439168
FT                   /gene="prfC"
FT                   /locus_tag="SPT_0476"
FT   CDS_pept        437624..439168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="SPT_0476"
FT                   /product="peptide chain release factor 3"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03144; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00503"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23041"
FT                   /db_xref="GOA:C1CPU9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPU9"
FT                   /protein_id="ACO23041.1"
FT                   /translation="MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKG
FT                   KKTGTFAKSDWMDIEKQRGISVTSSVMQFDYDGKRVNILDTPGHEDFSEDTYRTLMAVD
FT                   AAVMVVDSAKGIEAQTKKLFEVVKHRGIPVFTFMNKLDRDGREPLDLLQELEEILGIAS
FT                   YPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNPFYEQVKDDIELL
FT                   NEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLEIFLKFAPEPHGHKKTDGEIVDPY
FT                   DKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAE
FT                   SRENVINAVAGDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQ
FT                   KSFHKGIEQLVQEGAVQLYKNYQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMSPMGK
FT                   KTVRWIKPEDLDERMSSSRNILAKDRFDQPVFLFENDFALRWFADKYPDVELEEKM"
FT   gene            439952..440080
FT                   /pseudo
FT                   /locus_tag="SPT_0477"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            440196..440384
FT                   /gene="rpmB"
FT                   /locus_tag="SPT_0478"
FT   CDS_pept        440196..440384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SPT_0478"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22784"
FT                   /db_xref="GOA:C1CPV0"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPV0"
FT                   /protein_id="ACO22784.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPK
FT                   KVWASARALKSGKVERV"
FT   gene            440541..440906
FT                   /locus_tag="SPT_0479"
FT   CDS_pept        440541..440906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0479"
FT                   /product="alkaline shock protein"
FT                   /note="identified by match to protein family HMM PF03780"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22455"
FT                   /protein_id="ACO22455.1"
FT                   /translation="MTVKINTKDGQIELTDEVIATVVGGAATEIFGVVGMASKNALKDN
FT                   FQALLGKENYSKGVVVKAAEDGSIAVDVYTVLSYGTKISEVSKNIQERVAFSLENQLGI
FT                   TAQTVNVYIQNIKVVGE"
FT   gene            440909..442576
FT                   /locus_tag="SPT_0480"
FT   CDS_pept        440909..442576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0480"
FT                   /product="dihydroxyacetone kinase family protein"
FT                   /note="identified by match to protein family HMM PF02734"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22902"
FT                   /protein_id="ACO22902.1"
FT                   /translation="MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMG
FT                   MTIENGAKEVADKPASTVGEVASILAKGLLMGARGNSGVITSQLFRGFSQAIKDKDELT
FT                   GQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAIGAKKKAEQTDDAVEVMRAALEGA
FT                   KTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALTGEYIASEDFVATPANMSEMI
FT                   NVEHHKSVAGHVATEDITFGYCTEIMVALKQGPTYAKDFDYDEFRNYLDELGDSLLVVN
FT                   DDEIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKSAEEKEY
FT                   ALIAVVAGKGLADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNIF
FT                   MAAQSAAEVLEQPAVVVEARTLPQGMTSLLAFDPSKSIEENQERMTAALSDVVSGSVTT
FT                   AVRDTTIDGLEIHENDNLGMVDGKILVSNPDMHQTLTETLKHMLDEDSEIVTFYVGEDG
FT                   SEELANEIAQEIVEEFEDVEVEIHQGQQPVYPYLFSVE"
FT   gene            442776..444476
FT                   /gene="ilvB"
FT                   /locus_tag="SPT_0481"
FT   CDS_pept        442776..444476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="SPT_0481"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22475"
FT                   /protein_id="ACO22475.1"
FT                   /translation="MEKISLESPKTGSDLVLETLRDLGVDTIFGYPGGAVLPFYDAIYN
FT                   FKGIRHILGRHEQGCLHEAEGYAKSTGKLGVAVVTSGPGATNAITGIADAMSDSVPLLV
FT                   FTGQVARAGIGKDAFQEADIVGITMPITKYNYQVRETADIPRIITEAVHIATTGRPGPV
FT                   VIDLPKDISALETDFIYSPEVNLPSYQPTLEPNDMQIKKILKQLSKAKKPVLLAGGGIS
FT                   YAEAATELNEFAERYQIPVVTSLLGQGTIATSHPLFLGMGGMHGSFAANIAMTEADFMI
FT                   SIGSRFDDRLTGNPKTFAKNAKVAHIDIDPAEIGKIISADIPVVGDAKKALQMLLAEPT
FT                   VHNNTEKWIEKVTKDKNRVRSYDKKERVVQPQAVIERIGELTNGDAIVVTDVGQHQMWT
FT                   AQYYPYQNERQLVTSGGLGTMGFGIPAAIGAKIANPDKEVVLFVGDGGFQMTNQELAIL
FT                   NIYKVPIKVVMLNNHSLGMVRQWQESFYEGRTSESVFDTLPDFQLMAQAYGIKNYKFDN
FT                   PETLAQDLEVITEDVPMLIEVDISRKEQVLPMVPAGKSNHEMLGVQFHA"
FT   gene            444469..444945
FT                   /gene="ilvN"
FT                   /locus_tag="SPT_0482"
FT   CDS_pept        444469..444945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="SPT_0482"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23949"
FT                   /protein_id="ACO23949.1"
FT                   /translation="MRRMLTAKLQNRSGVLNRFTGVLSRRQVNIESISVGATEDPNVSR
FT                   ITIIIDVASHDEVEQIIKQLNRQIDVIRIRDITDKPHLEREVILVKMSAPAEKRAEILA
FT                   IIQPFRATVVDVAPSSITIQMTGNAEKSEALLRVIRPYGIRNIARTGATGFTRD"
FT   gene            445011..446033
FT                   /gene="ilvC"
FT                   /locus_tag="SPT_0483"
FT   CDS_pept        445011..446033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="SPT_0483"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="identified by match to protein family HMM PF01450;
FT                   match to protein family HMM PF02629; match to protein
FT                   family HMM PF07991; match to protein family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23274"
FT                   /db_xref="GOA:C1CPV5"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPV5"
FT                   /protein_id="ACO23274.1"
FT                   /translation="MTVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDSGRDVI
FT                   IGVRPGKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAEIAPNLEAGNAV
FT                   GFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAVYQDATGNAKN
FT                   IAMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLTALIEAGFEVLTEAGYAPE
FT                   LAYFEVLHEMKLIVDLIYEGGFKKMRQSISNTAEYGDYVSGPRVITEQVKENMKAVLAD
FT                   IQNGKFANDFVNDYKAGRPKLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN
FT                   "
FT   gene            446140..446376
FT                   /locus_tag="SPT_0484"
FT   CDS_pept        446140..446376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23273"
FT                   /protein_id="ACO23273.1"
FT                   /translation="MLADQNKADWSYDENAVINIYDDANFEDGRLHMTFEQFFKLAQIA
FT                   REEGLEIHSPFERAGATKSARYIAKWILRNKKY"
FT   gene            446614..446970
FT                   /locus_tag="SPT_0485"
FT   CDS_pept        446614..446970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22702"
FT                   /protein_id="ACO22702.1"
FT                   /translation="MNITNLFSIKTGCDETDRQLQKLFFQLDLQLGELTDQLRKLDSNF
FT                   VPRSQFVDTLDLNDVEYKEILNYFIFHRNDSEESLVEWLYDWISTNRYELPKEFSIRMA
FT                   HKYHESVTEIFGDE"
FT   gene            447020..448270
FT                   /gene="ilvA"
FT                   /locus_tag="SPT_0486"
FT   CDS_pept        447020..448270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="SPT_0486"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM PF00585; match to protein
FT                   family HMM TIGR02079"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24235"
FT                   /protein_id="ACO24235.1"
FT                   /translation="MLSSKDIIKAHKVLNGVVVNTPLDYDHYLSEKYGAKIYLKKENAQ
FT                   RVRSFKIRGAYYAISQLSKEERERGVVCASAGNHAQGVAYTCNEMKIPATIFMPITTPQ
FT                   QKIGQVRFFGGDFVTIKLVGDTFDASAKAAQEFTVSENRTFIDPFDDAHVQAGQGTVAY
FT                   EILEEARKESIDFDAVLVPVGGGGLIAGVSTYIKETSPEIEVIGVEANGARSMKAAFEA
FT                   GGPVKLKEIDKFADGIAVQKVGQLTYEATRQHIQTLVGVDEGLISETLIDLYSKQGIVA
FT                   EPAGAASIASLEVLAEYIKGKTICCIISGGNNDINRMPEMEERALIYDGIKHYFVVNFP
FT                   QRPGALREFVNDILGPNDDITRFEYIKRASKGTGPVLIGIALADKHDYAGLIRRMEGFD
FT                   PAYINLNGNETLYNMLV"
FT   gene            448412..448600
FT                   /locus_tag="SPT_0487"
FT   CDS_pept        448412..448600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23521"
FT                   /protein_id="ACO23521.1"
FT                   /translation="MAQISILHFDFLSIDKHSHTVFNTLRKSLQTTLALSATSKQCFEQ
FT                   LAASFLVCSLIFIEYKV"
FT   gene            449141..449356
FT                   /locus_tag="SPT_0488"
FT   CDS_pept        449141..449356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23718"
FT                   /protein_id="ACO23718.1"
FT                   /translation="MAKSNFEKVESVVGWVRDKKITGYRISKETNAREMSIIALAQGRA
FT                   KVKNISFETALGLIDFYEKNYEKFED"
FT   gene            complement(449465..450205)
FT                   /gene="gltL"
FT                   /locus_tag="SPT_0489"
FT   CDS_pept        complement(449465..450205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="SPT_0489"
FT                   /product="glutamate/aspartate ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24135"
FT                   /protein_id="ACO24135.1"
FT                   /translation="MTQAILEIKHLKKSYGQNEVLKDISLTVHKGEVISIIGSSGSGKS
FT                   TFLRSINLLETPTDGQILYHGQNVLEKGYDLTQYREKLGMVFQSFNLFENLNVLENTIV
FT                   AQTTVLKRERTEAEKIAKENLEKVGMGERYWQAKPKQLSGGQKQRVAIARALSMNPDAI
FT                   LFDEPTSALDPEMVGEVLKIMQDLAQEGLTMIVVTHEMEFARDVSHRVIFMDKGVIAEE
FT                   GKPEDLFTNPKEDRTKEFLQRYLK"
FT   gene            complement(450205..451770)
FT                   /locus_tag="SPT_0490"
FT   CDS_pept        complement(450205..451770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0490"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein/permease protein"
FT                   /note="identified by match to protein family HMM PF00497;
FT                   match to protein family HMM PF00528; match to protein
FT                   family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23325"
FT                   /protein_id="ACO23325.1"
FT                   /translation="MRKIYLSIFTSLLLMLGLVNVAQADEYLRIGMEAAYAPFNWTQDD
FT                   DSNGAVKIDGTNQYANGYDVQIAKKIAKDLGKEPLVVKTKWEGLVPALTSGKIDMIIAG
FT                   MSPTAERKQEIAFSSSYYTSEPVLLVKKDSAYVSAKSLDDFNGAKITSQQGVYLYDLIA
FT                   QIPGAKKETAMGDFAQMRQALEAGVIDAYVSERPEALTAEAANSKFKMIQVEPGFKTGE
FT                   EDTAIAIGLRKNDNRISQINASIETISKDDQVALMDRMIKEQPAEATTTEETSSSFFSQ
FT                   VAKILSENWQQLLRGAGITLLISIVGTIIGLIIGLAIGVFRTAPLSENKAIYGLQKLVG
FT                   WVLNVYIEIFRGTPMIVQSMVIYYGTAQAFGINLDRTLAAIFIVSINTGAYMTEIVRGG
FT                   ILAVDKGQFEAATALGMTHNQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLNVISVV
FT                   ELYFSGNTVATQTYQYFQTFTIIAVIYFVLTFTVTRILRFIERRMDMDTYTTGANQMQT
FT                   EDLK"
FT   gene            451908..453797
FT                   /locus_tag="SPT_0492"
FT   CDS_pept        451908..453797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23211"
FT                   /protein_id="ACO23211.1"
FT                   /translation="MKKTFFLLVLGLFCLLPLSVFAIDFKINSYQGDLYIHADNTAEFR
FT                   QKIVYQFEEDFKGQIVGLGRAGKMPSGFDIDPHPKVQAAKNGAELADVTSEVTEEADGY
FT                   TVRVYNPGQEGDIVEVDLVWNLKNLLFLYDDIAELNWQPLTDSSESIEKFEFHVRGDKG
FT                   AEKLFFHTGKLFREGTIEKSNLDYTIRLDNLPAKRGVELHAYWPRTDFASARDQGLKGN
FT                   RLEEFNKIEDSIVREKDQSKQLVTWVLPSILSISLLLSVCFYFIYRRKTTPSVKYAKNH
FT                   RLYEPPMELEPMVLSEAVYSTSLEEVSPLVKGAGKFTFDQLIQATLLDVMDRGNVSIIS
FT                   EGDAVGLRLVKEDGLSRFERDCLNLAFSGKKEATLSNLFADYKVSDSLYRGAKAADEKR
FT                   IQARGIQLKSSFEAVLKEMQEGVRKRVVFWGLPDYYRPLTGLEKALQVGMGVLTILPLF
FT                   IGFGLFLYSLDVHGYLYLPLPILGFLGLVLSVFYYWKLRLDNRDGVLNEAGAEVYYLWT
FT                   SFENMLREIARLDKAELESIVVWNRLLVYATLFGYADKVSHLMKVHQIQVENPDINLYV
FT                   AYGWHSMFYHSSAQMSHYASVANTASTYSVSSGSGSSGGGFSGGGGGGSIGAF"
FT   gene            complement(453794..453964)
FT                   /locus_tag="SPT_0491"
FT   CDS_pept        complement(453794..453964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0491"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23787"
FT                   /protein_id="ACO23787.1"
FT                   /translation="MKKWTFSRAFCRALKSSPNHQIEIRNSLDKTIDFSYSLSFFYLPL
FT                   YHTFSVYGSSL"
FT   gene            complement(454098..454646)
FT                   /pseudo
FT                   /locus_tag="SPT_0493"
FT                   /note="transposase, degenerate; this region contains one or
FT                   more premature stops and/or frameshifts; identified by
FT                   match to protein family HMM PF02371"
FT   gene            complement(454844..454966)
FT                   /locus_tag="SPT_0494"
FT   CDS_pept        complement(454844..454966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0494"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24126"
FT                   /protein_id="ACO24126.1"
FT                   /translation="MLYVGIDVAKNKHDVTALNVRGKLFLNHSLFQIIKLVLNS"
FT   gene            455222..456067
FT                   /locus_tag="SPT_0495"
FT   CDS_pept        455222..456067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0495"
FT                   /product="undecaprenyl-diphosphatase (Undecaprenyl
FT                   pyrophosphatephosphatase) (Bacitracin resistance protein)"
FT                   /EC_number="3.6.1.27"
FT                   /note="identified by match to protein family HMM PF02673"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22382"
FT                   /db_xref="GOA:C1CPW6"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPW6"
FT                   /protein_id="ACO22382.1"
FT                   /translation="MYLIEILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEA
FT                   FMSMFNVVIQLGAILAVMVIYFNKLNPFKPTKDKQEVRKTWRLWLKVLIATLPLLGVFK
FT                   FDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRNKARAIEPSVTELDKLPYTTAFYIGLF
FT                   QVLALLPGTSRSGATIVGGLLNGTSRSVVTEFTFYLGIPVMFGASALKIFKFVKAGELL
FT                   SFGQLFLLLVAMGVAFAVSMVAIRFLTSYVKKHDFTLFGKYRIVLGSVLLLYSFVRLFV
FT                   "
FT   gene            456060..456188
FT                   /locus_tag="SPT_0496"
FT   CDS_pept        456060..456188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22960"
FT                   /protein_id="ACO22960.1"
FT                   /translation="MYKKNLEGATLQGFILLENFFKPRQLYLQPQNSVLSSLRLAS"
FT   gene            complement(456214..457275)
FT                   /locus_tag="SPT_0497"
FT   CDS_pept        complement(456214..457275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0497"
FT                   /product="DNA polymerase IV (Pol IV)"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23288"
FT                   /protein_id="ACO23288.1"
FT                   /translation="MLIFPLLNDLSRKIIHIDMDAFFAAVEIKDNPKLRGKPVIIGSDP
FT                   RQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKAVGLQIRAIFK
FT                   RYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGISYNKFLAK
FT                   MASDYQKPHGLTVILPEQAENFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEV
FT                   TLIDRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIKKELTILSE
FT                   KVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQISQIALQLYEELSEKE
FT                   RGVRLLGITLTGF"
FT   gene            457623..459947
FT                   /gene="pflB"
FT                   /locus_tag="SPT_0498"
FT   CDS_pept        457623..459947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflB"
FT                   /locus_tag="SPT_0498"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF02901; match to protein
FT                   family HMM TIGR01255"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22750"
FT                   /protein_id="ACO22750.1"
FT                   /translation="MVVKTVVEAQDIFDKAWEGFKGVDWKEKASVSRFVQANYTPYDGD
FT                   ESFLAGPTERSLHIKKIVEETKAHYEETRFPMDTRPTSIADIPAGFIDKENEVIFGIQN
FT                   DELFKLNFMPKGGIRMAETTLKENGYEPDPAVHEIFTKYVTTVNDGIFRAYTSNIRRAR
FT                   HAHTVTGLPDAYSRGRIIGVYARLALYGADYLMQEKVNDWNAIKEIDEETIRLREEVNL
FT                   QYQALQQVVRLGDLYGVDVRKPAMNVKEAIQWVNIAFMAVCRVINGAATSLGRVPIVLD
FT                   IFAERDLARGTFTESEIQEFVDDFVMKLRTVKFARTKAYDQLYSGDPTFITTSMAGMGN
FT                   DGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWTDKLPYNFRRYCMHMSHKHSSIQYEGV
FT                   TTMAKDGYGEMSCISCCVSPLDPENEEQRHNIQYFGARVNVLKALLTGLNGGYDDVHKD
FT                   YKVFDIDPIRDEVLEFESVKANFEKSLDWLTDTYVDALNIIHYMTDKYNYEAVQMAFLP
FT                   TKQRANMGFGICGFANTVDTLSAIKYATVKPIRDEDGYIYDYETIGDYPRWGEDDPRSN
FT                   ELAEWLIEAYTTRLRSHKLYKDAEATVSLLTITSNVAYSKQTGNSPVHKGVYLNEDGSV
FT                   NLSKLEFFSPGANPSNKAKGGWLQNLNSLSSLDFSYAADGISLTTQVSPRALGKTRDEQ
FT                   VDNLVTILDGYFENGGQHVNLNVMDLNDVYEKIMSGEDVIVRISGYCVNTKYLTPEQKT
FT                   ELTQRVFHEVLSMDDALDALS"
FT   gene            complement(460005..461267)
FT                   /locus_tag="SPT_0499"
FT   CDS_pept        complement(460005..461267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0499"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23476"
FT                   /protein_id="ACO23476.1"
FT                   /translation="MEHINHTTLLIGIKDKNITLNKAIQHDTHIEVFATLDYHPPKCKH
FT                   CKGKQIKYDFQKPSKIPFIEIGGFPSLIHLKKRRFQCKSCRKVTVAETTLVQKNCQISE
FT                   MVRQKIAQLLLNREALTHIASKLAISTSTSTVYRKLKQFHFQEDYTTLPEILSWDEFSY
FT                   QKGKLAFIAQDFNTKKIMTILDNRRQTTIRNHFFKYSKEARKKVKVVTVDMSGSYIPLI
FT                   KKLFPNAKIVLDRFHIVQHMSRALNQTRINIMKQFDDKSLEYRALKYYWKFILKDSRKL
FT                   SLKPFYARTFRETLTPRECLKKIFTLVPELKDYYDLYQLLLFHLQEKNTDQFWGLIQDT
FT                   LPHLNRTFKTTLSTFIRYKNYITNAIELPYSNAKLEATNKLIKDIKRNAFGFRNFENFK
FT                   KRIFIALNIKKERTKFVLSRA"
FT   gene            complement(461532..463061)
FT                   /locus_tag="SPT_0500"
FT   CDS_pept        complement(461532..463061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0500"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by match to protein family HMM PF05043;
FT                   match to protein family HMM PF08270; match to protein
FT                   family HMM PF08280"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22909"
FT                   /protein_id="ACO22909.1"
FT                   /translation="MLNKYIEKRITDKITILNILLDIRSIELDELSTLTSLQSKSLLSI
FT                   LQELQETFEEELTFNLDTQQVQLIEHHSHQTNYYFHQLYNQSTILKILRFFLLQGNQSF
FT                   NEFTQKEYISIATGYRVRQKCGLLLRSVGLDLVKNQVVGPEYRIRFLIALLQFHFGIEI
FT                   YDLNDGSMDWVTHMIVQSNSQLSHELLEITPDEYVHFSILVALTWKRREFPLEFPESKE
FT                   FEKLKNLFMYPILMEHCQTYLEPHANMTFTQEELDYIFLVYCSANSSFSKDKWNQEKKT
FT                   HTIQLILQHTRGKHLLSKFKNILGNDISNSLSFLTALTFLTRTFLFGLQNLVPYYNYYE
FT                   HYGIESDKPLYHISKAIVQEWMTEQKIEGVIDQHRLYLFSLYLTETIFSSLPAIPIFII
FT                   LNNQADVNLIKSIILRNFTDKVASVTGYNILISPPPSEEHLTEPLIIITTKEYLPYVKK
FT                   QYPKGKHHFLTIALDLHVSQQRLIYQTIVDIRKEAFDKRVAMIAKKAHYLL"
FT   gene            463577..466237
FT                   /locus_tag="SPT_0501"
FT   CDS_pept        463577..466237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0501"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00092;
FT                   match to protein family HMM PF05738"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22459"
FT                   /protein_id="ACO22459.1"
FT                   /translation="MKKVRKIFQKAVAGLCCISQLTAFSSIVALAETPETSPAIGKVVI
FT                   KETGEGGALLGDAVFELKNNTDGTTVSQRTEAQTGEAIFSNIKPGTYTLTEAQPPVGYK
FT                   PSTKQWTVEVEKNGRTTVQGEQVENREEALSDQYPQTGTYPDVQTPYQIIKVDGSEKNG
FT                   QHKALNPNPYERVIPEGTLSKRIYQVNNLDDNQYGIELTVSGKTVYERKDKSVPLDVVI
FT                   LLDNSNSMSNIRNKNARRAERAGEATRSLIDKITSDPENRVALVTYASTIFDGTEFTVE
FT                   KGVADKNGKRLNDSLFWNYDQTSFTTNTKDYSYLKLTNDKNDIVELKNKVPTEAEDHDG
FT                   NRLMYQFGATFTQKALMKADEILTQQARQNSQKVIFHITDGVPTMSYPINFNHATFAPS
FT                   YQNQLNAFFSKSPNKDGILLSDFITQATSGEHTIVRGDGQSYQMFTDKTVYEKGAPAAF
FT                   PVKPEKYSEMKAVGYAVIGDPINGGYIWLNWRESILAYPFNSNTAKITNHGAPTRWYYN
FT                   GNIAPDGYDVFTVGIGINGDPGTDEATATSFMQSISSKPENYTNVTDTTKILEQLNRYF
FT                   HTIVTEKKSIENGTITDPMGELIDLQLGTDGRFDPADYTLTANDGSRLENGQAVGGPQN
FT                   DGGLLKNAKVFYDTTEKRIRVTGLYLGTGEKVTLTYNVRLNDQFVSNKFYDTNGRTTLH
FT                   PKEVEKNTVRDFPIPKIRDVRKYPAITIAKEKKLGEIEFIKINKNDKKPLRDAVFSLQK
FT                   QHPDYPDIYGAIDQNGTYQNVRTGEDGKLTFKNLSDGKYRLFENSEPAGYKPVQNKPIV
FT                   AFQIVNGEVRDVTSIVPQDIPAGYEFTNDKHYITNEPIPPKREYPRTGGIGMLPFYLIG
FT                   CMMMGGVLLYTRKHP"
FT   gene            466460..468457
FT                   /locus_tag="SPT_0503"
FT   CDS_pept        466460..468457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0503"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF05738; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23362"
FT                   /protein_id="ACO23362.1"
FT                   /translation="MKSINKFLTMLAALLLTASSLFSAATVFAAGTTTTSVTVHKLLAT
FT                   DGDMDKIANELETGNYAGNKVGVLPANAKEIAGVMFVWTNTNNEIIDENGQTLGVNIDP
FT                   QTFKLSGAMPATAMKKLTEAEGAKFNTANLPAAKYKIYEIHSLSTYVGEDGATLTGSKA
FT                   VPIEIELPLNDVVDAHVYPKNTEAKPKIDKDFKGKANPDTPRVDKDTPVNHQVGDVVEY
FT                   EIVTKIPALANYATANWSDRMTEGLAFNKGTVKVTVDDVALEAGDYALTEVATGFDLKL
FT                   TDAGLAKVNDQNAEKTVKITYSATLNDKAIVEVPESNDVTFNYGNNPDHGNTPKPNKPN
FT                   ENGDLTLTKTWVDATGAPIPAGAEATFDLVNAQTGKVVQTVTLTTDKNTVTVNGLDKNT
FT                   EYKFVERSIKGYSADYQEITTAGEIAVKNWKDENPKPLDPTEPKVVTYGKKFVKVNDKD
FT                   NRLAGAEFVIANADNAGQYLARKADKVSQEEKQLVVTTKDALDRAVAAYNALTAQQQTQ
FT                   QEKEKVDKAQAAYNAAVIAANNAFEWVADKDNENVVKLVSDAQGRFEITGLLAGTYYLE
FT                   ETKQPAGYALLTSRQKFEVTATSYSATGQGIEYTAGSGKDDATKVVNKKITIPQTGGIG
FT                   TIIFAVAGAVIMGIAVYAYVKNNKDEDQLA"
FT   gene            complement(468423..468725)
FT                   /locus_tag="SPT_0502"
FT   CDS_pept        complement(468423..468725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23848"
FT                   /protein_id="ACO23848.1"
FT                   /translation="MQVSHNLHPIIIGIRIIQLPYLQPMTITRWQLTNHLLIVLQLQDQ
FT                   RVIFLRLDCMCTPYKRKTQSHNKEDTTNHFLHFLHCHQWLLSLLLKQVDPHLCCF"
FT   gene            468774..469685
FT                   /locus_tag="SPT_0504"
FT   CDS_pept        468774..469685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0504"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF05738;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23540"
FT                   /protein_id="ACO23540.1"
FT                   /translation="MTFLENQIEVSHIPNGLYYVRSIIQTDAVSYPAEFLFEMTDQTVE
FT                   PLVIVAKKADTVTTKVKLIKVDQDHNRLEGVGFKLVSVARDGSEKEVPLIGEYRYSSSG
FT                   QVGRTLYTDKNGEIVVTNLPLGTYRFKEVEPLAGYTVTTMDTDVQLVDHQLVTITVVNQ
FT                   KLPRGNVDFMKVDGRTNTSLQGAMFKVMKEENGHYTPVLQNGKEVVVASGKDGRFRVEG
FT                   LEYGTYYLWELQAPTGYVQLTSPVSFTIGKDTRKELVTVVKNNKRPRIDVPDTGEETLY
FT                   ILMLVAILLFGSGYYLTKKTNN"
FT   gene            470024..470920
FT                   /locus_tag="SPT_0505"
FT   CDS_pept        470024..470920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0505"
FT                   /product="sortase family protein"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23255"
FT                   /protein_id="ACO23255.1"
FT                   /translation="MAKTKKQKRNNLLLGVVFFIGMAVMAYPLVSRLYYRVESNQQIAD
FT                   FDKEKATLDEADIDERMKLAQAFNDSLNNVVSGDPWSEEMKKKGRAEYARMLEIHERMG
FT                   HVEIPAIDVDLPVYAGTAEEVLQQGAGHLEGTSLPIGGNSTHAVITAHTGLPTAKMFTD
FT                   LTKLKVGDKFYVHNIKEVMAYQVDQVKVIEPTNFDDLLIVPGHDYVTLLTCTPYMINTH
FT                   RLLVRGHRIPYVAEVEEEFIAANKLSHLYRYLFYVAVGLIVILLWIIRRLRKKKRQSER
FT                   ALKALKEATKEVKVEDE"
FT   gene            470989..471807
FT                   /locus_tag="SPT_0506"
FT   CDS_pept        470989..471807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0506"
FT                   /product="sortase family protein"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22356"
FT                   /protein_id="ACO22356.1"
FT                   /translation="MVGLAVAMYPLVSRYYYRIESNEVIKEFDETVSQMDKAELEERWR
FT                   LAQAFNATLKPSEILDPFTDQEKKQGVSEYANMLKVHERIGYVEIPAIEQEIPMYVGTS
FT                   EDILQKGAGLLEGASLPVGGENTHTVITAHRGLPTAELFSQLDKMKKGDIFYLHVLDQV
FT                   LAYQVDQIVTVEPNDFEPVLIQHGQDYATLLTCTPYMINSHRLLVRGKRIPYTAPIAER
FT                   NRAVRERGQFWLWLLLGAMAVILLLLYRVYRNRRIVKGLEKQLEGRHVKD"
FT   gene            471836..472645
FT                   /locus_tag="SPT_0507"
FT   CDS_pept        471836..472645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0507"
FT                   /product="sortase, putative"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24139"
FT                   /protein_id="ACO24139.1"
FT                   /translation="MLVACLIPIYCFGQMVLQSLGQVKGHATFVKSMTTEMYQEQQNHS
FT                   LAYNQRLASQNRIVDPFLAEGYEVNYQVSDDPDAVYGYLSIPSLEIMEPVYLGADYHHL
FT                   GMGLAHVDGTPLPLDGTGIRSVIAGHRAEPSHVFFRHLDQLKVGDALYYDNGQEIVEYQ
FT                   MMDTEIILPSEWEKLESVSSKNIMTLITCDPIPTFNKRLLVNFERVAVYQKSDPQTAAV
FT                   ARVAFTKEGQSVSRVATSQWLYRGLVVLAFLGILFVLWKLARLLRGK"
FT   gene            complement(472719..474043)
FT                   /pseudo
FT                   /locus_tag="SPT_0508"
FT                   /note="transposase, degenerate; this region contains one or
FT                   more premature stops and/or frameshifts"
FT   gene            complement(474158..474307)
FT                   /locus_tag="SPT_0511"
FT   CDS_pept        complement(474158..474307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23470"
FT                   /protein_id="ACO23470.1"
FT                   /translation="MDKMKPVFQALNKELIQENLTLTIICVDGYVLEYHGLRATQDVDA
FT                   FMAL"
FT   gene            complement(474300..474584)
FT                   /locus_tag="SPT_0512"
FT   CDS_pept        complement(474300..474584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22764"
FT                   /protein_id="ACO22764.1"
FT                   /translation="MVWYDYMIQASKQSQFNASHWFRYLRKVIFEDYSYLTNQDVEKLL
FT                   DSKELTRFQKISLKYAFQEHTPTHKYVISLNKPAKLTNVQKLMEKYKHG"
FT   gene            complement(475181..475351)
FT                   /locus_tag="SPT_0513"
FT   CDS_pept        complement(475181..475351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23053"
FT                   /protein_id="ACO23053.1"
FT                   /translation="MTKQVPKFTKDTAQLYTCKWLLYNKVTKMYDHTVVNHSVREYITD
FT                   SISTNTIEKAG"
FT   gene            complement(476005..477228)
FT                   /locus_tag="SPT_0514"
FT   CDS_pept        complement(476005..477228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0514"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22589"
FT                   /protein_id="ACO22589.1"
FT                   /translation="MITKQSAFLQNRATILEFLYRNPATSRTDIVNETGLTPATTTNII
FT                   KELSEQSLIYETGDEFSEFSGSGRRRKTISITDNIPYVVGGIEINVLGIFLSLCDLQGK
FT                   TLFETEILNEDYPISEINSTITNMIKTAIEYVPLETKLLGFGLSIPGHYNKDSGSIITN
FT                   NPIWESFNLLNVIKRFNFPFIVKNNIDCMAIGQYLFNPHNTPDNFIFLHAGLGIYTSFF
FT                   TKEKIGASKNPYIGEIGHTIVELNGQYCECGKKGCLQTYISDAWLIKHAQLLFKNSQLT
FT                   VLKSLVKTEKDIHLDTLLTAYNLGDSALRQQIDKGVNLLATSIANLLLINPADKIYINS
FT                   QLLNYQPFTHEVRDKIQDQLHFVPFTRNIEIEILPYNKHRGSIGACALAIVAFFIEHSN
FT                   VLQDIISP"
FT   gene            477395..478717
FT                   /locus_tag="SPT_0515"
FT   CDS_pept        477395..478717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0515"
FT                   /product="lichenan permease iic component (pts system
FT                   lichenan-specific eiiccomponent) (eiic-lic)"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24189"
FT                   /protein_id="ACO24189.1"
FT                   /translation="MNNILAFLETKVAPFGEKVGNQRHLKAIREGFMMAMPLILVGSLF
FT                   LILISWPQEDFTNWLNSVGLLSILTTMNQSTVAIISLVACFGIAYRLSEGYGTDGPSAG
FT                   IIALSSFVLMAPRFSSMVYDKNGEQVKQLFGGAIPFSSLNASSLFMAITIGLVTAEIYR
FT                   MFIQRGITIKMPSGVPDVVSKSFSALLPGFTTFVLWALVLKGLEAAGVAGGLNGLLGAI
FT                   VGTPLKLIAGTLPGMILCVIVNSFFWFCGVNGGQVLNAFVDPVWLQFTTENQEAVAAGQ
FT                   TLQHIITLPFKDLFVFIGGGGATIGLAICLFLFSKSRANKTLGKLAIIPSIFNINTAIL
FT                   FTFPTVLNPIMLIPFIATPTINALITYVSMAVGLVPYTTGVILPWTMPPIIGGFLATGA
FT                   SWRGALLQVVLILVSVAIYYPFFKIADKRNLEKEKATVGGK"
FT   gene            478719..480605
FT                   /locus_tag="SPT_0516"
FT   CDS_pept        478719..480605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23740"
FT                   /protein_id="ACO23740.1"
FT                   /translation="MVIRVFDQQKNTYSSFALEELSYYMNRVFKTNIELVEEKEADIFV
FT                   GLVNKEDRKDHVLISLDKGKGRIESNTIVGLLIGIYRMFHEFGVVYTRPGRGHDFVPEL
FT                   RFEDFLDKQLSIDETASYYHRGVCIEGADSFENILDFIDWLPKIGMNSFFIQFENPYSF
FT                   LKRWYEHEFNPYLNKEQFSNELVQELSDRLDKELQKRGLIHHRVGHGWTGEVLGYSSKF
FT                   GWESGLSISEEKKPYVAEINGKRELFNTAPILTSLDFSNPDVADKMVEIIKDYAKKRPD
FT                   VNYLHVWLSDARNNICECENCRQELVSDQYIRILNQLDRALTSEGLDTKICFLLYHELL
FT                   WAPQKEKLDNPERFTMMFAPITRTFEMSYADVDFDNSIPTPKPYMRNKIILPNSLEENL
FT                   SYLFEWQKAFKGDSFVYDYPLGRAHYGDLGYMKISQTIYRDVSYLSNLHLNGYISCQEL
FT                   RAGFPHNFPNYVMGQMLWKKTRSYEELIEEYFSALYGENWQSVVEYLEKLSIYSSCDYF
FT                   NAIGSRQNDVLANHYYIAYNLADNFLPIIEENISKLLNSQKDEWKQLSYHREYVVKMAK
FT                   ALYLQATGKTRQAQDEWRNVLNYIRGHELLFQSNLDVYRVIEVAKNYAGFHL"
FT   gene            480773..481117
FT                   /locus_tag="SPT_0517"
FT   CDS_pept        480773..481117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0517"
FT                   /product="lactose-specific phosphotransferase enzyme iia
FT                   component (pts system lactose-specific eiia component)
FT                   (eiia-lac) (eiii-lac)"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22799"
FT                   /protein_id="ACO22799.1"
FT                   /translation="MKSKEEINMLGFTIVAYAGDARSDLMDALAFARDGYFEQARELVE
FT                   SANDSIVSAHREQTNLLAEEAYGDNFEVSFIMIHGQDTLMTTMLLYDQVKFFIDEYERI
FT                   RKIEEHIGLQ"
FT   gene            481127..482539
FT                   /gene="lacG1"
FT                   /locus_tag="SPT_0518"
FT   CDS_pept        481127..482539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacG1"
FT                   /locus_tag="SPT_0518"
FT                   /product="6-phospho-beta-galactosidase"
FT                   /EC_number="3.2.1.85"
FT                   /note="identified by match to protein family HMM PF00232;
FT                   match to protein family HMM TIGR01233"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22341"
FT                   /protein_id="ACO22341.1"
FT                   /translation="MENLQFKVLPKEFLLGAATAAYQVEGATRVDGKGINMWDVYLQEN
FT                   SPFLPDPASDFYYRYEEDIALAAEHGLQALRLSISWVRIFPDIDGDANVLAVHYYHRVF
FT                   QSCLKHNVIPFVSLHHFDSPQKMLETGDWLNRENIDRFIRYARFCFQEFTEVKHWFTIN
FT                   ELMSLAAGQYIGGQFPPNHHFQLSEAIQANHNMLLAHALAVLEFHQLGIEGKVGCIHAL
FT                   KLGYPIDGQKENILAAKRYDVYNNKFLLDGTFLGYYSEDTLFHLNQILEANNSSFIIED
FT                   GDLEIMKRAAALNTMFGMNYYRSEFIREYKGENRQEFNSTGIKGQSSFKLNALGEFVKK
FT                   PGIPTTDWDWNIYPQGLFDMLLRIKEEYPQHPVIYLTENGTALKEVKPEGENDIIDDSK
FT                   RIRYIEQHLHKVLEARDRGVNIQGYFIWSLQDQFSWANGYNKRYGLFFVDYETQKRYIK
FT                   KSALWVKGLKRN"
FT   gene            482608..484287
FT                   /locus_tag="SPT_0519"
FT   CDS_pept        482608..484287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0519"
FT                   /product="pts system lactose-specific eiicb component
FT                   (eiicb-lac) (eii-lac)"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF02302;
FT                   match to protein family HMM PF02378"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23148"
FT                   /protein_id="ACO23148.1"
FT                   /translation="MDKLVAAIEKQQGKFEKISTNNYMMAIKDGFIATMPLIMFSSFLM
FT                   IIIMIPKNFGVELPSPAIVWMRKVYMLTMGVLGVIVSGTVAKSLAGNVNRKMPPGKVIN
FT                   DISVMLAAICSYLVLTVTLVVDEKTGSTSLSTNYLGSQGLVTSFVSAFITVNVYRFCIK
FT                   RDITIHLPKEVPGAISQAFRDIFPFSFVLLISGLLDIVSRFSLDVPFAQVFQQLLTPIF
FT                   KGVESYPAMMLIWFMCALLWFVGIHGPSIVLPAVTALQLSNMEENAQLLANGQFPYHSL
FT                   TPNFGNYIAAIGGTGATFVVPFILIFFMRSKQLKSVGKATITPVLFAVNEPLLFGMPVI
FT                   LNPYLFVPFLMTPPVNVFLGKVFIDFFGMNGFYIQLPWAFPGPLGLLIGTNFQSISFVF
FT                   LSLMLVVDILIYLPFCRAYDRQLLMKEDVVSSNDIILEEETSEIMPGEIDVIKSKELKV
FT                   LVLCAGSGTSAQLANAINEGAQLAEVRVIANSGAYGAHYDIMGVYDLIILAPQVRSYYR
FT                   EMKVDAERLGIQIVATRGMEYIHLTKSPSKALQFVLEHYQAV"
FT   gene            complement(484413..485852)
FT                   /locus_tag="SPT_0520"
FT   CDS_pept        complement(484413..485852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0520"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by match to protein family HMM PF02386"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23830"
FT                   /protein_id="ACO23830.1"
FT                   /translation="MNKSMIRYLLSKLLLIEAVLLLVPVAIAVYYRESSQVFTALFSTI
FT                   GILVLLGGSGSLQKPKNQRIYAKEGVLIVALCWILWSFFGGLPFVFSGQIPSLIDAFFE
FT                   ISSGFTTTGASILNDVSVLSRSLLFWRSFTHLIGGMGVLVFALAIMDNAKNSHLEVMKA
FT                   EVPGPVFGKVVSKLKNTAQILYLLYLALFSLFVIIYYLAGMPLYDSFVIAMGTAGTGGF
FT                   TVYNDGIAHYGSSLITYLVSIGVLVFGVNFNLYYYLMLRRIKAFFGDEELRAYLVIVLV
FT                   STGLISLNTLYLYPGFSKSFEMTFFQVSNIITTTGFGYGDITNWPLFSQFILLFLMAIG
FT                   GSAGSTAGGLKIIRGLILSKIAKNQILSILSPHRVLTLHVNKTVIDKDTQHKILKYFVI
FT                   YAMILLALIFIVSLDSNDFLVVTSAVFSCFNNIGPILGTTSSFSIFSPISKILLSFAMI
FT                   AGRLEIYPILLLFMKRTWSKR"
FT   gene            complement(485856..487205)
FT                   /locus_tag="SPT_0521"
FT   CDS_pept        complement(485856..487205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0521"
FT                   /product="potassium uptake protein, Trk family"
FT                   /note="identified by match to protein family HMM PF02080;
FT                   match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22869"
FT                   /protein_id="ACO22869.1"
FT                   /translation="MKIILVGGGKVGFALCRSLVAEKHDVLLIEQDEAVLNHIVSRFDI
FT                   IGILGNGADFAILEQASVQDCDIFIALTEHDEVNMIAAVLAKKMGAKETIVRVRNPEYS
FT                   NSYFKEKNILGFSLIVNPELLAARAIANIIDFPNALSVERFAGGRVSLMEFVVKSTSGL
FT                   CQMPISDFRKKFGNVIVCAIERDHQIIIPSGDMTVQDKDRIFVTGNRVDMILFHNYFKS
FT                   RAVKSLLIVGAGRIAYYLLGILKDSRIDTKVIEINPEIASFFSEKFPNLYIVQGDGTAK
FT                   DILLEESAQHYDAVATLTGVDEENLITSMFLDRVGVQKNITKVNRTSLLEIINAPDFSS
FT                   IITPKSIAVDTIMHFIRGRVNAQYSDLQAMHHLANGQIETLQFHIKEANKMTAKPLSQL
FT                   KLKKGVLIAAIIRKGKTIFPTGEDMLEVGDKLLVTTLLPNITKIYDLIAR"
FT   gene            487393..488241
FT                   /locus_tag="SPT_0522"
FT   CDS_pept        487393..488241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0522"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF01887"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23303"
FT                   /protein_id="ACO23303.1"
FT                   /translation="MNNNLLVLQSDFGLVDGAVSAMIGVALEESPTLKIHHLTHDITPY
FT                   NIFEGSYRLFQTVDYWPEGTTFVSVVDPGVGSKRKSVVAKTAKNQYIVTPDNGTLSFIK
FT                   KHVGIVAIREISEVANRRQNTEHSYTFHGRDVYAYTGAKLASGHITFEEVGPELSVEQI
FT                   VELPVVATIIEDHLVKGAIDILDVRFGSLWTSITREEFYKLEPEFGDRFEVTIYHADML
FT                   VYQNQVVYGKSFADVRIGQPILYINSLYRLGLAINQGSFAKAYNVGVGSSWTIEIKKIE
FT                   G"
FT   gene            488256..488804
FT                   /locus_tag="SPT_0523"
FT   CDS_pept        488256..488804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0523"
FT                   /product="protein YdcD"
FT                   /note="identified by match to protein family HMM PF07155"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24056"
FT                   /db_xref="GOA:C1CPZ1"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CPZ1"
FT                   /protein_id="ACO24056.1"
FT                   /translation="MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQA
FT                   LLSIIFGPIIGLLVGLIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRKYVRVINGVF
FT                   DWKDILIFNLIQLLANALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGT
FT                   LLLLAYAGTQTRAGSLKKD"
FT   gene            488811..489068
FT                   /locus_tag="SPT_0524"
FT   CDS_pept        488811..489068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22380"
FT                   /protein_id="ACO22380.1"
FT                   /translation="MKIKEQTRKLAAGCSKQCFEIVDRTDEVSSKHGFEVVDETDEVSN
FT                   HTYGKAKLTWFEEIFEEYKMMGKAGQLVFFDVYRLVRQVS"
FT   gene            489170..490852
FT                   /locus_tag="SPT_0525"
FT   CDS_pept        489170..490852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0525"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23608"
FT                   /protein_id="ACO23608.1"
FT                   /translation="MKEAIIEWKDFSFRYETQQEPTLQGIDLTIYKGEKVLIVGPSGSG
FT                   KSTLGQCLNGIIPNIYKGQTYGEFLIKGQAAFDMSIYDKSHLVSTVLQDTDGQFIGLSV
FT                   AEDLAFALENDVTALDEMKGRVYKWAEKLDLLPLLDQRPQDLSGGQKQRVSLAGVLIDE
FT                   SPILLFDEPLANLDPKSGQDIIELIDQIHKEEGTTTLIIEHRLEDVLHRPVDRIVLIND
FT                   GRILFNGSPDQLLATDLLTQNGIREPLYLTTLRQLGVDLVKEEQLANLDNLSISKGQVQ
FT                   LQNELAKETPALQSLFRLEEVSFSYDDRPILKSLHLDIKKGEKIAIVGKNGAGKSTLAK
FT                   AISSFIQTEGRYLWEKQDIKGDSVAERAERVGYVLQNPNQMISTNMIFDEVALGLRLRG
FT                   VDEKEIETRVYETLKICGLYEFRNWPISALSFGQKKRVTIASILVLGAEIILLDEPTAG
FT                   QDQKNYTEIMEFLEELHQKGHTIVMITHDMQLMLDYSDRVLVMVDGELIADTVPASLLS
FT                   DPELLVKANLKETSIFNLAKKLDVDPLDLTAFYKERREGCKLN"
FT   gene            490837..491667
FT                   /locus_tag="SPT_0526"
FT   CDS_pept        490837..491667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0526"
FT                   /product="cobalt transport family protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24086"
FT                   /protein_id="ACO24086.1"
FT                   /translation="MQAKLIGYQHRDTVIHRLSGAGKLLFFILVSLAAMISYDTRMLLL
FT                   IAIFSVFLLYLSEIRFKDVSFVAVFATVFAVLNVLMVYLFSPEYGVGLYGERSVIWQGI
FT                   GVYTLTSQELFYLLNLAIKYLCTIPLAIIFLMTTHPSQFASSLNQIGVPYKIAYSVSLT
FT                   LRYIPDLQEEFFTIKMSQEARGMELSKKASLMQRIKGNLLIITPLIFSSLERIDTIATA
FT                   MELRRFGKEKKRTWYSYQALKKGDYITLLLATLFLVVSLLLILQNQGRFYNPWK"
FT   gene            491860..492363
FT                   /locus_tag="SPT_0527"
FT   CDS_pept        491860..492363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0527"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22708"
FT                   /protein_id="ACO22708.1"
FT                   /translation="MTNHIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRKM
FT                   KRAGLDYWDKLEIYFYESLEDFMSQMKGKLYLISKFAEKIYSEVDLSTDEDHYFLFGRE
FT                   DKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQNFAGLELVHTYEV
FT                   DKLK"
FT   misc_binding    492539..492651
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element); riboswitch00002"
FT   gene            492816..493379
FT                   /locus_tag="SPT_0528"
FT   CDS_pept        492816..493379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23196"
FT                   /protein_id="ACO23196.1"
FT                   /translation="MTNTRRLSTIAILSAISFVLMYFDFPLLPAASFLKIEFSILPVLV
FT                   GLVVMDLPAALGVLLLRSLLKLLLNSQGVNTYIGLPMNIVALGVFVIVFALIWKKERTT
FT                   LRFLLGSLAGTVGLTLAMLVLNYVYAVPLYAKFANFDIGKILGLSNYLMTMVLPFNLIE
FT                   GVIFSVSFWLLYVLLKPTLKHYER"
FT   gene            493393..494019
FT                   /locus_tag="SPT_0529"
FT   CDS_pept        493393..494019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0529"
FT                   /product="PAP2 family protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23628"
FT                   /protein_id="ACO23628.1"
FT                   /translation="MKGSFALLLFVILGYMVKFYPETLVGFDQSIQTAIRGDLPDYLTI
FT                   LFRSLTRLIDIPVIITWVVIIAFVFYRKRWKIESFFMLGNLALAGLLIVTFKNIYQRPR
FT                   PAILHLVEEKGFSFPSGHSLAVTLMVGTLIVILSQRIKDQVWRKIVQIVLGLYLVSVLV
FT                   SRVYLGVHYPSDVLASLCVGLGVLFIEFPFYDKLRFQWRFKGKQK"
FT   gene            494046..494435
FT                   /locus_tag="SPT_0530"
FT   CDS_pept        494046..494435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22661"
FT                   /protein_id="ACO22661.1"
FT                   /translation="MKVNIADLHPTQLYLSEKKLQDIQMLYQSAETIQVDPISILAFGD
FT                   CLLITDGHHRAYQALLAGRDTISAEWDRGGGDELYHLYAQACEERKIYSVFDLEDRILA
FT                   QDGYEAKWYNWCDGFNQAATLLLKR"
FT   gene            494440..494889
FT                   /locus_tag="SPT_0531"
FT   CDS_pept        494440..494889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23239"
FT                   /protein_id="ACO23239.1"
FT                   /translation="MCFVPYYKVNYCEEAFAWYQDVNLVYLVDGVKLPYSQATLEAMYS
FT                   YLDRHGELFWIEVKEKGEWFPIGDITLSQDNLPIVIGNSAYQHRGLGKKILSALIELAR
FT                   VKGWKELRVKEIYTYNHASRRCFKSLGFVENGATEKGRSFILELV"
FT   gene            495017..495604
FT                   /gene="rpoE"
FT                   /locus_tag="SPT_0532"
FT   CDS_pept        495017..495604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="SPT_0532"
FT                   /product="DNA-directed RNA polymerase, delta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF05066"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23546"
FT                   /db_xref="GOA:C1CQ00"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQ00"
FT                   /protein_id="ACO23546.1"
FT                   /translation="MELEVFAGQEKSELSMIEVARAILELRGRDHEMHFSDLVNEIQNY
FT                   LGTSNSDIREALPLFYTELNFDGSFISLGDNKWGLRSWYGVDEIDEEIIALEENDDDEV
FT                   APKAKKKRVNAFMDGDSDAIDYNADDPEDEDAYEADPALSYDDENPDDEKNEVEAYDAE
FT                   INEIAPDDLGEDVDLNEDDDEFSDDDAETSEE"
FT   gene            495994..497601
FT                   /gene="pyrG"
FT                   /locus_tag="SPT_0533"
FT   CDS_pept        495994..497601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SPT_0533"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF06418; match to protein
FT                   family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24151"
FT                   /protein_id="ACO24151.1"
FT                   /translation="MSTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYI
FT                   NIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKER
FT                   RGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMK
FT                   ADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGI
FT                   KNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAPAADMTEWSAM
FT                   VDKVMNLKKQVKISLVGKYVELQDAYISVVEALKHSGYVNDVEVKINWVNANDVTAENV
FT                   AELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGL
FT                   EGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQ
FT                   RRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPN
FT                   RPEELYTAFVTAAVENSN"
FT   gene            complement(498160..499791)
FT                   /locus_tag="SPT_0534"
FT   CDS_pept        complement(498160..499791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0534"
FT                   /product="sodium-dependent phosphate transporter"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM PF02690; match to protein
FT                   family HMM TIGR00704"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22914"
FT                   /protein_id="ACO22914.1"
FT                   /translation="MSINWQEILFHFLGGLGLFLYSIKTMGDGLQQAAGDRLRFYIDKY
FT                   TSNPFFGVLVGIGMTALIQSSSGVTVITVGLVSAGLLTLRQAIGIVMGANIGTTVTSFL
FT                   IGFKLGNYALPMLFIGAVCLFFTKNRTVNNIGRILFGIGGIFFALNLMSGAMAPLKDLQ
FT                   VFKDYMIELSKNPVLGVFVGTGLTLLIQASSATIGILQNLYAGNLIDLQGALPVLFGDN
FT                   IGTTITAIIASLGANIAAKRVAGAHVAFNVIGTVVCVIFLVPFTVLIHWFEATLNLAPE
FT                   MTIAFAHGTFNITNTIVQFPFIGALAYFVTKIIPGEDEVVKYEPLYLDEHFIKQAPSIA
FT                   LGNAKKELLHLGNYAAKAFDLSYKYIIGLDEKVAEKGHKTEEAINTIDEQLTRYLIALS
FT                   SEALSQKESEVLTNILDSSRDLERIGDHTEALLNLTDYLQRKNVEFSDAALKELEEVYR
FT                   QTSDFIKDALDSVENNDIEKARSLVERHEAINKIERVLRKTHIKRLNKGECSTQAGVNF
FT                   IDIISHYTRVSDHAMNLAEKVFAEQI"
FT   gene            500152..505020
FT                   /locus_tag="SPT_0535"
FT   CDS_pept        500152..505020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0535"
FT                   /product="endo-beta-N-acetylglucosaminidase D"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF00754; match to protein
FT                   family HMM PF03644; match to protein family HMM PF07501;
FT                   match to protein family HMM PF07523; match to protein
FT                   family HMM PF07554; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23482"
FT                   /protein_id="ACO23482.1"
FT                   /translation="MIGAVLFAGPALAEETAVPENSGANTELVSGESEHSTNEADKQNE
FT                   GEHTRENKLEKAEGVATASETAEAASAAKPEEKASEVVAETPSAEAKPKSDKETEAKPE
FT                   ATNQGDESKPAAEANKTEKEVQPDVPKNTEKTLKPKEIKFNSWEELLKWEPGAREDDAI
FT                   NRGSVVLASRRTGHLVNEKASKEAKVQALSNTNSKAKDHASVGGEEFKAYAFDYWQYLD
FT                   SMVFWEGLVPTPDVIDAGHRNGVPVYGTLFFNWSNSIADQERFAEALKQDADGSFPIAR
FT                   KLVDMAKYYGYDGYFINQETTGDLVKPLGEKMRQFMLYSKEYAAKVNHPIKYSWYDAMT
FT                   YNYGRYHQDGLGEYNYQFMQPEGDKVPADNFFANFNWDKAKNDYTIATANWIGRNPYDV
FT                   FAGLELQQGGSYKTKVKWNDILDENGKLRLSLGLFAPDTITSLGKTGEDYHKNEDIFFT
FT                   GYQGDPTGQKPGDKDWYGIANLVADRTPAVGNTFTTSFNTGHGKKWFVDGKVSKDSEWN
FT                   YRSVSGVLPTWRWWQTSTGEKLRAEYDFTDAYNGGNSLKFSGDVAGKTDQDVRLYSTKL
FT                   EVTEKTKLRVAHKGGKGSKVYMAFSTTPDYKFDDADAWKELTLSDNWTNEEFDLSSLAG
FT                   KTIYAVKLFFEHEGAVKDYQFNLGQLTISDNHQEPQSPTSFSVVKQSLKNAQEAEAVVQ
FT                   FKGNKDADFYEVYEKDGDSWKLLTGSSSTTIYLPKVSRSASAQGTTQELKVVAVGKNGV
FT                   RSEAATTTFDWGMTVKDTSLPKPLAENIVPGATVIDSTFPKTEGGEGIEGMLNGTITSL
FT                   SDKWSSAQLSGSVDIRLTKPRTVVRWVMDHAGAGGESVNDGLMNTKDFDLYYKDADGEW
FT                   KLAKEVRGNKAHVTDITLDKPITAQDWRLNVVTSDNGTPWKAIRIYNWKMYEKLDTESV
FT                   NIPMAKAAARSLGNNKVQVGFADVPAGATITVYDNPNSQTPLATLKSEVGGDLASAPLD
FT                   LTNQSGLLYYRTQLPGKEISNVLAVSVPKDDRRIKSVSLETGPKKTSYAEGEDLDLRGG
FT                   VLRVQYEGGTEDELIRLTHAGVSVSGFDTHHKGEQNLTLQYLGQPVNANLSVTVTGQDE
FT                   ASPKTILGIEVSQEPKKDYLVGDSLDLSEGRFAVAYSNDTMEEHSFTDEGVEISGYDAQ
FT                   KTGRQTLTLRYQGHEVNFDVLVSPKAALNDEYLKQKLAEVEAAKNKVVYNFASPEVKEA
FT                   FLKAIEAAEQVLKDHETSTQDQVNDRLNKLTEAHKALNGQEKFKEEKTELDRLTGEVQE
FT                   LLAAKPNHPSGSALAPLLEKNKALVEKVDLSPEELATAKQSLKDLVALLKEDKPAVFSD
FT                   SKTGVEVHFSNKEKTVIKGLKVERVQASAEEKKYFAGEDAHVFEIEGLDEKGQDVDLSY
FT                   ASIVKIPIEKDKKVKKVFFLPEGKEAVELAFEQTDSHVIFTAPHFTHYAFVYESAEKPQ
FT                   PAKPAPQNKVLPKPTYQPASDQQKAPKLEVQEEKVAFHRQEHENTEMLVGEQRVIIQGR
FT                   DGLLRHVFEVDENGQRRLRSTEVIQEAIPEIVEIGTKVKTVPAVVATQEKPAQNTAVKS
FT                   EEASKQLPNTGTADANEALIAGLASLGLASLALTLRRKREDKD"
FT   gene            505110..506306
FT                   /gene="pgk"
FT                   /locus_tag="SPT_0536"
FT   CDS_pept        505110..506306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SPT_0536"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="identified by match to protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23880"
FT                   /db_xref="GOA:C1CQ04"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQ04"
FT                   /protein_id="ACO23880.1"
FT                   /translation="MAKLTVKDVDLKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIK
FT                   YIIEQGGRAILFSHLGRVKEEADKAGKSLAPVAADLAAKLGQDVVFPGVTRGAELEAAI
FT                   NALEDGQVLLVENTRYEDVDGKKESKNDPELGKYWASLGDGIFVNDAFGTAHRAHASNV
FT                   GISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEKADKV
FT                   LIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKALLEKANGKLILPVDSKEANAFAGYTE
FT                   VRDTEGEAVSEGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAGTIGVMD
FT                   AIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGLAALTEK"
FT   gene            506442..506969
FT                   /locus_tag="SPT_0537"
FT   CDS_pept        506442..506969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22299"
FT                   /protein_id="ACO22299.1"
FT                   /translation="MSYFKKYKFDKSQFKLGMRTFKTGIAVFLVLLIFGFFGWKGLQIG
FT                   ALTAVFSLRESFDESVHFGTSRILGNSIGGLYALVFFLLNTFFHEAFWVTLVVVPICTM
FT                   LTIMTNVAMNNKAGVIGGVAAMLIITLSIPSGETILYVFVRVLETFMGVFVAIIVNYDI
FT                   DRIRLFLEKKEK"
FT   gene            507046..507402
FT                   /locus_tag="SPT_0538"
FT   CDS_pept        507046..507402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0538"
FT                   /product="HTH-type transcriptional regulator GlnR"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23242"
FT                   /protein_id="ACO23242.1"
FT                   /translation="MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQELIKPDRNEG
FT                   NRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRRALHNELLQ
FT                   QGRFASVQSPFGRG"
FT   gene            507439..508785
FT                   /gene="glnA"
FT                   /locus_tag="SPT_0539"
FT   CDS_pept        507439..508785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="SPT_0539"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="identified by match to protein family HMM PF00120;
FT                   match to protein family HMM PF03951; match to protein
FT                   family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23290"
FT                   /protein_id="ACO23290.1"
FT                   /translation="MPITAADIRREVKEKNVTFIRLMFSDILGTMKNVEIPATDEQLDK
FT                   VLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWTVFPWGDENGSVAGLICDVYTTEGEP
FT                   FAGDPRGNLKRALRHMEEVGFKSFNLGPEPEFFLFKLDENGDPTLEVNDKGGYFDLAPT
FT                   DLADNTRREIVNVLTKMGFEVEASHHEVAVGQHEIDFKYDEVLRACDKIQIFKLVVKTI
FT                   ARKHGLYATFMAKPKFGIAGSGMHCNMSLFDAEGNNAFFDPNDPKGMQLSETAYHFLGG
FT                   LIKHAYNYTAIMNPTVNSYKRLVPGYEAPVYIAWAGRNRSPLVRVPASRGMGTRLELRS
FT                   VDPMANPYVAMAVLLEVGLYGIENKIEAPAPIEENIYIMTAEERKEAGITDLPSTLHNA
FT                   LKALTEDEVVKAALGDHIYTSFLEAKRIEWASYATFVSQWEIDNYLDLY"
FT   gene            complement(508881..509000)
FT                   /locus_tag="SPT_0540"
FT   CDS_pept        complement(508881..509000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23934"
FT                   /protein_id="ACO23934.1"
FT                   /translation="MPDIVFEIEFFHSDSLIFFYTSDDKSNSQKSQEDFSKNK"
FT   gene            508965..509114
FT                   /locus_tag="SPT_0541"
FT   CDS_pept        508965..509114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0541"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23278"
FT                   /protein_id="ACO23278.1"
FT                   /translation="MEKFNFKNNIGQENKLLQIEIYKFTNFYKLQNYTSVNIFSKDIFE
FT                   AIVN"
FT   gene            509567..510847
FT                   /locus_tag="SPT_0543"
FT   CDS_pept        509567..510847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0543"
FT                   /product="type I restriction enzyme specificity protein"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23872"
FT                   /protein_id="ACO23872.1"
FT                   /translation="MRIKSIYWNFGQNKPEKSFRYIDTSSIDRKKNIINYKNLQYLSPE
FT                   QAPSRARKLVSQNSVLFSTVRPYLKNIAVVRELKEYLIASTAFIVLDTLLNETYLKYYL
FT                   LSDNFINRVNNKSTGTSYPAINDYNFNLLLIALPPLSEQQRIIEAIESALEKVDEYAES
FT                   YNRLEQLDKEFPDKLKKSILQYAMQGKLVEQDPNDESVEVLLEKIRAEKQKLFEEGKIK
FT                   KKDLDISIVSQGDDNSYYGNKDETTSYPIYEIPEAWRYIKFASLVNFRIGKTPPRSEAT
FT                   FWGTEIPWVSISDMPISGYVTNTRESISKLALKSKKIDISPKGTLLMSFKLSIGKVAIL
FT                   DIPATHNEAIISIFPYANKENIIRDYLMIFLPLISTLGDSKDAIKGKTLNSTSISELLI
FT                   PISNHEEMKRIISKVDLLFQKVSQLFE"
FT   gene            complement(510795..512360)
FT                   /locus_tag="SPT_0542"
FT   CDS_pept        complement(510795..512360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0542"
FT                   /product="type I site-specific deoxyribonuclease chain S"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23728"
FT                   /protein_id="ACO23728.1"
FT                   /translation="MTPEQLKASILQRAMEGKLVPQNPNDEPASELLKRIKAEKEKLIS
FT                   EGKIKRDKKETEIFRGDDGKHYGKFADGSTQEIDVPYDIPDTWEWVRFSTLVEIVRGGS
FT                   PRPIKDYLTSEVDGINWIKIGDTEKGEKYINNVKEKIKKSGLNKTRFVKKGTFLLTNSM
FT                   SFGRPYILNVDGAIHDGWLAISNYENSLNKDYLFYILSSNVVYSQFLSLISGAVVKNLN
FT                   SDKVASILIPLPPLAEQQRIIEAIESALEKVDEYAESYNRLEQLDKEFPDKLKKSILQY
FT                   AMQGKLVEQDPNDESVEVLLEKIRAEKQKLFEEGKIKKKDLDISIVSQGDDNSYYGNIP
FT                   MNWVVIKIKDIFSMNTGLSYKKGDLSINNKGVRIIRGGNIKPLEFSLLDNDYYIDTQFI
FT                   SSEQVYLKHNQLITPVATSLEHIGKFARIDKDYDGVVAGGFIFQLTPFESSEIISKFLL
FT                   FNLSSPLFYKQLKAITKLSGQALYNIPKTTLSELLIPLAPFEEQELITQKVEKLFEKVN
FT                   QLWK"
FT   gene            complement(512360..513823)
FT                   /locus_tag="SPT_0544"
FT   CDS_pept        complement(512360..513823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0544"
FT                   /product="type I restriction enzyme"
FT                   /EC_number="2.1.1.72"
FT                   /note="identified by match to protein family HMM PF02384"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23146"
FT                   /protein_id="ACO23146.1"
FT                   /translation="MSITSFVKRIQDITRNDAGVNGDAQRIEQMSWLLFLKIYDSREMV
FT                   WELEEDEYESIIPEELKWRNWAHAQNGERVLTGDELLDFVNNKLFKELKELEITSNMPI
FT                   RKTIVKSAFEDANNYMKNGVLLRQVINVIDEVDFNSPEDRHSFNDIYEKILKDIQNAGN
FT                   SGEFYTPRAATDFIAEVLNPKLGESMADLACGTGGFLTSTLNRLSSQRKTSEDTKKYNT
FT                   AVFGIEKKAFPHLLAVTNLFLHEIDDPKIVHGNTLEKNVREYTDDEKFDIIMMNPPFGG
FT                   SELETIKNNFPAELRSSETADLFMAVIMYRLKENGRVGVILPDGFLFGEGVKTRLKQKL
FT                   VDEFNLHTIIRLPHSVFAPYTGIHTNILFFDKTKKTEETWFYRLDMPDGYKNFSKTKPM
FT                   KSEHFNPVRDWWENREEILEGKFYKSKSFTPSELAELNYNLDQCGFPKEEEEILDPFEL
FT                   IQNYQAERATLNHKIDNVLADILQLLEDK"
FT   gene            complement(513836..516169)
FT                   /locus_tag="SPT_0545"
FT   CDS_pept        complement(513836..516169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0545"
FT                   /product="type I restriction-modification system, R
FT                   subunit"
FT                   /EC_number="3.1.21.3"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF04313; match to protein
FT                   family HMM PF04851; match to protein family HMM PF08463"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22510"
FT                   /protein_id="ACO22510.1"
FT                   /translation="MVEFIKSKKEMSEEDIKANFITPAIVSKGWKNGEHIAYEEYFTDG
FT                   RIEVRGDKARRKEGKKSDYSLYYQFGTRIAIVEAKDNKHSVRAGLQQAIEYGEILDVPF
FT                   VYSSNGDGFIEHDRITREERELELDEFPTREELFSRMTKEKGLTYEITEAISTPYYTDA
FT                   FSMKTPRYYQQIAINRTIETVARGQKRVMFVMATGTGKTFMAFQIIHRLRKAGLAKRVL
FT                   FLADRNILVDQTMAEDFKPFEKVMTKITPKLLTAPEKLNSFEIYLGLYQQLTGEDGTET
FT                   HYQKFDKDFFDLIVIDEAHRGSAKENSNWRKIIDYFSSATQIGMTATPKETKNASNTEY
FT                   FGEPIYTYSLKQGIEDGFLAPYRVMRVNLDVDVDGYRPETGKVDTNGQLIEDRYYGRKD
FT                   FDKTIVIDDRTQRVAKFVSDYMKQSNARFDKTIVFCVDIDHAERMRAALVKENLDLVQE
FT                   DYRYVMQVTGDNAEGKAQLDNFMDVNSNFPAIVTTSKLLTTGVNAKTCRLIVLDSNIQS
FT                   MTEFKQIIGRGTRLYPQKGKEFFTIIDFRNVTNLFADPDFDGDPVKVLETGAKTVSGST
FT                   PGFVDEEGDPVEKYIVTDKQVTILNSTVQVLDENGKLITESLTDYTRKNILGSYATLND
FT                   FITVWHTADKKKLILDELYKKGVYLDAIRESEGISEQEIDDFDLLLKLAYGQKELTKTE
FT                   RINKLKQSGYLYKYSEEARAVLEILLNKYMDKGIGELESIETLKLPEFQIYGGTFKIIN
FT                   TYFGDKKRYLQAIKELEQELFTVA"
FT   gene            complement(516520..516648)
FT                   /locus_tag="SPT_0546"
FT   CDS_pept        complement(516520..516648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23980"
FT                   /protein_id="ACO23980.1"
FT                   /translation="MKIKNTFQLKELPPVTNFEKNGSRAKKRSKIGSIRIVKIRLA"
FT   gene            516777..517286
FT                   /locus_tag="SPT_0547"
FT   CDS_pept        516777..517286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23436"
FT                   /protein_id="ACO23436.1"
FT                   /translation="MNSRVEFRIFTIVDLDKEEEYLHEMHLKGWRYRTSRFGLFYFDQC
FT                   QPDDVIYRIYDSRFLKKYKHELQDFRDRGWELIGAGSCSILRKSSSDLLPEDQVYMSKG
FT                   LKWEVMRSRLRSCTATFLGGLVVCTSLFREDLSMSFFLIFVLYAFLISYLIHGYFRLKR
FT                   KYRVDE"
FT   gene            517450..518484
FT                   /locus_tag="SPT_0548"
FT   CDS_pept        517450..518484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0548"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22867"
FT                   /db_xref="GOA:C1CQ16"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQ16"
FT                   /protein_id="ACO22867.1"
FT                   /translation="MVTERQQDILNLIIDIFTKTHEPVGSKALQESINSSSATIRNDMA
FT                   ELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKAFDQEFFKLEDI
FT                   LQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLI
FT                   PRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVIDLFEHIFK
FT                   EMFNENIVMAGKVHLLNFANLAAYQFFDQPQKVALEIREGLREEQMQNVRVADGQESCL
FT                   ADLAVISSKFLIPYRGVGILAIIGPVNLDYQQLINQVNVVNRVLTMKLTDFYRYLSSNH
FT                   YEVH"
FT   gene            518511..519035
FT                   /gene="grpE"
FT                   /locus_tag="SPT_0549"
FT   CDS_pept        518511..519035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SPT_0549"
FT                   /product="co-chaperone GrpE"
FT                   /note="identified by match to protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22240"
FT                   /db_xref="GOA:C1CQ17"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQ17"
FT                   /protein_id="ACO22240.1"
FT                   /translation="MAQDIKNEEVEEVQEEEVVETAEETTPEKSELDLANERADEFENK
FT                   YLRAHAEMQNIQRRANEERQNLQRYRSQDLAKAILPSLDNLERALAVEGLTDDVKKGLG
FT                   MVQESLIHALKEEGIEEIAADGEFDHNYHMAIQTLPADDEHPVDTIAQVFQKGYKLHDR
FT                   ILRPAMVVVYN"
FT   gene            519515..521338
FT                   /locus_tag="SPT_0550"
FT   CDS_pept        519515..521338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0550"
FT                   /product="chaperone protein DnaK (Heat shock protein 70)
FT                   (Heat shock 70 kDaprotein) (HSP70)"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23549"
FT                   /db_xref="GOA:C1CQ18"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQ18"
FT                   /protein_id="ACO23549.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPDTVISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEDY
FT                   LGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKTDKEEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLSTAGDNKLGGDDFDQKIIDHLVAEFKKENGIDL
FT                   STDKMAMQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAGPLHLEMTLTRAKFDDLTRD
FT                   LVERTKVPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEV
FT                   VAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKA
FT                   KDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRKEEVDLRNEVDQAIFATE
FT                   KTIKETEGKGFDAERDAAQAALDDLKKAQEDNNLDDMKAKLEALNEKAQGLAVKLYEQA
FT                   AAAQQAQEGAEGAQATGNAGDDVVDGEFTEK"
FT   gene            521351..521704
FT                   /locus_tag="SPT_0551"
FT   CDS_pept        521351..521704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22422"
FT                   /protein_id="ACO22422.1"
FT                   /translation="MSVNKNNLSDIADYHEKIKFFEELFNLDYNPTEMLVTVERNGNVI
FT                   YKEFTEVAVGKSKYDYTSVFKDVMIYFSDHICQELHLYKTQDPHYNKFEFDLAKRSLKI
FT                   TTRDNTTIFISNE"
FT   gene            521909..523045
FT                   /gene="dnaJ"
FT                   /locus_tag="SPT_0552"
FT   CDS_pept        521909..523045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SPT_0552"
FT                   /product="chaperone protein DnaJ"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23798"
FT                   /protein_id="ACO23798.1"
FT                   /translation="MNNTEFYDRLGVSKNASADEIKKAYRKLSKKYHPDINKEPGAEDK
FT                   YKEVQEAYETLSDDQKRAAYDQYGAAGANGGFGGAGGFGGFNGAGGFGGFEDIFSSFFG
FT                   GGGSSRNPNAPRQGDDLQYRVNLTFEEAIFGTEKEVKYHREAGCRTCNGSGAKPGTSPV
FT                   TCGRCHGAGVINVDTQTPLGMMRRQVTCDVCHGRGKEVKYPCTTCHGTGHEKQAHSVHV
FT                   KIPAGVETGQQIRLAGQGEAGFNGGPYGDLYVVVSVEASDKFEREGTTIFYNLNLNFVQ
FT                   AALGDTVDIPTVHGDVELVIPEGTQTGKKFRLRSKGAPSLRGGAVGDQYVTVNVVTPTG
FT                   LNDRQKVALKEFATAGDLKVNPKKKGFFDHIKDAFDGE"
FT   gene            complement(523367..523561)
FT                   /locus_tag="SPT_0553"
FT   CDS_pept        complement(523367..523561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0553"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23344"
FT                   /protein_id="ACO23344.1"
FT                   /translation="MHHNLGNSYSIKIKKQTRKLGTDCSKHRFKVVDRTDEVSNHTHDK
FT                   PTLTWFEEIFEEYHSPFHN"
FT   gene            complement(523723..524010)
FT                   /locus_tag="SPT_0554"
FT   CDS_pept        complement(523723..524010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22873"
FT                   /protein_id="ACO22873.1"
FT                   /translation="MKLSNLLLFAGAAAGSYLVTKNRQTITDEVLNTTDRVQAIKDDVD
FT                   IIQNSLQIINQQKELIKEYQEDLTYKFKVLEKDIQTRLAVIKEMQGTEDK"
FT   gene            complement(524020..524430)
FT                   /locus_tag="SPT_0555"
FT   CDS_pept        complement(524020..524430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0555"
FT                   /product="histidine triad domain protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22412"
FT                   /protein_id="ACO22412.1"
FT                   /translation="MSDCIFCKIIAGEIPASKVYEDEQVLAFLDISQVTLGHTLVVPKE
FT                   HYRNLLEMDATSASQLFAQVPKVAQKVMKVTKAAGMNIISNCEEVAGQTVFHTHVHLVP
FT                   RYSADDDLKIDFIAHEPDFDKLAQVAETIKNA"
FT   gene            524498..525229
FT                   /locus_tag="SPT_0556"
FT   CDS_pept        524498..525229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0556"
FT                   /product="ABC-type transporter ATP-binding protein EcsA"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23570"
FT                   /protein_id="ACO23570.1"
FT                   /translation="MLEIKNLTGGYVHVPVLKDVSFTVESGQLVGLIGLNGAGKSTTIN
FT                   EIIGLLAPYSGSININGLTLQGDATSYRKQIGYIPETPSLYEELTLREHIETVAMAYGI
FT                   EQKVAFERVEPLLKMFRLEQKLDWFPVHFSKGMKQKVMIICAFVVDPSLFIVDEPFLGL
FT                   DPLAISDLIQLLEVEKQKGKSILMSTHVLDSAEKMCDAFVILHKGEVRAKGNLLQLREA
FT                   FDMPEASLNDIYLALTKEEDL"
FT   gene            525226..526275
FT                   /locus_tag="SPT_0557"
FT   CDS_pept        525226..526275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0557"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF05975"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23216"
FT                   /protein_id="ACO23216.1"
FT                   /translation="MKDLFLKRKQAFRKECLCYLRYVLNDHFVLFLLVLLGFLAYQYSQ
FT                   LLQHFPENHWPILLFVGITSVLLLLWGGIATYMEAPDKLFLLVGEEEIKLHLKRQTGIS
FT                   LVFWIFVQTLFLLLFAPLFLVMGYGLPVFLVYVLLLGVGKYFLFRQKASKFFTETGLDW
FT                   DYVISQESKRKQVLLRFFALFTQVKGISNSVKRRAYLDFILKVVQKVSGKIWQNLYLRS
FT                   YLRNGDLFALSLRLLLLSLLAQVFIEQSWIATAVVVLFNYLLLFQLLALYHAFDYQYLT
FT                   QLFPLDKGQKEKGLQEVVRGLISFVLLVELVVGLITFQEKLALLALLGAGLVLLVLYLP
FT                   YQVKRQMQD"
FT   gene            complement(526443..526772)
FT                   /locus_tag="SPT_0558"
FT   CDS_pept        complement(526443..526772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0558"
FT                   /product="BlpT protein, fusion"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22629"
FT                   /protein_id="ACO22629.1"
FT                   /translation="MTDTDPIKRAHTLITDLNKAYQACKQASADDVRFQEQLNSILGFL
FT                   AKTETVDNRFLIELEKFYQTSSLLMGLSALDPDAPTRAAWRAYDRFHFDQVKTKLILNE
FT                   NQRAN"
FT   gene            complement(527068..528414)
FT                   /locus_tag="SPT_0559"
FT   CDS_pept        complement(527068..528414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0559"
FT                   /product="Spn1 transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23862"
FT                   /protein_id="ACO23862.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKER
FT                   ISKYLATNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGF
FT                   FGDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVR
FT                   TGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPGRKASLMMH"
FT   gene            528756..529094
FT                   /locus_tag="SPT_0560"
FT   CDS_pept        528756..529094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0560"
FT                   /product="BlpS protein"
FT                   /note="identified by match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23270"
FT                   /protein_id="ACO23270.1"
FT                   /translation="MKHMIIQTQKTVYKVNIDDIYYIQTHPTKAHTVQIVTEKASFNML
FT                   QNLSNLENQCGETLMRCHRNCLVNLDKLKSIDFQERILFLGEEGQYAVRYARRRYREIR
FT                   QKWLKEGE"
FT   gene            529099..529836
FT                   /locus_tag="SPT_0561"
FT   CDS_pept        529099..529836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0561"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23262"
FT                   /protein_id="ACO23262.1"
FT                   /translation="MRIFVLEDDFSQQTRIETTIEKLLKAHHIIPSSFEVFGKPDQLLA
FT                   EVHEKGAHQLFFLDIEIRNEEMKGLEVARKIREQDPYALIVFVTTHSEFMPLSFRYQVS
FT                   ALDYIDKALSAEEFESRIETALLYANSQDSKSLAEDCFYFKSKFAQFQYPFKEVYYLET
FT                   SPRPHRVILYTKTDRLEFTASLEEVFKQEPRLLQCHRSFLINPANVVHLDKKEKLLFFP
FT                   NGGSCLIARYKVREVSEAINNLH"
FT   gene            529849..531189
FT                   /locus_tag="SPT_0562"
FT   CDS_pept        529849..531189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0562"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22774"
FT                   /protein_id="ACO22774.1"
FT                   /translation="MYIFWIILYTLITNGLEIVIFFKVDGIGLTFERIFKAFLLKILLA
FT                   FVFVMIGYMIGNVYLSYFMEPLYGIGLSFLLLRGLPKKLLFFYGLFPMILVNLFYRGVS
FT                   YFVLPFLGQEQVYDGYSFTGLCIIIFNFFISLAFLKWLDYDFTSLRREILDTGFQKSLT
FT                   KINWIMGAYYLVIQSLSYFEYEQGIQSTTVRHLILVFYLLFFMGVIKKLDTYLKDKLHD
FT                   RLDQEQVLRYRDMERYSRHIEELYKEVRSFRHDYTNLLTSLRLGIEEEDMEQIKEVYDL
FT                   VLKDSSKKLQDNKYDLGRLVNVRDRALKSLLAGKFIKAREKDIVFNVEVPEEIQVEGMR
FT                   LLDFLTIVSILCDNAIEASAEAGQPHVSIAFLKSGAQETFIIENSIKEEGIDISEIFSF
FT                   GVSSKGEERGVGLYTVMKIVESYPNASLNTTCQDQVFRQVLTMIPTE"
FT   gene            complement(531429..532775)
FT                   /locus_tag="SPT_0563"
FT   CDS_pept        complement(531429..532775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0563"
FT                   /product="Spn1 transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23320"
FT                   /protein_id="ACO23320.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKER
FT                   ISKYLATNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGF
FT                   FGDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVR
FT                   TGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPGRKASLMMH"
FT   gene            complement(532942..533097)
FT                   /locus_tag="SPT_0564"
FT   CDS_pept        complement(532942..533097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0564"
FT                   /product="bacteriocin-type signal sequence domain protein"
FT                   /note="identified by match to protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22423"
FT                   /protein_id="ACO22423.1"
FT                   /translation="MDKKQNLTSFQELTTTELNQITGGGLWEDILYSLNIIKHNNTKGL
FT                   HHPIQL"
FT   gene            complement(533154..534515)
FT                   /locus_tag="SPT_0565"
FT   CDS_pept        complement(533154..534515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0565"
FT                   /product="BlpC ABC transporter"
FT                   /note="identified by match to protein family HMM TIGR01000"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23674"
FT                   /protein_id="ACO23674.1"
FT                   /translation="MNPNLFRSVEFYQRRYHNYATVLIIPLSLLFTFILIFSLVATKEI
FT                   TVTSQGEITPTSVIASIQSTSDNPILANHLVANQVVEKGDLLIKYSETMEESQKTALET
FT                   QLQRLEKQKEGLGILKQSLEKATDLFSSEDEFGYHNTFMNFTKQSHDIELGISKTNTEV
FT                   SNQANLTNSSSSAIEQEITKVQQQIGEYQELRDTIVNKRARLPTGNPHQSILNRYLIAS
FT                   QEQTQGTAEEPFLSQINQSIAGLESSIASLKIQQAGIGSVATYDNSLATKIEVLRTQFL
FT                   QTASQQQLTVENQLTELKVQLDQATQRLGNNTLTAPSKGIVHLNSEFEGKNRIPTGTEI
FT                   AQIFPVITDTREVLITYYVSSDYLPLLDKGQTVRLKLEKIGNHGTTIIGQLQTIDQTPT
FT                   RTEQGNLFKLTALAKLSNEDSKLIQYGLQGRVTSVTAKKTYFDYFKDKILTHSD"
FT   gene            complement(534526..535784)
FT                   /pseudo
FT                   /locus_tag="SPT_0566"
FT                   /note="transport/processing ATP-binding protein ComA,
FT                   internal deletion; this gene contains a frame shift which
FT                   is not the result of sequencing error; identified by match
FT                   to protein family HMM PF03412"
FT   gene            536059..536307
FT                   /locus_tag="SPT_0568"
FT   CDS_pept        536059..536307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0568"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23506"
FT                   /protein_id="ACO23506.1"
FT                   /translation="MNTKMMSQFSVMDNEMLASIEGGTDWGTVGKGAVYGAGIGVAMCA
FT                   VGGLLTGGSTWAMTAGCAWAGAKLGGSFTAIADNLWP"
FT   gene            536323..536532
FT                   /locus_tag="SPT_0569"
FT   CDS_pept        536323..536532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0569"
FT                   /product="bacteriocin-type signal sequence domain protein"
FT                   /note="identified by match to protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24171"
FT                   /protein_id="ACO24171.1"
FT                   /translation="MFNYKIVDNQELSNISGGGLGGDVVVGALSGAFQAGQSCIAGGPQ
FT                   AYLICATGGAIVGGILAYGLRPPK"
FT   gene            537734..538309
FT                   /locus_tag="SPT_0570"
FT   CDS_pept        537734..538309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0570"
FT                   /product="ABC transporter ATP binding protein-unknown
FT                   substrate"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22562"
FT                   /protein_id="ACO22562.1"
FT                   /translation="MFVGFLVYVIVATVGYTINQGDYFQNEHLFIIAKTFLISLSVAYA
FT                   KWFDMISLRRLTKKEVLLFIASFLLCVLVNIGYHSLFTVSSGAGYQHLEAASTGISLSF
FT                   IASATVFGPILEEFVFRGILQGVVFENSWLGLVLTASLFSFLHAPYDFPSFIYYLFGGF
FT                   MLGFAYKKSQKLSVAILVYICYNCLSFL"
FT   gene            538536..538724
FT                   /locus_tag="SPT_0571"
FT   CDS_pept        538536..538724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23365"
FT                   /protein_id="ACO23365.1"
FT                   /translation="MAALNTSLTTNIKFGLVGTVGGRFAGYGMYVLGYPGDYLDITNHR
FT                   VVSAKTSHKSYQILEND"
FT   gene            538820..539158
FT                   /locus_tag="SPT_0572"
FT   CDS_pept        538820..539158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0572"
FT                   /product="immunity protein BlpL"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24084"
FT                   /protein_id="ACO24084.1"
FT                   /translation="MVVSTYLFLSRQFLNFSLVFQFLLVIINLASILATVYLTREMRIR
FT                   KFEDDDLVSPRTNQLMFIGLTGFMSIICLYRGITAAESYQQIIAYIGAVLCLLIMLLLI
FT                   WGLKYYKK"
FT   gene            539361..540164
FT                   /pseudo
FT                   /locus_tag="SPT_0574"
FT                   /note="transposase, degenerate; this region contains one or
FT                   more premature stops and/or frameshifts; identified by
FT                   match to protein family HMM PF01609"
FT   gene            540314..540547
FT                   /locus_tag="SPT_0576"
FT   CDS_pept        540314..540547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0576"
FT                   /product="bacteriocin BlpM"
FT                   /note="identified by match to protein family HMM TIGR01847"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22442"
FT                   /protein_id="ACO22442.1"
FT                   /translation="MDTKIMEQFHEMDITMLSSIEGGKNNWQTNVLEGGGAAFGCAAGG
FT                   VKYGRLLGPWGAAIGGIGGAVVCGYLAYTATS"
FT   gene            541056..541745
FT                   /locus_tag="SPT_0577"
FT   CDS_pept        541056..541745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0577"
FT                   /product="BlpY protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22434"
FT                   /protein_id="ACO22434.1"
FT                   /translation="MKKYQLLFKISAVFSYLFFVFGLSQMTLIIQNYWQFSSQIGNFVW
FT                   IQNFLSLLFSGVMIWILVKTGHGYLFHIPRKKWLWYSILTVLVVVLQISFNVQTAKHVQ
FT                   STAEGWAVLIGYSGTNFAELGIYVTLFFLTPLMEELIYRGLLQHAFFKHSRFGLDLLLP
FT                   SILFALPHFLSLPSLLDIFVFATFGIIFAGLTRYTKSIYPSYAVHVINNIVATFPFLLT
FT                   FLHRVLG"
FT   gene            541787..542020
FT                   /pseudo
FT                   /locus_tag="SPT_0578"
FT                   /note="BlpZ; this region contains one or more premature
FT                   stops and/or frameshifts"
FT   gene            542171..542782
FT                   /locus_tag="SPT_0579"
FT   CDS_pept        542171..542782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0579"
FT                   /product="ABC transporter ATP binding protein-unknown
FT                   substrate"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23139"
FT                   /protein_id="ACO23139.1"
FT                   /translation="MEFFDKFHALCFGFLVLIIVITVPYTINHGDFFQNESALIIVSLL
FT                   VTSLSVAYARKFEMISFGMLSKKQLLLFIAIFLLSVLETLVYIHFFAVSSGSGVQHLAE
FT                   VSRGISLSLILTTSVFGPIQEELIFRGLLQGAVFDNSWLGLVLTSSLFSFMHGPSNVPS
FT                   FIFYLLGGLLLGLAYKKSQNLWVSTLVHMFYNSWPLLYYL"
FT   gene            542943..543737
FT                   /locus_tag="SPT_0580"
FT   CDS_pept        542943..543737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0580"
FT                   /product="phosphotransferase enzyme family"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22606"
FT                   /protein_id="ACO22606.1"
FT                   /translation="MDLGDNELTLTPIPGKSGKAYMGSYPDGKRIFVKMNTSPILPGLA
FT                   REQIAPQLLWSRRLADGRDMCAQEWLTGKILTPYDMNRKQIVNILTRLHRSRPLMTQLS
FT                   RLGYAMETPVDLLQSWQETAPDALRKNHFISEVMADLRQTIPGFREDHATIVHGDVRHS
FT                   NWIETDSGLIYLVDWDSVRLTDRMFDVAHMLCHYISEHQWKEWLTYYGYKYNQTVLSKL
FT                   YWYGQLSYLSQISKYYMNQDLENVNREIHGLRHFRDKYGKRR"
FT   gene            543734..544369
FT                   /gene="trmB"
FT                   /locus_tag="SPT_0581"
FT   CDS_pept        543734..544369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="SPT_0581"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22727"
FT                   /db_xref="GOA:C1CQ43"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQ43"
FT                   /protein_id="ACO22727.1"
FT                   /translation="MRVRNRKGATELLEANPQYVVLNPLEAKAKWRDLFGNDNPIHVEV
FT                   GSGKGAFVSGMAKQNPDINYIGIDIQKSVLSYALDKVLEAGVSNIKLLWVDGSDLTDYF
FT                   EDGEIDRLYLNFSDPWPKKRHEKRRLTYKTFLDTFKRILPENGEIHFKTDNRGLFEYSL
FT                   VSFSQYGMKLNGVWLDLHASDFEGNVMTEYEQKFSNKGQVIYRVEAEF"
FT   gene            544495..544974
FT                   /locus_tag="SPT_0582"
FT   CDS_pept        544495..544974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23079"
FT                   /db_xref="GOA:C1CQ44"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQ44"
FT                   /protein_id="ACO23079.1"
FT                   /translation="MDAIATIVELVREVVEPVIEAPFELVDIEYGKIGSDMILSIFVDK
FT                   PEGITLNDTADLTEMISPVLDTIKPDPFPEQYFLEITSPGLERPLKTKDAVAGAVGKYI
FT                   HVGLYQAIDKQKVFEGTLLAFEEDELTMEYMDKTRKKTVQIPYSLVSKARLAVKL"
FT   gene            545018..546154
FT                   /gene="nusA"
FT                   /locus_tag="SPT_0583"
FT   CDS_pept        545018..546154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="SPT_0583"
FT                   /product="transcription termination factor NusA"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF08529; match to protein
FT                   family HMM TIGR01953"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23393"
FT                   /protein_id="ACO23393.1"
FT                   /translation="MSKEMLEAFRILEEDKGIKKEDIIDAVVESLRSAYRRRYGQSDSV
FT                   AIDFNEKTGDFTVYTVREVVDEVFDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGR
FT                   VAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSK
FT                   QDQIPGEVFASHDRIEVYVYKVEDNPRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEI
FT                   MSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIE
FT                   ENIDVIEWVADPAEFIYNAIAPAEVDQVIFDENDSKRALVVVPDNKLSLAIGRRGQNVR
FT                   LAAHLTGYRIDIKSASEFEAMEDAASVELEVENDTVEE"
FT   gene            546176..546469
FT                   /locus_tag="SPT_0584"
FT   CDS_pept        546176..546469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0584"
FT                   /product="putative chain a, hypothetical cytosolic protein
FT                   coded by gene from nusainfb, ylxr homologue"
FT                   /note="identified by match to protein family HMM PF04296"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23576"
FT                   /protein_id="ACO23576.1"
FT                   /translation="MKTRKIPLRKSVVSNEVIDKRDLLRIVKNKEGQVFIDPTGKANGR
FT                   GAYIKLDNAEALEAKKKKVFNRSFSMEVEESFYDELIAYVDHKVKRRELGLE"
FT   gene            546462..546761
FT                   /locus_tag="SPT_0585"
FT   CDS_pept        546462..546761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0585"
FT                   /product="ribosomal protein HS6-type"
FT                   /note="identified by match to protein family HMM PF01248"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24145"
FT                   /protein_id="ACO24145.1"
FT                   /translation="MNKQKISNLLGLAQRAGRIISGEELVVKAIQDGKAKLVFLAHDAG
FT                   PNLTKKIQDKSHYYQVEIVTVFSTLELSIAVGKSRKVLAVTDAGFTKKMRSLME"
FT   gene            546778..549570
FT                   /locus_tag="SPT_0586"
FT   CDS_pept        546778..549570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0586"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22666"
FT                   /db_xref="GOA:C1CQ48"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQ48"
FT                   /protein_id="ACO22666.1"
FT                   /translation="MSKKRLYEIAKELGKESKEVVARAKELGLDVKSHSSSVEEAVAAK
FT                   IAASFKPAAAPKVEAKPAAPKVSAEKKAEKSEPAKPAVAKEEAKPAEPVAPKTEKVAAK
FT                   PQSRNFKAEREARAKEQAERRKQNKGNNRDQQQNGNRQKNDGRNGGKQGQSNRDNRRFN
FT                   DQAKKQQGQQKRRNERRQQEDKRSNQAAPRIDFKARAAALKAEQNAEYARSSEERFKQY
FT                   QAAKEALAQANKRKEPEEIFEEAAKLAEQAQQVQAVVEVVPEKKEPAVDTRRKKQARPD
FT                   KNRDDYDHEEDGPRKQQKNRSSQNQVRNQKNSNWNNNKKNKKGNNKNNRNQTPKPVTER
FT                   KFHELPTEFEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVD
FT                   YGIEAKQKVEVDNADIERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSR
FT                   VATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDG
FT                   VMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEI
FT                   SAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLN
FT                   VQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSAR
FT                   AAGEERAKRALMKQRQATQRVSLENLFDTLKAGELKSVNVIIKADVQGSVEALSASLQK
FT                   IDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHS
FT                   IIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKV
FT                   RVIRDGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAYVMEEIKR
FT                   "
FT   gene            549821..550171
FT                   /gene="rbfA"
FT                   /locus_tag="SPT_0587"
FT   CDS_pept        549821..550171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="SPT_0587"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by match to protein family HMM PF02033;
FT                   match to protein family HMM TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23714"
FT                   /db_xref="GOA:C1CQ49"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQ49"
FT                   /protein_id="ACO23714.1"
FT                   /translation="MANHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDL
FT                   SVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGN
FT                   KIDEMLRNLDKN"
FT   gene            550450..551229
FT                   /locus_tag="SPT_0588"
FT   CDS_pept        550450..551229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24247"
FT                   /protein_id="ACO24247.1"
FT                   /translation="MAEQDLAMQVLQQVVKLPVVKVDRSKFLVDKFSKELDPKDIPTLL
FT                   EQGPTTLLSQEILDRVANACIRDNVLLASGTSVLAGLPGGLAMAITIPADVAQFYAFSL
FT                   KLAQELGYIYGYEALWTSREELSEDAQNTLLLYLGVMLGVNGTAALLRAGGITIAKQVM
FT                   KTVPNKALTKTLWYPILKKVLRIFGVNLTKGGLAKGMGKFIPILGGIISGGLTFATMKP
FT                   MGESLQKELSKLVNYSEVQYQEDVETIRKEAEIIEGE"
FT   gene            551231..551413
FT                   /locus_tag="SPT_0589"
FT   CDS_pept        551231..551413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22305"
FT                   /protein_id="ACO22305.1"
FT                   /translation="MGLIKTLAKIYGNYFLTVQGVKVMKTIKKDDHVVVGLGKLFIADK
FT                   LMDTARWLIKPEDKK"
FT   gene            551410..551562
FT                   /locus_tag="SPT_0590"
FT   CDS_pept        551410..551562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22894"
FT                   /protein_id="ACO22894.1"
FT                   /translation="MKFFWGLLAIIFIKPIIGIVKFFWMIISFAVQLLFYKIVFKILDW
FT                   LFKLI"
FT   gene            complement(551692..551844)
FT                   /locus_tag="SPT_0591"
FT   CDS_pept        complement(551692..551844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0591"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22899"
FT                   /protein_id="ACO22899.1"
FT                   /translation="MKIKEQTRKLAAGCSKQCFEVVDRTDEVSSKHRFEVVDRTDEVSN
FT                   IYTAR"
FT   gene            551875..552108
FT                   /locus_tag="SPT_0592"
FT   CDS_pept        551875..552108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08984"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22505"
FT                   /protein_id="ACO22505.1"
FT                   /translation="MDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPLMRNTVGRK
FT                   VSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD"
FT   gene            552108..553442
FT                   /locus_tag="SPT_0593"
FT   CDS_pept        552108..553442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0593"
FT                   /product="hemerythrin HHE cation binding domain subfamily,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01814;
FT                   match to protein family HMM PF04282"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22754"
FT                   /protein_id="ACO22754.1"
FT                   /translation="MADERIHVLRDILLELHNGASPESVQDRFDATFTGVSAIEISLME
FT                   HELMNSDSGVTFEDVMELCDVHANLFKNAIKGVEVSDTEHPGHPVRVFKEENLALRAAL
FT                   IRIRRLLDTYELMEDEEMLAEMRKGLVRQMGLVGQFDIHYQRKEELFFPIMERYGHDSP
FT                   PKVMWGVDDQIRELFQTALTTAKSLPEVSISSVKEAFEAFATEFESMIFKEESILLMIL
FT                   LESFTQDDWLQIAEESDAYGYAIIRPSEKWVPERQSFIEEKIAEEPVQLDTAEGQVQQV
FT                   IDTPEGHFTITFTPKEKEAVLDRHSQQAFGNGYLSVEQANLILNHLPMEITFVNKEDIF
FT                   QYYNDNTPADEMIFKRTPSQVGRNVELCHPPKYLDKVKTIMKGLREGSKDKYEMWFKSE
FT                   SRGKFVHITYAAVHDEDGEFQGVLEYVQDIQPYREIDTDYFRGLE"
FT   gene            553452..553706
FT                   /locus_tag="SPT_0594"
FT   CDS_pept        553452..553706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08930"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22325"
FT                   /protein_id="ACO22325.1"
FT                   /translation="MSYEQEFMKEFEAWVNTQIMINDMAHKESQKVYEEDQDERAKDAM
FT                   IRYESRLDAYQFLLGKFENFKAGKGFHDLPEGLFGERNY"
FT   gene            553802..554197
FT                   /locus_tag="SPT_0595"
FT   CDS_pept        553802..554197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0595"
FT                   /product="superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24180"
FT                   /protein_id="ACO24180.1"
FT                   /translation="MSKKLNRKKQLRNGLRRAGAFSSTVTKVVDETKKVVKRAEQSASA
FT                   AGKAVSKKVEQAVEATKEQAQKVANSVEDFAANLGGLPLDRAKTFYDEGIKSASDFKNW
FT                   TEKELLALKGIGPATIKKLKENGIKFK"
FT   gene            554610..555059
FT                   /locus_tag="SPT_0596"
FT   CDS_pept        554610..555059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0596"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23761"
FT                   /protein_id="ACO23761.1"
FT                   /translation="MIGVVARENAAEQIKQYQKFTVNISDETSMLAMEQAGFISHQEKL
FT                   ERLGVHYEISERTQTPILDACPLVLDCRVDRIVEEDGICHIFAKILERLVVPELLDEKG
FT                   HFKNQLFAPTYFMGDGYQRVYRYLDKRVDMKGSFIKKARKKDGKN"
FT   gene            555046..555606
FT                   /locus_tag="SPT_0597"
FT   CDS_pept        555046..555606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0597"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22733"
FT                   /protein_id="ACO22733.1"
FT                   /translation="MARTELPDKIETECLVLRVRTVADAEDIFDYASLPEVAYPAGFPP
FT                   VKTLEDEIYYLEHILPERNQKENLPAGYGIVVKGTDKIVGSVDFNHRHEDDVLEIGYTL
FT                   HPDYWGRGYVPEAARALIDLAFKDLGLHKIELTCFGYNLQSQRVAEKLGFTLEARIRDR
FT                   KDAQGNCCDDLRYAFLKSEWEVI"
FT   gene            555606..556184
FT                   /locus_tag="SPT_0598"
FT   CDS_pept        555606..556184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0598"
FT                   /product="shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24071"
FT                   /protein_id="ACO24071.1"
FT                   /translation="MHLFIIGAPASGKMTIGQELSRLTDATLFYNHQAIDFALEIYQDY
FT                   TEEMWEFVRGITFSFLGASARNQRSVILTDVIDFSNQYHLIYLKQIQSLLDDYHQEILF
FT                   VELETSLEECIRRNRTENRLKYKPLKRHIEVSEREIIETAETLQLNSQHQPNELNHYFK
FT                   INNTNLSAEEAAKQIQNKINKIEKGHTHV"
FT   gene            556177..558828
FT                   /gene="valS"
FT                   /locus_tag="SPT_0599"
FT   CDS_pept        556177..558828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="SPT_0599"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23924"
FT                   /protein_id="ACO23924.1"
FT                   /translation="MSKELSPKYNPAEVEAGRYQKWLDADVFKPSGDQKAKPYSIVIPP
FT                   PNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGIS
FT                   RYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDL
FT                   YKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPE
FT                   TMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDP
FT                   NDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRV
FT                   HSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMEN
FT                   VHDWVISRQLWWGHQIPAWYNADGEMYVGEEAPEGDGWTQDEDVLDTWFSSALWPFSTM
FT                   GWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQ
FT                   GRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWN
FT                   ISRYILMNNEGLTLDVVHDNVTKVATGEAGNVTDRWILHNLNETIGKATANFDKFEFGV
FT                   AGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHPIMPFVT
FT                   EEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPIT
FT                   ILVKTSDSDLEAFFNSNVNYIKRFTNPEHLEIASTIPAPELAMSSVITGAEIYLPLADL
FT                   LNVEEELARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKECDKQADYQAKYDAT
FT                   VARIDEMKKLVK"
FT   gene            558909..559073
FT                   /locus_tag="SPT_0600"
FT   CDS_pept        558909..559073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0600"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23468"
FT                   /protein_id="ACO23468.1"
FT                   /translation="MGKIVAIDLFSGAGGTTSGLKKSGIDVQVAVEIDSVAVKTYKLNN
FT                   PEVSVIDME"
FT   gene            559124..560503
FT                   /pseudo
FT                   /locus_tag="SPT_0601"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            561106..561909
FT                   /locus_tag="SPT_0602"
FT   CDS_pept        561106..561909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0602"
FT                   /product="Fic protein family"
FT                   /note="identified by match to protein family HMM PF02661"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22370"
FT                   /protein_id="ACO22370.1"
FT                   /translation="MQSTYNIDNPNLSYEAKRDLWRIGFGLQKVDNLVPSAYMESLAEK
FT                   QSRGELTYEQVYEDATAYHHTIDASTEEADLVSLRIVELLSRRGFSFSPATLLAIHKEL
FT                   FQDIFEPSIPVGQFRQTNITKNEPVLNGESVVYSDYSMIQMTLDYDFNQEKQVAYATLT
FT                   QADVVKQIQHFISGIWQIHPFREGNTRTVTVFLIQYLREFGFDIDNTPFQQHSKYFRDA
FT                   LVLDNAKILQRRSEFLTAFFENLLLGGQNDLFSEKMYLDLDLDFS"
FT   gene            complement(562025..562858)
FT                   /locus_tag="SPT_0603"
FT   CDS_pept        complement(562025..562858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0603"
FT                   /product="integrase core domain protein"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22793"
FT                   /protein_id="ACO22793.1"
FT                   /translation="MTEFSLVLLLKSIKLARWTYYYHLKQLDKTDKDQELKAEIQSIFI
FT                   EHKGNYAYRRIYLELRNRAYLVNHKRVQGLMKVLNLQAKMRQKRKYSSHKGDVGKKAEN
FT                   LIQGQFEGSKTMEKCYTDVTEFAIPASTQKLYLSPVLDGFNSEIIAFNLSCSPNLEQVQ
FT                   TMLEQAFTEKHYENTILHSDQGWQYQHDSYHQFLEGKGIQASMSRKGNSQDNGMMESFF
FT                   GILKSEMFYGYEKTFKSLNQLEQAIVDYIDYYNNKRIKVKLKGLSLVQYRTKSFG"
FT   gene            complement(563084..563296)
FT                   /pseudo
FT                   /locus_tag="SPT_0604"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            563356..563538
FT                   /locus_tag="SPT_0605"
FT   CDS_pept        563356..563538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23959"
FT                   /protein_id="ACO23959.1"
FT                   /translation="MKSQKIKVSFTQSKIVTPILLVNKTIVWYGAMPLLGKVDEMTILR
FT                   LESASIASELVAGLR"
FT   gene            563838..564677
FT                   /locus_tag="SPT_0606"
FT   CDS_pept        563838..564677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0606"
FT                   /product="transcription antiterminator LicT"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23507"
FT                   /protein_id="ACO23507.1"
FT                   /translation="MIIKRILNHNAVIAQSKKDIDILLFGRGIAFGRKTGDKVNPIDIE
FT                   KSFFLKNRDNMTRFTEMFINVPLELVYITEKIINLGKITLGNNFDEIIYINLTDHISSS
FT                   IERYKEGVIISNPLRWEISKYYKEEFELGKRALQIIKKELGIELPIDEAAFIALHFVNA
FT                   NLENNFQESYKITEIIMGIEKIIQDFYCTEFNQDSIDYYRFITHIKLFAHRLVENTTYC
FT                   DDDDEDLLALMKNKYPREYECGEQVAMFIQTEYNYLLTSSELVYLMAHIRRLTKNLD"
FT   gene            564695..566533
FT                   /locus_tag="SPT_0607"
FT   CDS_pept        564695..566533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0607"
FT                   /product="pts system beta-glucoside-specific eiibca
FT                   component (eiibca-bgl) (eii-bgl)"
FT                   /EC_number="2.7.1.69"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23026"
FT                   /protein_id="ACO23026.1"
FT                   /translation="MSYKDTVQKILDVIGGEKNVNRVTHCVTRLRLELKDENLVNDDDV
FT                   KKIPGVIGIMKKNGQYQIILGNDVANYYKEFVKLGNFESDSVNQGYKGNILERIIEYIA
FT                   GSMTPIIPAMLGGGMLKVLVIILPMLGILQSDSQTIAFLTFFGDAPYYFLPLLLAYSAS
FT                   QKLKVTSTLAMSVAGVLLHPNFVQMVQSGNPLSLFGAPVTPASYGSSVVPILIMVWLMK
FT                   YIEKIIAKLTPAITKSFLQPTLVLLVSSCIALVVVGPIGVIVGEGLSNLVGQMYGVAGW
FT                   LTLAILGAIMPFIVMTGMHWAFAPIFLAASIATPDVLILPAMLGSNLAQGAASMAVALK
FT                   SKNNNTKQIAFAAGFSALLAGITEPALYGVTLKYKKPLYAAMIGGGLAGLFAGLTSVKA
FT                   YLFAVPSLIALPQFIYSDVPSNIVNALIVAVISVVITFVLAYIFGIDEEESSSNLEVEA
FT                   GVSNKKMIFSPISGEIIPLSDVQDKTFSDKLIGDGVAIIPSEGKVYAPFDGKITNIFPT
FT                   KHAIGLKSDEGVELLIHIGLDTVELKGQGFISHVEEGDRVFKNQLIFEMDLNLIKTKGY
FT                   ETVTPVIVTNTNDFLDVLVLPNNQTIEHSKELLVIL"
FT   gene            566546..567961
FT                   /locus_tag="SPT_0608"
FT   CDS_pept        566546..567961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0608"
FT                   /product="beta-glucosidase (Gentiobiase) (Cellobiase)
FT                   (Beta-D-glucoside glucohydrolase) (Amygdalase)"
FT                   /EC_number="3.2.1.21"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23958"
FT                   /protein_id="ACO23958.1"
FT                   /translation="MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEAT
FT                   ENPTEDNLKLLGIDFYHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKY
FT                   YDELFDELHAHGIEPLVTLSHYETPLYLARKYHGWIDRRMIHFYEKFARTVLERYKDKV
FT                   KYWLTFNEVNSVLELPFTSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEF
FT                   KVGCMVLAMPAYPMTPNPKDVWATHEYENLNYLFSDVHVRGYYPNYAKRYFKEHDINIE
FT                   FAAEDAELLKNYTVDFLSFSYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQI
FT                   DPIGLRIILNRYYDRYQIPLFIVENGLGAKDQLIKDEFNNLTVQDDYRIQYMEEHLLQV
FT                   AEALQDGVEIMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGNGTFNRYKKMSFTWY
FT                   KGVIESNGESLFK"
FT   gene            568511..569599
FT                   /gene="pheS"
FT                   /locus_tag="SPT_0609"
FT   CDS_pept        568511..569599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="SPT_0609"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01409;
FT                   match to protein family HMM PF02912; match to protein
FT                   family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24173"
FT                   /protein_id="ACO24173.1"
FT                   /translation="MWFSFYLRETDGGNMSTIEEQLKALREETLASLKQITAGNEKEMQ
FT                   DLRVSVLGKKGSLTEILKGMKDVSAEMRPIIGKHVNEARDVLTAAFEETAKLLEEKKVA
FT                   AQLASESIDVTLPGRPVATGHRHVLTQTSEEIEDIFIGMGYQVVDGFEVEQDYYNFERM
FT                   NLPKDHPARDMQDTFYITEEILLRTHTSPVQARAMDAHDFSKGPLKMISPGRVFRRDTD
FT                   DATHSHQFHQIEGLVVGKNISMADLQGTLQLIVQKMFGEERQIRLRPSYFPFTEPSVEV
FT                   DVSCFKCGGEGCNVCKKTGWIEIMGAGMVHPRVLEMSGIDATVYSGFAFGLGQERVAML
FT                   RYGINDIRGFYQGDVRFSEQFK"
FT   gene            569599..570108
FT                   /locus_tag="SPT_0610"
FT   CDS_pept        569599..570108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0610"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23737"
FT                   /protein_id="ACO23737.1"
FT                   /translation="MIRKVEMADVEVLAKIAKQAFRETFAYDNTEEQLQEYFEEAYSLK
FT                   TLSTELGNPDSETYFIMHEEEIAGFLKVNWGSAQTERELEDAFEIQRLYVLQKFQGFGI
FT                   GKQLFEFALELATKNSFSWAWLGVWEHNTKAQAFYNRYGFEKFSQHHFMVGQKVDTDWL
FT                   LRKKLR"
FT   gene            570185..572590
FT                   /gene="pheT"
FT                   /locus_tag="SPT_0611"
FT   CDS_pept        570185..572590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="SPT_0611"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM PF03147; match to protein
FT                   family HMM PF03483; match to protein family HMM PF03484;
FT                   match to protein family HMM TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23668"
FT                   /protein_id="ACO23668.1"
FT                   /translation="MLVSYKWLKELVDIDVPSQELAEKMSTTGIEVESVESPAADLSKI
FT                   VVGEVLSCEDVPETHLHVCQVNVGEEEARQIVCGAPNVRAGIKVMVALPGARIADNYKI
FT                   KKGKIRGLESLGMICSLGELGISDSVVPKEFADGIQILPENTVPGEEVFSYLDLDDEII
FT                   ELSITPNRADALSMCGVAHEVAAIYDKAVNFKEFTLTETNEAAADALSVSIGTDKAPYY
FT                   AARILDNVIIAPSPQWLQNLLMNEGIRPINNVVDVTNYILLYFGQPMHAFDLDTFEGTD
FT                   IRVREARAGEKLVTLDGEERDLDVNDLVITVADKPVALAGVMGGQATEISEKSSRVVLE
FT                   AAVFNGKSIRKTSGRLNLRSESSSRFEKGINVATVNEALDAAASMIAELAGATVRKGIV
FT                   SAGELDTSDVEVSSTLADVNRVLGTELSYADVEDVFRRLGFGLSGNADSFTVSVPRRRW
FT                   DITIEADLFEEIARIYGYDRLPTSLPKDDGTAGELTVTQKLRRQVRTIAEGAGLTEIIT
FT                   YALTTPEKAVEFTAQPSNLTELMWPMTVDRSVLRQNMISGILDTVAYNVARKNKNLALY
FT                   EIGKVFEQTGNPREELPNEINSFAFALTGLVAEKDFQTAAVPVDFFYAKGILEALFTRL
FT                   GLQVTYTATSEIASLHPGRTAVISLGDQVLGFLGQVHPVTAKAYDIPETYVAELNLSAI
FT                   EAALQPATPFVEITKFPAVSRDVALLLKAEVTHQEVVDAIQAAGVKRLTDIKLFDVFSG
FT                   EKLGLGMKSMAYSLTFQNPEDSLTDEEVARYMEKIQVSLEEKVNAEVR"
FT   gene            complement(572658..573659)
FT                   /locus_tag="SPT_0612"
FT   CDS_pept        complement(572658..573659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0612"
FT                   /product="endonuclease/exonuclease/phosphatase family"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23279"
FT                   /protein_id="ACO23279.1"
FT                   /translation="MIKTFLSALSVILFVIPIIAYSFFPSSNLNIWLSTRPILAQIYAF
FT                   PLATATMASILSFVFFSLSFYKKNKQIRFYSGILLLLSLILLLFGTDKTLSSASNKTKT
FT                   LKLVTWNVANQIEAQHIERIFSHFDADMAIFPELATNIRGEQENQRIKLLFHQVGLSMA
FT                   NYDIFTSPPTNSGIAPVTVIVKKSYGFYTEAKTFHTTRFGTIVLHSRKQNIPDIIALHT
FT                   APPLPGLMEIWKQDLNIIHNQLASKYPKAIIAGDFNATMRHGALAKISSHRDALNALPP
FT                   FERGTWNSQSPKLFNATIDHILLPKNHYYVRDLDIVSFQNSDHRCIFTEITF"
FT   gene            573806..574030
FT                   /pseudo
FT                   /locus_tag="SPT_0613"
FT                   /note="transposase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            574335..574601
FT                   /locus_tag="SPT_0614"
FT   CDS_pept        574335..574601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0614"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23051"
FT                   /protein_id="ACO23051.1"
FT                   /translation="MEGCPSELFSKEEILESDMRVAIMSELIEARYEQGISQKKLEEVS
FT                   GISQPVIARMETGESSLQLDTVLKVLTSLGKTLAVVPLEQGKS"
FT   gene            574862..577111
FT                   /gene="metE"
FT                   /locus_tag="SPT_0615"
FT   CDS_pept        574862..577111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="SPT_0615"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="identified by match to protein family HMM PF01717;
FT                   match to protein family HMM PF08267; match to protein
FT                   family HMM TIGR01371"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22975"
FT                   /protein_id="ACO22975.1"
FT                   /translation="MSTTIIGFPRLGEFRELKFTTEKYFRKEISEEELLAAAKDLRAKH
FT                   WNIVKEKGITEIPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLERYFALGRGYQGEK
FT                   GDVRALPMKKWFNTNYHYIVPKFEKDTQVKLAGHKIFDEFQEAKELGLNTRPVLVGPFT
FT                   FLQLSDFEEGVKADDFVDSLVVAYQEVFAKLAELGATRIQLDEAALVKDLTAEEKALFL
FT                   NLYNKLLADKKGLEVLLQTYFGDVRDVYADLVNLPVDAIGLDFVEGKKTLELVKGGFPA
FT                   DKTLYAGIVNGKNIWRNNYEKSLAVLEQIPAENIVLTSSCSLLHVPFTTANEEFEPALL
FT                   NHFAFAVEKLDEIRDLDAIRNGQGSEALAANKELFATERVGENAELRARIAGLTDADYT
FT                   RLPAFAEREAIQEEAFKLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKEYDAFLAET
FT                   IDEWIKWQEDIDFDVLVHGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIW
FT                   GDVTRLNPITVKWSSYAQSRTNKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIK
FT                   DEVLDLEAAGVKIIQIDEAALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVASDTQIHT
FT                   HMCYSEFTDIIPAIDNMDADVISFEASRSNLEILDELKAKNFQTEVGPGVYDIHSPRVP
FT                   NEGEIDNTIEAILAKVPSKKVWINPDCGLKTRGIPETKESLIRLVEAAKAAREKL"
FT   gene            577175..578041
FT                   /gene="metF"
FT                   /locus_tag="SPT_0616"
FT   CDS_pept        577175..578041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="SPT_0616"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="identified by match to protein family HMM PF02219;
FT                   match to protein family HMM TIGR00676"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22573"
FT                   /protein_id="ACO22573.1"
FT                   /translation="MSCQTPSLSFEVFPPNPAVGNDNIILALQDMQELAPHFISVTASN
FT                   NKFNIKETTVRLADFIQNDLAIPTIAHLPAIYLTKDKVAETIADLDKVGVQKILALRGD
FT                   IIPDVEPQKDFRYATDLIELIKEQAPHFDIIGACYPEGHPDSPNQISDIQNLKKKVDAG
FT                   CSSLVTQLFFDNEHFYDFQDKCILAGIDVPIHAGIMPILNRNQALRLLKTCENIHLPRK
FT                   FKAILDKYEHDPESLRAAGLAYAVDQIVDLVTQDVAGVHLYTMNNADTAKYIHQATHAL
FT                   FNHQSLG"
FT   gene            578726..580939
FT                   /locus_tag="SPT_0617"
FT   CDS_pept        578726..580939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0617"
FT                   /product="polyribonucleotide nucleotidyltransferase
FT                   (Polynucleotidephosphorylase) (PNPase) (Vegetative protein
FT                   15) (VEG15)"
FT                   /EC_number="2.7.7.8"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF00575; match to protein
FT                   family HMM PF01138; match to protein family HMM PF03725;
FT                   match to protein family HMM PF03726"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24204"
FT                   /db_xref="GOA:C1CQ76"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQ76"
FT                   /protein_id="ACO24204.1"
FT                   /translation="MAKQVFQTTFAGRELIVETGQVAKQANGSVVVRYGESTVLTAAVM
FT                   SKKMATGDFFPLQVNYEEKMYAAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEG
FT                   FRNEVQVINTVLSYDENASAPMAAMFGSSLALSISDIPFDGPIAGVQVGYVDGQIIINP
FT                   SQEQAEQSLLELTVAGTKHAINMVESGAKELSEEIMLEALLKGHEAVKELIAFQEEIVA
FT                   AVGKEKAEVELLHVDAELQAEIIAAYNSDLQKAVQVEEKLAREAATQAVKDQVTAVYEE
FT                   KYADHEEFDRIMRDVAEILEQMEHAEVRRLITEDKVRPDGRKVDEIRPLDAVVDFLPRV
FT                   HGSGLFTRGQTQALSVLTLAPMGETQIIDGLDPEYKKRFMHHYNFPQYSVGETGRYGAP
FT                   GRREIGHGALGERALAQVLPSLEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGV
FT                   PIKAPVAGIAMGLISDGNNYTVLTDIQGLEDHFGDMDFKVAGTRDGITALQMDIKIQGI
FT                   TAEILTEALAQAKKARFEILDVIEATIPEVRPELAPTAPKIDTIKIDVDKIKIVIGKGG
FT                   ETIDKIIAETGVKIDIDEEGNVSIYSSDQDAINRAKEIIAGLVREAKVDEVYRAKVVRI
FT                   EKFGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKA
FT                   LLPRPPKPEHDEKGEKSERPHRPRHHKDHKPKKEFTETPKDSE"
FT   gene            580955..581572
FT                   /gene="cysE"
FT                   /locus_tag="SPT_0618"
FT   CDS_pept        580955..581572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SPT_0618"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22819"
FT                   /protein_id="ACO22819.1"
FT                   /translation="MGWWRETIDIVKENDPAARTTLEVLLTYPGVKALAAHRLSHFLWK
FT                   HSFKLLARMHSQFWRFWTQIEIHPGAQIDSGVFIDHGSGLVIGETAIVEKGVLLYHGVT
FT                   LGGTGKDCGKRHPTVRKGALISAHAQVIGPVEIGENAKVGAAAVVVADVPSDVTVVGIP
FT                   AKIVRLHGKKDEPVIHAVEEKREYYVNKLEQAKDASHRSSGL"
FT   gene            581584..582468
FT                   /locus_tag="SPT_0619"
FT   CDS_pept        581584..582468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0619"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22331"
FT                   /protein_id="ACO22331.1"
FT                   /translation="MIQARNKLSQEELSEAKKVINCCQNYDGTYRDPYLSNMLNFDPNM
FT                   PAFFLYYEKGKLVGLLTVYADDQDVEVTILVHPGHRRQGIARALFTSFERETASFPIRS
FT                   VTFQTERIFLENHPDFASNWGLIEDEETETWLGKDRRPYPLANVSHLEILLADSSYQDQ
FT                   ISQLKFQAFSEEHESREVVDRYVAEALKDPESRLYILLKAGQVIGTCTVDLSSDTNYFY
FT                   GLAISEPERGKGYGSYLAKSLVNQLIEQNDKEFQIAVEDSNVGAKRLYEKIGFVKQTQV
FT                   VYLNEKGARDSEV"
FT   gene            582555..583898
FT                   /gene="cysS"
FT                   /locus_tag="SPT_0620"
FT   CDS_pept        582555..583898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SPT_0620"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM PF09190; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24181"
FT                   /protein_id="ACO24181.1"
FT                   /translation="MIKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTV
FT                   AFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALG
FT                   VKPATRHPRVVEFMADIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLE
FT                   LGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDT
FT                   IDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHD
FT                   ALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLKYLKNTYEQPFTGNVDAQELQN
FT                   FKDKFVAAMDEDFNAANGITVVFEMAKWINSGNYDASVKQALADMLEIFGIVFVEEVLD
FT                   AEIEDLIQKRQEARANRDFATADQIRDQLVTQGIKLLDTKDGVRWTRD"
FT   gene            583891..584277
FT                   /locus_tag="SPT_0621"
FT   CDS_pept        583891..584277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0621"
FT                   /product="ribonuclease III family protein"
FT                   /note="identified by match to protein family HMM PF00636"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23748"
FT                   /protein_id="ACO23748.1"
FT                   /translation="MIDVNLINGIALAFEGDAVYSMYIRRHLILKGMTKPNKLHQEATK
FT                   YVSAKAQARLIALMLEEQVLTEKEEEIYKRGRNTNSHTKAKNADVVTYRMSTGFEAVMG
FT                   YLHMTENLERLESLVSWCIQKVEG"
FT   gene            584281..585165
FT                   /locus_tag="SPT_0622"
FT   CDS_pept        584281..585165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0622"
FT                   /product="leucine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22897"
FT                   /protein_id="ACO22897.1"
FT                   /translation="MREKELQDWFPEARISDQPVEKEGYLTLPLASQQWILLEEAGLSE
FT                   REKQLVALLTQQEQARSLNPWYSYLVEGKGQAPQVFKKIQLVYCHLSYFQQENLTSWLD
FT                   MMRTLFPNCQTVLQVGAQDYVFVLQQDKYTSVRDILSDTIEAVEYDFGLRLSIMLGQVW
FT                   SQTGHQALSDLIKAERDLFKTWWRQGHQGVHTFSQLYLWSMGERLVDLKPIKECLHQMI
FT                   LDQDQIQEIILSLWENSAVLTKTAQQLYLHRNSLQYKIDKWEELTGLQLKELTDLTLCY
FT                   QLILGSLSTIVGL"
FT   gene            585213..585329
FT                   /locus_tag="SPT_0623"
FT   CDS_pept        585213..585329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0623"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22307"
FT                   /protein_id="ACO22307.1"
FT                   /translation="MQSYSGLMLGKYTVTAKTFLEAALISLIYLCKFYVILL"
FT   gene            585302..585901
FT                   /locus_tag="SPT_0624"
FT   CDS_pept        585302..585901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0624"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23789"
FT                   /protein_id="ACO23789.1"
FT                   /translation="MQILCYFTITVVAKPNNSGEVHLDVSIEDNQGGSGYNFSSVSSSS
FT                   QTAKYEGTGYNNNSSLYITIDKTSDATALLKLKLNNVDNQPATEVPSSGITVKLNAKDN
FT                   AGNWTSASNKKEVTVKIVSAKPTYPDKILVKNPDNIKDTEKNAIIEKLKEANKNHPAGA
FT                   PTFAKGEGEHANDIVATYSDGTTYYVPLNDVTKYAR"
FT   gene            586047..586220
FT                   /locus_tag="SPT_0625"
FT   CDS_pept        586047..586220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0625"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23321"
FT                   /protein_id="ACO23321.1"
FT                   /translation="MKSIVTSIDERLRTRLRVIIWKQWKKKSRRLWGLLKLGVPKWIAD
FT                   KVSGWGDHYQLY"
FT   gene            586433..586498
FT                   /locus_tag="SPT_2271"
FT   ncRNA           586433..586498
FT                   /locus_tag="SPT_2271"
FT                   /product="group II catalytic intron"
FT                   /ncRNA_class="autocatalytically_spliced_intron"
FT   gene            586571..587848
FT                   /locus_tag="SPT_0626"
FT   CDS_pept        586571..587848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0626"
FT                   /product="ABC transporter membrane-spanning permease-Pep
FT                   export"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22883"
FT                   /protein_id="ACO22883.1"
FT                   /translation="MNPIQRSWAYVSRKRLRSFILFLILLVLLAGISACLTLMKSNKTV
FT                   ESNLYKSLNTSFSIKKIENGQTFKLSDLASVSKIKGLENVSPELETVAKLKDKEAVTGE
FT                   QSVERDDLSAADNNLVSLTALEDSSKDVTFTSSAFNLKEGRHLQKGDSKKILIHEELAK
FT                   KNGLSLHDKIGLDAGQSESGKGQTVEFEIIGIFSGKKQEKFTGLSSDFSENQVFTDYDS
FT                   SQTLLGNSEAQVSAARFYVENPKEMDGLMKQVENLALENQGYQVEKENKAFEQIKDSVA
FT                   TFQTFLTIFLYGMLIAGAGALILVLSLWLRERVYEVGILLALGKGKSSIFLQFCLEVVL
FT                   VSLGALLPAFVAGNGITTYLLQTLLASGDQASLQDTLAKASSLSTSILSFAESYVFLVL
FT                   LSCLSVALCFLFLFRKSPKEILSSIS"
FT   gene            587861..588508
FT                   /locus_tag="SPT_0627"
FT   CDS_pept        587861..588508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0627"
FT                   /product="ABC transporter ATP-binding protein-Pep export"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22465"
FT                   /protein_id="ACO22465.1"
FT                   /translation="MTLLQLQDVTYRYKNTAEAVLYQIDYNFEPGKFYSIIGESGAGKS
FT                   TLLSLLAGLDSPVEGSILFQGEDIRKKGYSYHRMHHISLVFQNYNLIDYLSPLENIRLV
FT                   NKKASKDTLLELGLDESQIKRNVLQLSGGQQQRVAIARSLVSEAPVILADEPTGNLDPK
FT                   TAGDIVELLKSLAQKTGKCVIVVTHSKEVAQASDITLELKDKKLTETRNTSK"
FT   gene            588560..589939
FT                   /locus_tag="SPT_0628"
FT   CDS_pept        588560..589939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0628"
FT                   /product="ABC transporter membrane-spanning permease-Pep
FT                   export"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22571"
FT                   /protein_id="ACO22571.1"
FT                   /translation="MLHNAFAYVTRKFFKSIVIFLIILLMASLSLVGLSIKGATAKASQ
FT                   ETFKNITNSFSMQINRRVNQGTPRGAGNIKGEDIKKITENKAIESYVKRINAIGDLTGY
FT                   DLIETPETKKNLTADRAKRFGSSLMITGVNDSSKEDKFVSGSYKLVEGEHLTNDDKDKI
FT                   LLHKDLAAKHGWKVGDKVKLDSNIYDADNEKGAKETVEVTIKGLFDGHNKSAVTYSQEL
FT                   YENTAITDIHTAAKLYGYTEDTAIYGDATFFVTADKNLDDVMKELNGISGINWKSYTLV
FT                   KSSSNYPALEQSISGMYKMANLLFWGSLSFSVLLLALLLSLWINARRKEVGILLSIGLK
FT                   QASILGQFITESILIAIPALVSAYFLANYTARAIGNTVLANVTSGVAKQASKAAQASNL
FT                   GGGAEVDGFSKTLSSLDISIQTSDFIIIFVLALVLVVLVMALASSNLLRKQPKELLLDG
FT                   E"
FT   gene            590250..590906
FT                   /locus_tag="SPT_0629"
FT   CDS_pept        590250..590906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0629"
FT                   /product="VncR, response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24178"
FT                   /protein_id="ACO24178.1"
FT                   /translation="MKILIVEDEEMIREGVSDYLTDCGYETIEAADGQEALEQFSSYEV
FT                   ALVLLDIQMPKLNGLEVLAEIRKTSQVPVLMLTAFQDEEYKMSAFASLADGYLEKPFSL
FT                   SLLKVRVDAIFKRYYDTGRIFSYKDTKVDFESYSASLAGQEVPINAKELEILDYLVKNE
FT                   GRALTRSQIIDAVWKATDEVPFDRVIDVYIKELRKKLDLDCIFTVRNVGYKLERK"
FT   gene            590903..592231
FT                   /locus_tag="SPT_0630"
FT   CDS_pept        590903..592231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0630"
FT                   /product="VncS, histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23814"
FT                   /protein_id="ACO23814.1"
FT                   /translation="MKRTGLFTKIFIYTFSIFSVLVICLHLAIYFLFPSTYLSHRQETI
FT                   GQKATAIAQSLEGKDRQSIEQVLDLYSQTSDIKGTVKGEMTEDKLEVKDSLPLDTDRQT
FT                   TSLFIEEREVKTQDGGTMILQFLASMDLQKEAEQISLQFLPYTLLASFLISLLVAYIYA
FT                   RTIVAPILEIKRVTRRMMDLDSQVRLRVDSKDEIGNLKEQINSLYQHLLTVIADLHEKN
FT                   EAILQLEKMKVEFLRGASHELKTPLASLKILIENMRENIGRYKDRDQYLGVALGIVDEL
FT                   NHHVLQILSLSSVQELRDDRETIDLLQMTKNLVKDYALLAKERELQIDNSLTHQQAYLN
FT                   PSVMKLILSNLISNAIKHSVPGGLVRIGEREGELFIENSCSSEEQEKLAQSFSDNASRK
FT                   VKGSGMGLFVVKSLLEHEKLAYRFEMEENRLTFFIAFPKVVQD"
FT   gene            592372..593253
FT                   /locus_tag="SPT_0631"
FT   CDS_pept        592372..593253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0631"
FT                   /product="probable fructose-bisphosphate aldolase 1"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23390"
FT                   /protein_id="ACO23390.1"
FT                   /translation="MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPV
FT                   LIQTSMGAAKYMGGYKVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLKLAKEVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMV
FT                   ETGIDFLAAGIGNIHGPYPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAI
FT                   KLGVAKVNVNTECQIAFANATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVE
FT                   ERIDVFGSEGKA"
FT   gene            complement(593574..594764)
FT                   /locus_tag="SPT_0632"
FT   CDS_pept        complement(593574..594764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0632"
FT                   /product="oxidoreductase, NAD-binding"
FT                   /note="identified by match to protein family HMM PF00175;
FT                   match to protein family HMM PF00970; match to protein
FT                   family HMM PF01794"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23203"
FT                   /protein_id="ACO23203.1"
FT                   /translation="MKSIKGLLFIIASFILTLLTWMNTSPQFMIPGLALTSLSLTFILA
FT                   TRLPLLESWFHGLEKVYTVHKFTAFLSIILLIFHNFSMGGLWGSRLAAQFGNLAIYIFA
FT                   SIILVAYLGKYIQYEAWRWIHRLVYLAYILGLFHIYMIMGNRLLTFNLLSFLVGSYALL
FT                   GLLAGFYIIFLYQKISFPYLGKITHLKRLNHDTREIQIHLSRPFNYQSGQFAFLKIFQE
FT                   GFESAPHPFSISGGHGQTLYFTVKNSGDHTKNIYDNLQAGSKVTLDRAYGHMIIEEGRE
FT                   NQVWIAGGIGITPFISYIREHPILDKQVHFYYSFRGDENAVYLDLLRNYAQKNPNFELH
FT                   LIDSTKDGYLNFEQKEVPEHATVYMCGPISMMKALAKQIKKQNPKTELIYEGFKFK"
FT   gene            complement(594908..595567)
FT                   /locus_tag="SPT_0633"
FT   CDS_pept        complement(594908..595567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0633"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23663"
FT                   /protein_id="ACO23663.1"
FT                   /translation="MESILEVLTPDNLVFIFKGFGLTLYISLIAIILSTIIGTVLAVMR
FT                   NGKNPILRIISSIYIEFVRNVPNLLWIFTIFLVFKMKSTPAGITAFTLFTSAALAEIIR
FT                   GGLNAVDKGQYEAGMSQGFTSAQILYYIILPQAIRKMLPAIISQFVTVIKDTSLLYSVI
FT                   ALQELFGASQILMGRYFEPEQVFSLYILIALIYFSFNLAISNLSHMLAKRWQQAAE"
FT   gene            complement(595577..596254)
FT                   /locus_tag="SPT_0634"
FT   CDS_pept        complement(595577..596254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0634"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22743"
FT                   /protein_id="ACO22743.1"
FT                   /translation="MTDLSSWTAYFQDFGQFFNGFLFTLALAIGSFILAMVLGIFFGAM
FT                   STSKRPILRILARIFVEFYQNTPLLVQFVIVFYGLPLISDHTIMIPIYWTAVLCVGLYH
FT                   GAYIAEVIRSGIQSIPSGQMEAALSQGFTYISAMRLIILPQAFRIILPPLTNQIVNLIK
FT                   NTSTVAIISGVDLMFVTKSWSALNGNYIPGFLGAALLYFALCFPVAQFGRKMEQVNKKA
FT                   YSL"
FT   gene            complement(596267..597061)
FT                   /locus_tag="SPT_0635"
FT   CDS_pept        complement(596267..597061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0635"
FT                   /product="ABC transporter substrate-binding
FT                   protein-glutamine transport/Major cell binding factor"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23081"
FT                   /protein_id="ACO23081.1"
FT                   /translation="MKKKFFLSALLISLFGLAAAKPVQADTSIADIQKRGELVVGVKQD
FT                   VPNFGYKDPKTGTYSGIETDLAKMVADELKVKIRYVPVTAQTRGPLLDNEQVDMDIATF
FT                   TITDERKKLYNFTSPYYTDASGFLVNKSAKIKKIEDLNGKTIGVAQGSITQRLITELGK
FT                   KKGLKFKFVELGSYPELITSLHAHRIDAFSVDRSILSGYTSKRTALLDDSFKPSDYGIV
FT                   TKKSNTEFNDYLDNLVTKWSKDGSLQKLYDRYKLKPSSHTAD"
FT   gene            complement(597072..597830)
FT                   /locus_tag="SPT_0636"
FT   CDS_pept        complement(597072..597830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0636"
FT                   /product="ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23539"
FT                   /protein_id="ACO23539.1"
FT                   /translation="MALVEFKNVEKYYGDYHALRNINLRFEKGQVVVLLGPSGSGKSTL
FT                   IRTINGLEAVDKGSLLVNGHQVAGASQKDLVPLRKEVGMVFQHFNLYTHKTVLENVTLA
FT                   PVKVLGIDKKEAEKTAQKYLEFVNMWDKKDSYPAMLSGGQKQRIAIARGLAMHPELLLF
FT                   DEPTSALDPETIGDVLAVMQKLAHDGMNMIIVTHEMGFAREVADRIIFMADGEVLVDTT
FT                   DVDNFFDNPSEPRAQQFLSKIINHESDKVK"
FT   gene            598107..600329
FT                   /gene="recJ"
FT                   /locus_tag="SPT_0637"
FT   CDS_pept        598107..600329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="SPT_0637"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF01368;
FT                   match to protein family HMM PF02272; match to protein
FT                   family HMM TIGR00644"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23971"
FT                   /protein_id="ACO23971.1"
FT                   /translation="MITPTYEWQFALQVEDADFTKIAKKAGLGPEVARLLFERGIQDQE
FT                   SLKKFLEPSLEDLHDAYLLHDMDKAVERIRQAIEEGENILVYGDYDADGMTSASIVKES
FT                   LEQLGAECRVYLPNRFTDGYGPNASVYKYFIEQEGISLIVTVDNGVAGHEAIALAQSMG
FT                   VDVIVTDHHSMPETLPDAYAIVHPEHPDADYPFKYLAGCGVAFKLACALLEEVQVELLD
FT                   LVAIGTIADMVSLTDENRILVQYGLEMLGHTQRIGLQEMLDMAGIGANEVTEETVGFQI
FT                   APRLNALGRLDDPNPAIDLLTGFDDEEAHEIALMIHQKNEERKEIVQSIYEEAKTMVDP
FT                   EKKVQVLAKEGWNPGVLGIVAGRLLEELGQTVIVLNIEDGRAKGSARSVEAVDIFEALD
FT                   PHRDLFIAFGGHAGAAGMTLEVEQLSDLSQVLEDYVREKGADAGGKNKLNLDEELDLEA
FT                   LSLETVKSFERLAPFGMDNQKPIFYIKNFQVESARTMGAGNAHLKLKISKGEASFEVVA
FT                   FGQGRWATEFSQTKNLELAVKLSVNQWNGQTALQLMMVDARVEGVQLFNIRGKNAVLPE
FT                   GVPVLDFPGELPNLAASEAVVVKNIPEDITQLKTIFQEQHFSAVYFKNDIDKAYYLTGY
FT                   GTRDQFAKLYKTIYQFPEFDIRYKLKDLAAYLNIQQILLVKMIQVFEELGFVTIKDGVM
FT                   TVNKEAPKREIGESQIYQNLKQTVKDQEMMALGTVQEIYDFLMEKE"
FT   gene            600504..602165
FT                   /locus_tag="SPT_0638"
FT   CDS_pept        600504..602165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0638"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23816"
FT                   /protein_id="ACO23816.1"
FT                   /translation="MSNISLTTLGGVRENGKNMYIAEIGESIFVLNVGLKYPENEQLGV
FT                   DVVIPNMDYLFENSDRIAGVFLTHGHADAIGALPYLLAEAKVPVFGSELTIELAKLFVK
FT                   GNDAVKKFNDFHVIDENTEIDFGGTVVSFFPTTYSVPESLGIVLKTSEGSIVYTGDFKF
FT                   DQTASESYATDFARLAEIGRDGVLALLSDSANADSNIQVASESEVRDEITQTIADWEGR
FT                   IIVAAVSSNLSRIQQIFDAADKTGRRIVLTGFDIENIVRTAIRLKKLSLANEILLIKPK
FT                   DMSRFEDHELIILETGRMGEPINGLRKMSIGRHRYVEIKDGDLVYIATAPSIAKEAFVA
FT                   RVENMIYQAGGVVKLITQSLHVSGHGNVRDLQLMINLLQPKYLFPVQGEYRELDAHAKA
FT                   AMAVGMLPERIFIPKKGTTMAYENGDFVPAGSVSAGDILIDGNAIGDVGNVVLRDRKVL
FT                   SEDGIFIVAITVNRREKKIVARARVHTRGFVYLKKSRDILRESSELINQTVEEYLQGDD
FT                   FDWADLKGKVRDNLTKYLFDQTKRRPAILPVVMEAK"
FT   gene            602234..603013
FT                   /locus_tag="SPT_0639"
FT   CDS_pept        602234..603013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0639"
FT                   /product="tributyrin esterase"
FT                   /note="identified by match to protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22338"
FT                   /protein_id="ACO22338.1"
FT                   /translation="MAVMKIEYYSQVLDMEWGVNVLYPDANRVEEPECEDIPVLYLLHG
FT                   MSGNHNSWLKRTNVERLLRGTNLIVVMPNTSNGWYTDTQYGFDYYTALAEELPQVLKRF
FT                   FPNMTSKREKTFIAGLSMGGYGCFKLALATNRFSHAASFSGALSFQDFSPESQNLGTPA
FT                   YWRGVFGEIKDWTTSPYSLESLAKKSDKKTKLWAWCGEQDFLYEANNLAVKNLKKLGFD
FT                   VTYSHSAGTHEWYYWEKQLEVFLTTLPIDFKLEERLT"
FT   gene            603125..604345
FT                   /locus_tag="SPT_0640"
FT   CDS_pept        603125..604345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0640"
FT                   /product="serine/alanine-adding enzyme MurM"
FT                   /note="identified by match to protein family HMM PF02388"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22618"
FT                   /protein_id="ACO22618.1"
FT                   /translation="MYRYQIGIPTLEYDQFVKEHELANVLQSSAWEEVKSNWQHEKFGV
FT                   YREEKLLATASILIRTLPLGYKMFYIPRGPILDYGDKELLNFAIQSIKSYARSKRAVFV
FT                   TFDPSICLSQSLINQEKTEFPENLAIIDSLQQMGVRWSGKTEEMGDTIQPRIQAKIYKE
FT                   NFEEDKLSKSTKQAIRTARNKGLEIQYGGLELLDSFSELMKKTEKRKEIHLRNEAYYKK
FT                   LLDNFKDKAYITLATLDVSKRSQELEEQLAKNRALEETFTESTRISKVEAQKKEKERLL
FT                   EELTFLQEYIDVGQARVPLAATLSLEFGTTSVNIYAGMDDDFKRYNAPILTWYETARYA
FT                   FERGMVWQNLGGVENSLNGGLYHFKEKFNPTIEEYLGEFTMPTHPLYPLLRLALDFRKT
FT                   LRKKHRK"
FT   gene            604350..605582
FT                   /locus_tag="SPT_0641"
FT   CDS_pept        604350..605582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0641"
FT                   /product="alanine-adding enzyme MurN"
FT                   /note="identified by match to protein family HMM PF02388"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23260"
FT                   /protein_id="ACO23260.1"
FT                   /translation="MALTTLTKEEFQTYSDQVSSRSFMQSVQMGDLLEKRGARIVYLAL
FT                   KQEGEIQVAALVYSLPMLGGLHMELNSGPIYTQQDALPVFYAELKEYAKQNGVLELLVK
FT                   PYETYQTFDSQGNPIDAEKKSIIQGLTDLGYQFDGLITGYPGGEPDWLYYKDLTELTEK
FT                   SLLKSFSKKGKPLVKKAETFGIRLKKLKREELSIFKNITKETSERREYSDKSLEYYEHF
FT                   YDTFGEQAEFLIASLNFSDYMSKLQGEQSKLEENLDKLRLDLSKNPHSEKKQNQLREYS
FT                   SQFETFEVRKAEARDLIEKYGEEDIVLAGSLFVYMPQETTYLFSGSYTEFNKFYAPALL
FT                   QKYVMLESIKRGIPKYNFLGIQGIFDGSDGVLRFKQNFNGYIVRKAGTFRYHPSPLKYK
FT                   AIQLLKKIVGR"
FT   gene            605661..606362
FT                   /locus_tag="SPT_0642"
FT   CDS_pept        605661..606362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0642"
FT                   /product="matrixin family"
FT                   /note="identified by match to protein family HMM PF00413"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24170"
FT                   /protein_id="ACO24170.1"
FT                   /translation="MRWLFRLIGAFFSFVWRLFWRLVWIVVLLCVLAFGLLWYLNGDFQ
FT                   GALKQAERSVKIGQQSIDQWEKTGQLPKLSQTDSHQHSEGRWPQVSARIYLDPQMDSRF
FT                   QEAYLEAIQNWNQTGAFNFELVTESSKADITATEMNDGGTPVAGEAESQTNLLTGQFLS
FT                   VTVRLNHYYLSNPYYGYSYERLVHTAEHELGHAIGLDHTDEKSVMQPAGSFYGIQEEDV
FT                   ANLRKIYETSE"
FT   gene            606402..608246
FT                   /gene="uvrC"
FT                   /locus_tag="SPT_0643"
FT   CDS_pept        606402..608246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="SPT_0643"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="identified by match to protein family HMM PF01541;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF08459; match to protein family HMM TIGR00194"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22561"
FT                   /db_xref="GOA:C1CQA2"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQA2"
FT                   /protein_id="ACO22561.1"
FT                   /translation="MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF
FT                   RGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKI
FT                   TNERYPRLIITRQVKKDGGLYFGPYPDVGAANEIKRLLDRIFPFRKCTNPPSKVCFYYH
FT                   IGQCMAHTICKKDEAYFKSMAQEVSDFLKGQDNKIIDELKGKMAAAAQTMEFERAAEYR
FT                   DLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFN
FT                   DPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDSKILKPQRGEKKQLVNLA
FT                   IKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMV
FT                   VFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQ
FT                   VNIAKQVIQEELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDE
FT                   VHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMKHFKSLTKIKEASVDEIVEVGV
FT                   PRVVAEAVQRKLNPQGEALPQVAEERVDYQTEGNHNKP"
FT   gene            608278..609069
FT                   /locus_tag="SPT_0644"
FT   CDS_pept        608278..609069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0644"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23835"
FT                   /protein_id="ACO23835.1"
FT                   /translation="MTALEAVIADAKNQGVSEYWLLGDIFLPGPGANDLVALLKDLPIT
FT                   ASVRGNWDDRVLEALDGQYGLEDPQEVQLLRMTQYLMERMDPATIVWLRSLPLLEKKEI
FT                   DGLRFSISHNLPDKNYGGDLLVENDTEKFDQLLDAETDVAVYGHVHKQLLRYGSQGQQI
FT                   INPGSIGMPYFNWEALKNHRAQYAVIEVEDGELVNILFRKVAYDYEAELEFAKSKGLPF
FT                   IEMYEELRREDNYQRHNLELLASLIEKHRYVEDVKNFFDFL"
FT   gene            complement(609251..610051)
FT                   /locus_tag="SPT_0645"
FT   CDS_pept        complement(609251..610051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0645"
FT                   /product="ABC transporter substrate-binding
FT                   protein-glutamine transport/Major cell binding factor"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22471"
FT                   /protein_id="ACO22471.1"
FT                   /translation="MKKFSLLLAILPFLVACGNQATPKETSAQKTIVLATAGDVPPFDY
FT                   EDKGNLTGFDIEVLKAVDEKLSDYEIQFQRTAWESIFPGLDSGHYQAAANNLSYTKERA
FT                   EKYLYSLPISNNPLVLVSNKKNPLTSLDQIAGKTTQEDTGTSNAQFINNWNQKHTDNPA
FT                   TINFSGEDIGKRILDLANGEFDFLVFDKVSVQKIIKDRGLDLSVVDLPSADSPSNYIIF
FT                   SSDQKEFKEQFDKALKEFYQDGTLEKLSNTYLGGSYLPDQSQLQ"
FT   gene            610222..610827
FT                   /locus_tag="SPT_0646"
FT   CDS_pept        610222..610827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0646"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22958"
FT                   /protein_id="ACO22958.1"
FT                   /translation="MKFLELNKKRHATKHFTDKPVDPKDVRTAIEIATLAPSAHNSQPW
FT                   KFVVVREKNAELAKLAYGSNFEQVSSAPVTIALFTDTDLAKRARKIARVGGANNFSEEQ
FT                   LQYFMKNLPAEFARYSEQQVSDYLALNAGLVAMNLVLALTDQGIGSNIILGFDKSKVNE
FT                   VLEIEDRFRPELLITVGYTDDKLEPSYRLPVDEIIEKR"
FT   gene            610840..612240
FT                   /gene="pepV"
FT                   /locus_tag="SPT_0647"
FT   CDS_pept        610840..612240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepV"
FT                   /locus_tag="SPT_0647"
FT                   /product="dipeptidase PepV"
FT                   /EC_number="3.4.13.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM TIGR01886; match to protein
FT                   family HMM TIGR01887"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23280"
FT                   /protein_id="ACO23280.1"
FT                   /translation="MIAIDFTAEVEKRKEDLLADLFSLLEINSERDDSKADAQHPFGPG
FT                   PVKALEKFLEIADRDGYPTKNVDNYAGHFEFGDGEEVLGIFAHMDVVPAGSGWDTDPYT
FT                   PTIKDGRLYARGASDDKGPTTACYYGLKIIKELGLPTSKKVRFIVGTDEESGWADMDYY
FT                   FEHVGLAKPDFGFSPDAEFPIINGEKGNITEYLHFAGENTGAARLHSFTGGLRENMVPE
FT                   SATAVVSGDLADLQAKLDAFVAEHKLRGELQEEAGKYKVTIIGKSAHGAMPASGVNGAT
FT                   YLALFLSQFGFAGPAKDYLDIAGKILLNDHEGENLKIAHVDEKMGALSMNAGVFRFDET
FT                   SADNTIALNIRYPKGTSPEQIKSILENLPVASVSLSEHGHTPHYVPMEDPLVQTLLNVY
FT                   EKQTGLKGHEQVIGGGTFGRLLERGVAYGAMFPDSIDTMHQANEFIALDDLFRAAAIYA
FT                   EAIYELIK"
FT   gene            612294..612872
FT                   /locus_tag="SPT_0648"
FT   CDS_pept        612294..612872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0648"
FT                   /product="uracil DNA glycosylase family protein"
FT                   /note="identified by match to protein family HMM PF03167"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22590"
FT                   /protein_id="ACO22590.1"
FT                   /translation="MSQIERIKQAIMADSQNASYTERGIEPLFAAPKTARINIIGQAPG
FT                   LKTQEAGLYWKDKSGDRLRDWLGVDEDTFYNSGYFAVLPMDFYFPGHGKSGDLPPRTGF
FT                   AEKWHPQLLQELPDIQLTLLIGQYAQAYYLQEKISGKVTERVKHYKDYLPAYFPLVHPS
FT                   PRNQIWMAKNPWFEAEVVPDLKKRIKTIL"
FT   gene            613032..613184
FT                   /locus_tag="SPT_0649"
FT   CDS_pept        613032..613184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0649"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22929"
FT                   /protein_id="ACO22929.1"
FT                   /translation="MKEIAFDAFYQLYQNDQLSLVDVREVDEFAALHLEGAHNLPLSQL
FT                   ADSYD"
FT   gene            613200..613319
FT                   /locus_tag="SPT_0650"
FT   CDS_pept        613200..613319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0650"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23522"
FT                   /protein_id="ACO23522.1"
FT                   /translation="MHYIICKSGMRSARACQFLLEQGYNVINVQGGMLAFEEL"
FT   gene            613490..614815
FT                   /locus_tag="SPT_0651"
FT   CDS_pept        613490..614815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0651"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24200"
FT                   /protein_id="ACO24200.1"
FT                   /translation="MAKKGTLTGLLLFGIFFGAGNLIFPPSLGALSGEHFLPAIAGFVF
FT                   SGVGIAVLTLIIGTLNPKGYIYEISTKIAPWFATLYLSVLYLSIGPFFATPRTATTAYE
FT                   VGISPLLSDANKGLGLIVFTVLYFAAAYLISLNPSKILDRIGRILTPVFAILIVILVVL
FT                   GAIKYGGTSPQAASAAYQASAFGTGFLEGYNTLDALASVAFSVIAVQTLKQLGFSSKKE
FT                   YISTIWVVGIVVALAFSALYIGLGFLGNHFPVPAEAMKGGTPGVYILSQATQEIFGSTA
FT                   QLFLAAMVTVTCFTTTVGLIVSTAEFFNERFPQISYKVYATAFTLIGFAIANLGLDAII
FT                   KYSIPVLVILYPITIAIVMIVIVNKFVALSKPGMQLTIAVVTVIAIANVLGSSFKVEFL
FT                   ANLVSVLPFAKASLPWLVPAIVGILLSLVLPNKQESDVFEME"
FT   gene            614913..615950
FT                   /locus_tag="SPT_0652"
FT   CDS_pept        614913..615950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0652"
FT                   /product="peptidase, M42"
FT                   /note="identified by match to protein family HMM PF05343"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23219"
FT                   /protein_id="ACO23219.1"
FT                   /translation="MNQTVEYIKELTAIASPTGFTREISNYLVKTLEGFGYQPVRTAKG
FT                   GVNVTIKGQNDEQHRYVTAHVDTLGAIVRAVKPDGRLKLDRIGGFPWNMIEGENCTVHV
FT                   ASTGQKVSGTILIHQTSCHVYKDAGTAERTQDNMEVRLDVKVSNEKETRALGIEVGDFI
FT                   SFDPRTVVTDTGFIKSRHLDDKVSAAILLNLLRVYKEEGIDLPMTTHFAFSVFEEVGHG
FT                   ANSNIPEEVVEYLAVDMGAMGDDQQTDEYTVSICVKDASGPYHYDFRQHLVALAKEQDI
FT                   PFKLDIYPFYGSDASAAMSAGAEVKHALLGAGIESSHSYERTHIDSVVATERMVDAYLK
FT                   SEAVS"
FT   gene            615952..616413
FT                   /locus_tag="SPT_0653"
FT   CDS_pept        615952..616413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0653"
FT                   /product="HIT family protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23788"
FT                   /protein_id="ACO23788.1"
FT                   /translation="MCLICQRIELIKAGQNPYFVKELETGYVVIGDHQYFKGYTLFLAK
FT                   DHVTELHHMETSVKLRFLEEMSLVQEAVAKAFEAEKMNIELLGNGDAHAHWHLFPRRAG
FT                   DMKSHGLNGRGPVWWVPWEEMAAEDCQVQSPELEEMIKILSHELEKYLA"
FT   gene            616431..617147
FT                   /locus_tag="SPT_0654"
FT   CDS_pept        616431..617147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0654"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22402"
FT                   /protein_id="ACO22402.1"
FT                   /translation="MKKRYVILSGLLALTLAACSQEKTKVEENTQKTEQSSQPEGTVGS
FT                   KSQASSQKKAEVSNKGSYYSIQGKYDEIILANKRYPLSKDYNPGENPTAKAELLKLIAA
FT                   MQAEGYPISDQYSGFRSYETQAKLYQDYVNQDGKEAADRYSARPGYSEHQTGLAFDLIG
FT                   TDGDLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKEAKEIAASG
FT                   LSLEEYYGFEGGDYVD"
FT   gene            complement(617187..617324)
FT                   /locus_tag="SPT_0655"
FT   CDS_pept        complement(617187..617324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0655"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23914"
FT                   /protein_id="ACO23914.1"
FT                   /translation="MKIKEQTRKLAAGCSKYSFEIADKTDEVSSKHCFEVVNRTDAVSR
FT                   "
FT   gene            617456..617881
FT                   /gene="rplK"
FT                   /locus_tag="SPT_0656"
FT   CDS_pept        617456..617881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="SPT_0656"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23680"
FT                   /db_xref="GOA:C1CQB5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQB5"
FT                   /protein_id="ACO23680.1"
FT                   /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQAGMIIPVVISVYEDKSFTFVTKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTRAQ
FT                   VQEIAETKMPDLNAANVESAMRMIEGTARSMGFTVVD"
FT   gene            618089..618778
FT                   /gene="rplA"
FT                   /locus_tag="SPT_0657"
FT   CDS_pept        618089..618778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="SPT_0657"
FT                   /product="ribosomal protein L1"
FT                   /note="identified by match to protein family HMM PF00687;
FT                   match to protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23015"
FT                   /db_xref="GOA:C1CQB6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQB6"
FT                   /protein_id="ACO23015.1"
FT                   /translation="MAKKSKQLCAALEKIDSTKAYSVEEAVALAKETNFAKFDATVEVA
FT                   YNLNIDVKKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NDGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADRAGNVQAIIGKVSFEAEKLVENFKAFNETIQKAKPATAKGTYVTNLTITTTQGVGI
FT                   KVDVNSL"
FT   gene            619260..619325
FT                   /locus_tag="SPT_2272"
FT   ncRNA           619260..619325
FT                   /locus_tag="SPT_2272"
FT                   /product="group II catalytic intron"
FT                   /ncRNA_class="autocatalytically_spliced_intron"
FT   gene            complement(619370..619516)
FT                   /locus_tag="SPT_0658"
FT   CDS_pept        complement(619370..619516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0658"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23805"
FT                   /protein_id="ACO23805.1"
FT                   /translation="MKTKEQTRKLAVGCSKHCFEVVDRTDEVSNHTHGKATLTWFEEIF
FT                   EEY"
FT   gene            619674..619892
FT                   /locus_tag="SPT_0659"
FT   CDS_pept        619674..619892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0659"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24213"
FT                   /protein_id="ACO24213.1"
FT                   /translation="MKKISVTVIGYFEINIDENITDILYVNGTAILCPYLRSIVSTVSA
FT                   IDSSEAMLLPTINVLELLDKSQPFEEE"
FT   gene            620291..620527
FT                   /locus_tag="SPT_0660"
FT   CDS_pept        620291..620527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22977"
FT                   /protein_id="ACO22977.1"
FT                   /translation="MKAFYITIEKFIRDDESLKCYFTKVISSRSKVTSLDQIEADKTIQ
FT                   RKYSSELKKFIGFYNEIICEENSFLHVRKRWSS"
FT   gene            620937..621929
FT                   /locus_tag="SPT_0661"
FT   CDS_pept        620937..621929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0661"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22399"
FT                   /protein_id="ACO22399.1"
FT                   /translation="MAMIEVEHLQKHFVKIVKEPGLKGALRSFIHPEKQTFEAVKDLTF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGFCRINGKIPQDNRQDYVKDIGVVFG
FT                   QRTQLWWDLALQETYTVLKEIYDVPDSLFHKRMDFLNEVLDLKDFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCDRIFMIDKGQEIFDGTVSQLKETFGKMKTLSFELLPGQSHLVSHYEGLSDMTIDRQG
FT                   NSLNIEFDSSRYQSADIIKQTLSDFEIRDLKMVDTDIEDIIRRFYRKEL"
FT   gene            621931..622749
FT                   /locus_tag="SPT_0662"
FT   CDS_pept        621931..622749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0662"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23445"
FT                   /protein_id="ACO23445.1"
FT                   /translation="MIKLWRRYKPFINAGVQELITYRVNFILYRIGDVMGAFVAFYLWK
FT                   AVFDSSQESLIQGFSMADITLYIIMSFVTNLLTRSDSSFMIGEEVKDGSIIMRLLRPVH
FT                   FAASYLFTELGSKWLIFISVGLPFLSVIVLMKIISGQGIVEVLGLTVIYLFSLTLAYLI
FT                   NFFFNICFGFSAFVFKNLWGSNLLKTSIVAFMSGSLIPLAFFPKVVSDILSFLPFSSLI
FT                   YTPVMIIVGKYDASQILQALLLQFFWLLVMVGLSQLIWKRVQSFITIQGG"
FT   gene            622751..623536
FT                   /locus_tag="SPT_0663"
FT   CDS_pept        622751..623536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0663"
FT                   /product="ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22889"
FT                   /protein_id="ACO22889.1"
FT                   /translation="MKKYQRMHLIFIRQYIKQIMEYKVDFVVGVLGVFLAQGLNLLFLN
FT                   VIFQHIPFLEGWTFQEIAFIYGFSLIPKGMDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   NPLFHILVETFQIDALGELLVGGILLGTTVTSIVWTLPKFLLFLVCIPFATLIYTSLKI
FT                   ATASIAFWTKQSGAMIYIFYMFNDFAKYPISIYNSLLRWLISFIVPFAFTAYYPASYFL
FT                   QEKDVFFNVGGLMLISLVFFVISLKLWDKGLDSYESAGS"
FT   gene            623737..623853
FT                   /pseudo
FT                   /locus_tag="SPT_0664"
FT                   /note="acetyltransferase, gnat family; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            623838..624035
FT                   /pseudo
FT                   /locus_tag="SPT_0665"
FT                   /note="conserved domain protein; this region contains one
FT                   or more premature stops and/or frameshifts"
FT   gene            624768..631199
FT                   /locus_tag="SPT_0666"
FT   CDS_pept        624768..631199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0666"
FT                   /product="serine protease"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF02225; match to protein family HMM PF05922;
FT                   match to protein family HMM PF06280; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23233"
FT                   /protein_id="ACO23233.1"
FT                   /translation="MKKSTVLSLTTAAVILAAYAPNEVVLADTSNSEDALNISDKEKVV
FT                   LDKETENKEKHEDIHNAIETSQDFKEKKTAVIEGKAVVSKNPVTDNNTSNEEARIKEDS
FT                   NQSQGDHTDSFVNKNTENPKKEDKVVYIAEFKDKESGEKAIKQLSNLKNTKVLYTYDRI
FT                   FNGSAIETTPDNLDKIKQIEGITSVERAQKVQPMMNHARKEIGVEEAIDYLKSINAPFG
FT                   KNFDGRGMVISNIDTGTDYRHKAMRIDDDAKASMRFKKEDLKGTDKNYWLSDKIPHAFN
FT                   YYNGGKITVEKYDDGRDYFDPHGMHIAGILAGNDTEQDIKNFNGIDGIAPNAQIFSYKM
FT                   YSDAGSGFAGDETMFHAIEDSIKHNVDVVSVSSGFTGTGLVGEKYWQAIRALRKAGIPM
FT                   VVATGNYATSASSSSWDLVANNHLKMTDTGNVTRTAAHEDAIAVASAKNQTVEFDKVNI
FT                   GGESFKYRNIGAFFDKNKITTNEDGTKAPSKLKFVYIGKGQDQDLIGLDLRGKIAVMDR
FT                   IYTKDLKNAFKKAMDKGARAIMVVNTVNYYNRDNWTELPAMGYEADEGTKSQVFSISGD
FT                   DGVKLWNMINPDKKTEVKRNNKEDFKDKLEQYYPIDMESFNSNKPNVGDEKEIDFKFAP
FT                   DTDKELYKEDIIVPAGSTSWGPRIDLLLKPDVSAPGKNIKSTLNVINGKSTYGYMSGTS
FT                   MATPIVAASTVLIRPKLKEMLERPVLKNLKGDDKIDLTSLTKIALQNTARPMMDATSWK
FT                   EKSQYFASPRQQGAGLINVANALRNEVVATFKNTDSKGLVNSYGSISLKEIKGDKKYFT
FT                   IKLHNTSNRPLTFKVSASAVTTDSLTDRLKLDETYKDEKSPDGKQIVPEIHPEKVKGAN
FT                   ITFEHDTFTIGANSSFDLNAVINVGEAKNKNKFVESFIHFESVEEMEALSSNGKKTDFQ
FT                   PSLSMPLMGFAGNWNHEPILDKWAWEEGSKSKTMEGYDDDGKPKIPGTLNKGIGGEHGI
FT                   DKFNPAGVIQNRKDKNRTSLDQDPDLFAFNNQGVHAESTSGSKIANIYPLDSNGNPQDA
FT                   QLERGLTPSPLVLRSAEEGLISIVNTNKEGENQKDLKVVSREHFIRGILNSKGNDAKGI
FT                   KSSKLKVWGDLKWDGLIYNPRGREENAPESKDNQDPATKIRGQFEPIAEGQYFYKFKYR
FT                   LTKDYPWQVSYIPVKIDNTAPKIVSVDFSNPEKIKLITKDTYHKVKDQYKNETLFARDQ
FT                   KEHPEKFDEIANEVWYAGAALVNEDGEVEKNLEVTYAGEGQGRNRKLDKDGNTIYEISG
FT                   AGDLRGKIIEVIALDGASNFTKIHRIKFANQADEKGMISYYLVDPDQDSSKYQKLGEIP
FT                   ESKFKNLKNVKDDSLNKETAEVENNLLVDNQSIEGKSLFNIHKTISTIRDFENKDLKKL
FT                   IKKKYKQEDDFVNGGTRTVERDYKYDDKGNIIAYDDGTDLEYETEKLDEIKSKIYGVLS
FT                   PSKDGHFEILGKISNVSKNAKVYYGNNYKSIEIKATKYDFHSKTMTFDLYANINDIVDG
FT                   LAFAGDMRLFVKDNDQKKAEIKIRMPEKIKETKSEYPYVSSYGNVIELGEGDLSKNKPD
FT                   NLTKMESGKIYSDSEKQQYLLKDNIILRKGYALKVTTYNPGKTDMLEGNGVYSKEDIAK
FT                   IQKANPNLRVLSETTIYADSRNVEDGRSTQAVLMSALDGFNIIRYQVFTFKMNDKGEAI
FT                   DKDGNLVTDSSKLVLFGKDDKEYTGEDKSNVEAIKEDGSMLFIDTKPVNLSMDKNYFNP
FT                   SKSNKIYVRNPEFYLRGKISDKGGFNWELRVNESVVDNYLIYGDLHIDNTRDFNIKLNV
FT                   KDGDIMDWGMKDYKANGFPDKVTDMDGNVYLQTGYSDLNAKAVGVHYQFLYDNVKPEVN
FT                   IDPKGNTSIEYADGKSVVFNINDKRNNGFDGEIQEQHIYVNGKEYTSFDDIKQITDKTL
FT                   NIKIVVKDFARNTTVKEFILNKDTGEVSELKPHRVTVTIQNGKEMSSTIVSEEDFILPV
FT                   YKGELEKGYQFDGWEISGFEGKKDAGYVINLSKDTFIKPVFKKIEEKKEEENKPTFDVS
FT                   KKKDNPQVNHSQLNESHRKEDLQREDHSQKSDSTKDVTATVLDKNNISSKSTTNNPNKL
FT                   PKTGTASGAQTLLAAGIMFIVGIFLGLKKKNQD"
FT   gene            631831..632307
FT                   /locus_tag="SPT_0667"
FT   CDS_pept        631831..632307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0667"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22650"
FT                   /protein_id="ACO22650.1"
FT                   /translation="MVLDYFFDKNLVFCLEADNQEHLFDQVASLLEEREIVTPTYREAL
FT                   ITREKSFPTGLDMEFLGKDLPNVAIPHTDIVHNLAEKVVVVRLEKPVTFHNMIAPDKEV
FT                   EVSLLFFIINNSSSSQTNILAQLMDFFTGNGHLEDLSKISEPEKLYAYIAEATA"
FT   gene            632345..632650
FT                   /locus_tag="SPT_0668"
FT   CDS_pept        632345..632650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0668"
FT                   /product="PTS system, galactose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23184"
FT                   /protein_id="ACO23184.1"
FT                   /translation="MIKILAACGAGVNSSHQIKSALEEELSNRGYDVHCDAVMVKDVNE
FT                   DLMKGYDIFTPIAATDLGFEPGIPVIEAGPILFRIPAMSAPVFDNIEAAIKEHGLS"
FT   gene            632698..634173
FT                   /locus_tag="SPT_0669"
FT   CDS_pept        632698..634173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0669"
FT                   /product="phosphotransferase system sugar-specific EII
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22695"
FT                   /protein_id="ACO22695.1"
FT                   /translation="MDAIFDLIGKVFNPILEMGGPVIMLIILTVLALLFGVKFSKALEG
FT                   GIKLAIALTGIGAIIGMLNGAFSASLAKFVENTGIQLSITDVGWAPLATITWGSAWTLY
FT                   FLLIMLIVNVVMLAMKKTDTLDVDIFDIWHLSITGLLIKWYADNNGVSQGVSLFIATAA
FT                   IVLVGVLKIINSDLMKPTFDDLLNAPSSSPMTSTHMNYMMNPVIMVLDKIFEKFFPGLD
FT                   KYDFDAAKLNKKIGFWGSKFFIGFILGIVIGIMGTPHPIAGVADADKWRLVIKGWLSLG
FT                   LTAGVSLELFSLIGSWFIAAVEPLSQGITNVATKRLRGRKFNIGLDWPFIAGRAEIWAC
FT                   ANVLAPIMLIEAVLLSKVGNGILPLAGIIAMGVTPALLVVTRGKLLRMIIFGTLLLPLF
FT                   LLSGTLIAPFATELAKGVGAFPEGVSQTQLITHSTLEGPIEKLLGWTIGNTTTGDIKAI
FT                   LGAVVFLVFYIGIFAWYRKQMIKRNEEYAAKAK"
FT   gene            634568..641269
FT                   /locus_tag="SPT_0670"
FT   CDS_pept        634568..641269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0670"
FT                   /product="beta-galactosidase"
FT                   /note="identified by match to protein family HMM PF00703;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF02836; match to protein family HMM PF02837;
FT                   match to protein family HMM PF04650; match to protein
FT                   family HMM PF07501; match to protein family HMM PF07532;
FT                   match to protein family HMM TIGR01167; match to protein
FT                   family HMM TIGR01168"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24044"
FT                   /protein_id="ACO24044.1"
FT                   /translation="MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYA
FT                   DETLITHTAEKPKEEKMIVEEKADKALETKNVVERTEQSEPSSTEAIASEKKEDEAVTP
FT                   KEEKVSAKPEEKAPRIESQASSQEKPLKEDAKAVTNEEMNQMIEDRKVDFNQNWHFKLN
FT                   ANSKEAIKPDADVSTWKKLDLPYDWSIFNNFDHESPAQNEGGQLNGGEAWYRKTFKLDE
FT                   KDLKKNVRLTFDGVYMDSQVYVNGQLVGHYPNGYNQFSYDITKYLHKDGRENVIAVHAV
FT                   NKQPSSRWYSGSGIYRDVTLQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIVNT
FT                   DDKDHELVAEYQIVERGGHAVTGLVRTASRTLKAHESTSLDAILEVERPKLWTVLNDKP
FT                   ALYELITRVYRDGQLVDAKKDLFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGA
FT                   EENYKAEYRRLKQMKEMGVNSIRTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPY
FT                   DYGRFFEKDATHPEARKGEKWSDFDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLA
FT                   TVKRLVKVIKDVDKTRYVTMGADKFRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAK
FT                   HPKWLIYGSETSSATRTRGSYYRPERELKHSNGPERNYEQSDYGNDRVGWGKTATASWT
FT                   FDRDNAGYAGQFIWTGTDYIGEPTPWHNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQW
FT                   VSVKKKPMVHLLPHWNWENKELASKVADSEGKIPVRAYSNASSVELFLNGKSLGLKTFN
FT                   KKQTSDGRTYQEGANANELYLEWKVAYQPGTLEAIARDESGKEIARDKITTAGKPAAVR
FT                   LIKEDHAIAADGKDLTYIYYEIVDSQGNVVPTANNLVRFQLHGQGQLVGVDNGEQASRE
FT                   RYKAQADGSWIRKAFNGKGVAIVKSTEQAGKFTLTAHSDLLKSNQVTVFTGKKEGQEKT
FT                   VLGTEVPKVQTIIGEAPEMPTTVPFVYSDGSRAERPVTWSSVDVSKPGIVTVKGMADGR
FT                   EVEARVEVIALKSELPVVKRIAPNTDLNSVDKSVSYVLTDGSVQEYEVDSWEIAEEDKA
FT                   KLAIPGSRIQATGYLEGQPIHATLVVEEGNPAAPVVPTVTVGGEAVTGLTSRQPMQYRT
FT                   LSYGAQLPEVTASAENADVTVLQASAANGMRASIFIQPKDGGPLQTYAIQFLEEAPKIA
FT                   HLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLPADKVTFSTSGEGEVAIRKGMLELH
FT                   KPGAVTLNAEYEGAKGQVELTIQANTEKKIAQSIRPVNVVTDLHQKPTLPTTVTVEYDK
FT                   GFPKAHKVTWQAIPKEKLDSYQTFEVLGKVEGIDLEARAKVSVEGIVSVEEVSVTTPIA
FT                   EAPQLPESVRTYDSNGHVSSAKVAWDAIRIEQYAKEGVFTVNGRLEGTQLTTKLHVRVS
FT                   AQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKLISYNNQPANRWTNWNRSNPE
FT                   ASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGAPKSYVIEYYVGKTVPTAPKNPSFVGN
FT                   EDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAVRIRMVKADNKRGTSITEV
FT                   QIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGKVPAVTANVSNNGLATVV
FT                   PSVREGEPVRVIAKAENGDILGEYRLHFTKDKNLLSHKPVAAVKQARLLQVGQALELPT
FT                   KVPVYFTGKDGYETKDLTVEWEEVPAENLTKAGQFTVRGRVLGSDLVAEVTVRVTDKLG
FT                   EALSDNPNYDENSNQAFASATNDIDKNSHDRVDYLNDGDHSENRRWTNWSPTPSSNPEV
FT                   SAGVIFRENGKIVERTVAQAKLHFFADSGTDAPTKLVLERYVGPEFEVPTYYSNYQAYD
FT                   ADHPFNNPENWEAVPYRADKDIEAGDEINVTFKAVKAKAMRWRMERKADKSGVAMIEMT
FT                   FLAPSELPQESTQSKILVDGKELADFAENRQDYQITYKGQRPKVSVEENNQVASTVVDS
FT                   GEDSLPVLVRLVSESGKQVKEYRIQLTKEKPVSEKTVAAVQEDLPKLEFVEKDLAYKTV
FT                   EKKDSTLYLGETRVEQEGKTGKERIFTAINPDGSKEEKLREVVEAPTDRIVLVGTKPVA
FT                   QEAKKPQVSEKADTKPIDSSEASQTNKAQLPNTGSAASQAAVAAGLALLGLSAGLVVTK
FT                   GKKED"
FT   gene            complement(641517..641747)
FT                   /locus_tag="SPT_0671"
FT   CDS_pept        complement(641517..641747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0671"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23609"
FT                   /protein_id="ACO23609.1"
FT                   /translation="MNERYQNLKAKECQALLSPQGRQIFAQRKIDVEPVFGQLKACLGY
FT                   KRCNLRGKRQVRIDMGLVLMANNLLKHSEMK"
FT   gene            complement(641716..642129)
FT                   /locus_tag="SPT_0672"
FT   CDS_pept        complement(641716..642129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0672"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23774"
FT                   /protein_id="ACO23774.1"
FT                   /translation="MTLDCLFIDGTKIESNANKYSFVWKKTTEKFSAKLQEQIQVYFQE
FT                   EITPLLIKYAMFDKEQKRGYKQSAKNLANWHYNDKEDSYTHPDGWYYRFHHTKHQKTQT
FT                   DFQQEIKVYYADEPESAPQKGAIYERTLSKLES"
FT   gene            complement(642129..642374)
FT                   /locus_tag="SPT_0673"
FT   CDS_pept        complement(642129..642374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0673"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22283"
FT                   /protein_id="ACO22283.1"
FT                   /translation="MHIHYNTNQTTLPLEISSFLPQDHLVFTIEKVVNTLEEHHFYAFY
FT                   HAFDRPSYHPKMLVSTLLFVYSQGIFSGRKIEKWKS"
FT   gene            complement(642585..642944)
FT                   /locus_tag="SPT_0674"
FT   CDS_pept        complement(642585..642944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0674"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22904"
FT                   /protein_id="ACO22904.1"
FT                   /translation="MGMILMKLASILLLILTLVVCIILTKLFRLKKLGRNFADLAFPVL
FT                   VFEYYLITAKTFTHNFLPRLGLALSILAIILVFFFLLKKRSFYYPKFIKFFWRTGFLLT
FT                   LIMYIEMVVELFLMK"
FT   gene            643036..643991
FT                   /pseudo
FT                   /locus_tag="SPT_0676"
FT                   /note="radical SAM superfamily enzyme, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts; identified by match to protein family HMM
FT                   PF04055"
FT   gene            643977..644534
FT                   /locus_tag="SPT_0677"
FT   CDS_pept        643977..644534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0677"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="identified by match to protein family HMM PF06962"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23077"
FT                   /protein_id="ACO23077.1"
FT                   /translation="MKRPLEMAHDFLAEVVTKEDVVVDATMGNGHDTLFLAKLAKQVYA
FT                   FDIQKQALEKTQERLHQAGLTNAQLILQGHETLDQFVTKAKAGIFNLGYLPSADKSVIT
FT                   RPQTTIEALEKLCGLLVKGGRIAIMIYYGHEGGDLERDAVLDFVIQLNQQEYTAAIYRT
FT                   LNQVNNPPFLVMIEKLERYRHG"
FT   gene            644527..644781
FT                   /locus_tag="SPT_0678"
FT   CDS_pept        644527..644781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23166"
FT                   /protein_id="ACO23166.1"
FT                   /translation="MDKQYLREKLDAMRQNFVESTHHERAVGVLDQAHMSKKMLKIKKK
FT                   LVALEMERCQRKIEHKDCSKIDQKIKEQKEIFESCCKKD"
FT   gene            644793..646847
FT                   /locus_tag="SPT_0679"
FT   CDS_pept        644793..646847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0679"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23586"
FT                   /protein_id="ACO23586.1"
FT                   /translation="MELLIYLILFLLVLIVSSTTNKLLPFLPLPLVQILLGIVIGLFLP
FT                   NTDFHLNTELFLALVIGPLLFREAEEADVTAILKHWRIIVYLIFPVIFISTLSLGGLAH
FT                   LLWFSLPLAACLAVGAALGPTDLVAFASLSERFSFPKRVSNILKGEGLLNDASGLVAFQ
FT                   VALTAWTTGAFSLGQASSSLIFSILGGFLIGFLTAMTNRFLHSFLLSVRATDIASELLL
FT                   ELSLPLVTFFLAEEVHVSGIIAVVVAGILKASRFKKITLLEAQVDTVTETVWHTVTFML
FT                   NGSVFVILGMELEMIAEPILTNPIYNPLLLLLSLIALTFVLFVIRFIMIYGYYAYRTRR
FT                   LKKKLNKYMKDMFLLTFSGVKGTVSIATILLIPSNLEQEYPLLLFLVAGVTLVSFLTGL
FT                   LVLPHLSDEEEESKDYLMHIAILNEVTLELEKELEDTRNKLPLYAAIDNYHGRIENLIL
FT                   SQENQDDQEDWAALKLLILSIESDGLEQAYEEGNISNRAYRVYQRYLKNIEQGINRKLA
FT                   SRLTYYFLVSLRILRFLLHEVFTLGKTFRSWKNKEQSRLRALDYDQIAELYLANTEMII
FT                   ESLENLKGVYRRSLISFMQESRLRETAIISSGAFVERVINRVKPNNIDEMLRGYYLERK
FT                   LIFEYEEKRLITTKYAKKLRQNVNNLENYSLKEAANTLPYDMVELVRRN"
FT   gene            647026..647886
FT                   /locus_tag="SPT_0680"
FT   CDS_pept        647026..647886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0680"
FT                   /product="ribonuclease BN"
FT                   /note="identified by match to protein family HMM PF03631"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23283"
FT                   /protein_id="ACO23283.1"
FT                   /translation="MKKWWKELIDKPLLKAFLHYYQASDSELTSVAVAYYWLISIFPLL
FT                   LVVVNILPYFQIPVGEFLGFMKDVLPPSLYEGVEKIAREVLTQPSTGLLSFSVLSALWS
FT                   FSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQLLFAFALFLILFGQMILALL
FT                   AHYWTKDGIIYQALQGLAGPLIYALLFAILVMLYYFLPNLSNRKISYTLPGSAFVLLVI
FT                   LGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVILGAVINASMQSLKDP
FT                   VFKKD"
FT   gene            648097..648807
FT                   /locus_tag="SPT_0682"
FT   CDS_pept        648097..648807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0682"
FT                   /product="cytochrome c-type biogenesis protein"
FT                   /note="identified by match to protein family HMM PF02683"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22935"
FT                   /protein_id="ACO22935.1"
FT                   /translation="MGHIFFFLSVFLAGILSFFSPCILPLLPVYTGVLLDDKDGAQASS
FT                   GKFSISVTSLLRTLAFIAGISFIFILLGYGAGFLGDLLYASWFQYLTGAIIILLGLHQM
FT                   EILHFKGLYKEKRLQLQGQGQNGKGYSQAFLLGLTFSFAWTPCVGPVLGSVLALAASGG
FT                   SGAWQGAGLMLVYTLGLALPFLLLALTSSYVLKHFRKLHPYLGILKKVGGFLIIVMGLL
FT                   VLFGNASILSQLFE"
FT   gene            648827..649393
FT                   /locus_tag="SPT_0683"
FT   CDS_pept        648827..649393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0683"
FT                   /product="thioredoxin family protein"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23494"
FT                   /protein_id="ACO23494.1"
FT                   /translation="MKKWQTCVLGAGSLLCLTACSGKSVTSEHQTKDEMKTEQTASKTS
FT                   AAKGKEVADFELMGVDGKTYRLSDYKGKKVYLKFWASWCSICLASLPDTDEIAKEAGDD
FT                   YVVLTVVSPGHKGEQSEADFKNWYKGLDYKNLPVLVDPSGKLLETYGVRSYPTQAFIDK
FT                   EGKLVKTHPGFMEKDAILQTLKELA"
FT   gene            649404..650516
FT                   /locus_tag="SPT_0684"
FT   CDS_pept        649404..650516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0684"
FT                   /product="peptide methionine sulfoxide reductase MsrA/msrB"
FT                   /EC_number="1.8.4.11"
FT                   /EC_number="1.8.4.12"
FT                   /note="identified by match to protein family HMM PF01625;
FT                   match to protein family HMM PF01641; match to protein
FT                   family HMM TIGR00357; match to protein family HMM
FT                   TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22230"
FT                   /protein_id="ACO22230.1"
FT                   /translation="MNDKLKIFLLLGVFFLAITGFYVLLIRNAGQTDASQIEKAAVSQG
FT                   GKTVKKTEISKDADLHEIYLAGGCFWGVEEYFSRVPGVTDAVSGYANGRGETTKYELIN
FT                   QTGHAETVHVTYDAKQISLKEILLHYFRIINPTSKNKQGNDVGTQYRTGVYYTDDKDLE
FT                   VINQVFDEVAKKYDQPLAVEKENLKNFVVAEDYHQDYLKKNPNGYCHINVNQAAYPVID
FT                   ASKYPKPSDEELKKTLSPEEYAVTQENQTERAFSNRYWDKFESGIYVDIATGEPLFSSK
FT                   DKFESGCGWPSFTQPISPDVVTYKEDKSYNMTRMEVRSRVGDSHLGHVFTDGPQDKGGL
FT                   RYCINSLSIRFIPKDQMEEKGYAYLLDYVD"
FT   gene            650739..651476
FT                   /locus_tag="SPT_0685"
FT   CDS_pept        650739..651476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0685"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22940"
FT                   /protein_id="ACO22940.1"
FT                   /translation="MTYTILIVEDEYLVRQGLTKLVNVAAYDMEIIGQAENGRQAWELI
FT                   QKQVPDIILTDINMPHLNGIQLASLVRETYPQVHLVFLTGYDDFDYALSAVKLGVDDYL
FT                   LKPFSRQDIEEMLGKIKQKLDKEEKEEQLQDLLTNRFEGNMAQKIQSHLADSQFSLKSL
FT                   ASDLGFSPTYLSSLIKKELGLPFQDYLVRERVKQAKLLLLTTDLKIYEIAEKVGFEDMN
FT                   YFTQRFKQIAGVTPRQFKKGEGR"
FT   gene            651473..653164
FT                   /locus_tag="SPT_0686"
FT   CDS_pept        651473..653164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0686"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF00672;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF02743; match to protein family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23753"
FT                   /protein_id="ACO23753.1"
FT                   /translation="MKRSSLLVRMVISIFLVFLILLALVGTFYYQSSSSAIEATIEGNS
FT                   QTTISQTSHFIQSYIKKLETTSTGLTQQTDVLAYAENPSQDKVEGIRDLFLTILKSDKD
FT                   LKTVVLVTKSGQVISTDDSVQMKTSSDMMAEDWYQKAIHQGAMPVLTPARKSDSQWVIS
FT                   VTQELVDAKGANLGVLRLDISYETLEAYLNQLQLGQQGFAFIINENHEFVYHPQHTVYS
FT                   SSSKMEAMKPYIETGQGYTPGHKSYVSQEKIAGTDWTVLGVSSLEKLDQVRSQLLWTLL
FT                   GASVTSLLVCLCLVWFSLKRWIAPLKDLRETMLEIASGAQNLRAKEVGAYELREVTRQF
FT                   NAMLDQIDQLMVAIRSQEETTRQYQLQALSSQINPHFLYNTLDTIIWMAEFHDSQRVVQ
FT                   VTKSLATYFRLALNQGKDLICLSDEINHVRQYLFIQKQRYGDKLEYEINENVAFDNLVL
FT                   PKLVLQPLVENALYHGIKEKEGQGHIKLSVQKQDSGLVIRIEDDGVGFQDAGDSSQSQL
FT                   KRGGVGLQNVDQRLKLHFGANYQMKIDSRPQKGTKVEIYINRIETS"
FT   gene            653280..653843
FT                   /locus_tag="SPT_0687"
FT   CDS_pept        653280..653843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0687"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04260;
FT                   match to protein family HMM TIGR01440"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23861"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQE1"
FT                   /protein_id="ACO23861.1"
FT                   /translation="MNETQIQRETRQVVEDVLEKTNLKQGALFVLGLSSSEVLGGQIGK
FT                   ESSQEIGELIVETILGILGSRGIHLAVQGCEHVNRALVVERQVAEQFGLEIVSVHPTLH
FT                   AGGSGQLAAFKFMQDPVEVEFIKAHAGLDIGDTAIGMHVKHVQVPIRPILREIGHAHVT
FT                   ALASRPKLIGGARAHYPQDAIRKS"
FT   gene            653865..659573
FT                   /gene="zmpB"
FT                   /locus_tag="SPT_0688"
FT   CDS_pept        653865..659573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmpB"
FT                   /locus_tag="SPT_0688"
FT                   /product="zinc metalloprotease ZmpB"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF05342; match to protein
FT                   family HMM PF07501; match to protein family HMM PF07580;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23059"
FT                   /protein_id="ACO23059.1"
FT                   /translation="MFKKDRFSIRKIKGVVGSVFLGSLLMAPSVVDAATYHYVNKEIIS
FT                   QEAKDLIQTGKPDRNEVVYGLVYQKDQLPQTGTEASVLTAFGLLTVGSLLLIYKRKKIA
FT                   SVFLVGAMGLVVLPSAGAVDPVATLALASREGVVEMEGYRYVGYLSGDILKTLGLDTVL
FT                   EETSAKPGEVTVVEVETPQSTTNQEQARTENQVVEAEEAPKEEAPKTEESPKEEPKSEV
FT                   KPTDDTLPKVEEGKEDSAEPAPVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEPP
FT                   VEQAKGPEQPVQPTQAEQPRIPKDSSQPEDPKEDRGAEETPKQEDEQPAEAPEIKVEEP
FT                   VESKEETKTAKGTQEEGKEGQAPVQEVNPEYKVTTGTVEKSTESELDFTTEVVPDDTKY
FT                   VDEEVVERQGSKGVQVTKTTYETVEVVETDKVLSTTTEVKTPAVPKVVKKGTKPVKGTA
FT                   VETREEVIPFATKEQEDDTLKRGTRQVAQEGVNGKKQITETYKTIRGEKTNEAPTVEET
FT                   VLQAPQDEIIKKGTKGLEKPTLEWVKTDKDVLKKSATASYTLNKPDGVEIKSIKVALKD
FT                   NTGTVIKEVTVEENNLNATLDNLKYYQGYTLSTTMVYNRGEGEETETLEDKEVQLDLKK
FT                   VEIKNIKETSLMSVDDAGVETDKSLLTEKPTDVAPLYLRVTTHDNKTTRLAVSSVEEVV
FT                   VDGKTLYKVVAKAPDLVQRREDDTLSEEYVHYFEKQLPKVDNVYYSFNELITDMQKNPT
FT                   GTFKLGADLNAANTPTPSKSYVTGEFKGKLSSVDGQHYTIHNTARPLFNNIVGGTVKNI
FT                   NLNNVNIDMPWADQIASVANVIKGGSLIENVKVKGNVLGRNWVSGFIDKIDSGGRLVNV
FT                   AFIGNVTSVGDGDKFLTGIVGENWKGYVEKAYVEANIKGKRAKAAGISYWSQNSGDNNA
FT                   VGRDGAIKKSVVKGSIDVEKPIEVGGAVGSLNYLGYIEDTVAMMKVKNGEIFYGSHDID
FT                   TDPYYTGERVNRNFIVDGVSEGKSSYTYSKQQKRIKSISQEEADKKIKELGITADKFTI
FT                   IDPIVNKLNNIKQKADTYKDTQDYKADRELTYRNIEKLQPFYNKEWIVDQGNKVPSNSK
FT                   LLTTEVLSVTGIKSGQFVTDLSDIDKIMIHYSDGAKEELNVTRQESNVQQVREYSITDL
FT                   DILYTPNMVEKDRAQLMTDVKSKLSSVELESDGVRQLLVKRDTKKDANANSVGRQNGYI
FT                   RDLFLEESFSEVKANLDKLVKQILENEDHQLNDNELAERALLKKVEDNKAKIMMGLAYL
FT                   NQYYAFKYDELSIKDIMMFKPDFYGKTASVIDRLINIGSAENNLKGDRTQDAYRGIISG
FT                   ATGKGSLHDFLTYNMKLFTNETDINVWFKKAIEKNAYVVEQPSTNPAFANKKYRLYEGI
FT                   NNGQHGRMILPLLNLKNAHLFMISTYNTISFSSFEKYGKDTDEKREKFKSEINKRAKEQ
FT                   VNYLDFWSRLATDNVRDKLLKSQNVVPTPVWDNHNSPNGWASRHGHIDGKPDYAPIREF
FT                   FGRINKYHGYKYGYGAYAYIFAAPQPMDAVYFVMTDLISDFGTSAFTHETTHVNDRMAY
FT                   YGGHWHREGTDLEAFAQGMLQTPSVSNPNGEYGALGLNMAYERQNDGNQWYNTNPNDLT
FT                   TRAEIDNYMKGFNDTLMLLDYLEGEAVLNKANQDLNNAWFKKVDKQLRGASTKNQYDKV
FT                   RDLTADEKNITLNSVDDLVDNNFMTKHGPGNNVYDPTGFGTAYVTVPITAGIYGGNTSE
FT                   GAPGSMSFKHNTFRMWGYYGYEKGFLNYASNMLKNESRQAGHNTLGDDFIIKKVSDNKF
FT                   STLEDWKKAYFKEVVDKAKAGFNPVTIDGTTYSSYDDLKNAFAAAVEKDKATLKNGSVK
FT                   SDNTVALKEKIYKKLLQQTDSFKTSIFR"
FT   gene            659634..661355
FT                   /locus_tag="SPT_0689"
FT   CDS_pept        659634..661355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0689"
FT                   /product="chorismate binding enzyme"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM TIGR00553"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23772"
FT                   /protein_id="ACO23772.1"
FT                   /translation="MHRKTVIDFRTLGERYTFTQPIKELKTRNVEEVADLLAQVESYQE
FT                   QGYYVVGYVSYEAAPAFEEKLTVHKVPLLGEYLLYFTVHDRVETSPIPLTYEDIDLPSN
FT                   WQEVTSAADYEKAIAQIHHHLRQGDTYQVNYTVQLKQKLSANPFAIYNRMVVEQEAGYN
FT                   AYVEHDEMAVISMSPELFFEQNDRELTTRPMKGTTQRGVTDQEDLEQASWLEQDPKNRS
FT                   ENMMIVDLLRNDMNRISEVGSEHVERLCQVEQYSTVWQMTSTIKSQLREDVDLVEIFRS
FT                   LFPCGSITGAPKIATMEIIKDLEPQPRGVYCGTIGLLLPNGRRIFNVAIRTIQLHKDQA
FT                   IYGVGGGITWDSTWESEYREVHQKAAVLYRKQARFQLITTGKISQKNLLFEDQHLERLR
FT                   KASRYFAFPFDAEDLGHKIEEECQDCEANRDYRLRISLSKSGEIEVNRQVLTPLSTSFC
FT                   QAQVCLQEAALNQSFTYFKTTHRPHLSLGEQEKIYHNKSGELLETSIGNLVLKIAGKLY
FT                   TPPIRLGILPGIYRQHLLETGQVEEKVLTLADLAQAEAIYGCNAVRGLYELSLEEN"
FT   gene            661356..661973
FT                   /locus_tag="SPT_0690"
FT   CDS_pept        661356..661973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23493"
FT                   /protein_id="ACO23493.1"
FT                   /translation="MKLIFLHGLGQSAESWKEVRNLLTDYPSEAIELFPSGVSNYQQAK
FT                   ERVYQHLAQETEPFVLIGLSLGAALTLELSSYDLPNLRALILSGCPLKLAGNILFYLQL
FT                   LIFKLLPKRVFEKQGADKTLMVGVSEELKTLDLTDIAGTCSYPTLLICGSKDKPNLSSM
FT                   KALHRLLTDSQFQIIPDGPHVLNKAKPKEFVEKTRSFLELLK"
FT   gene            662023..663021
FT                   /locus_tag="SPT_0691"
FT   CDS_pept        662023..663021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0691"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01473;
FT                   match to protein family HMM PF05901; match to protein
FT                   family HMM PF07553"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23957"
FT                   /protein_id="ACO23957.1"
FT                   /translation="MNKRLFLKMSLVTLPILALFSQPVLAEENIHFSSCKEAWANGYSD
FT                   IHEGEPGYSAKLDRDHDGVACELKNAPKGAFKAKQAATTQTDTTSSTASGWVKQDGSWY
FT                   YFDGNGNLVKNAWQGNYYLKADGKMAQSEWIYDSSYQAWYYLKSDGSYARNAWQGNYYL
FT                   KSDGKMAKGEWVYDATYQAWYYLKSDGSYARNAWQGNYYLKSDGKMAKGEWVYDATYQA
FT                   WYYLTSDGSYAYSTWQGNYYLKSDGKMAVNEWVDGGRYYVGADGVWKEGQASTASSSND
FT                   SNSEYSAALGKAKTYNSLFHMSKKRMYRQLTSDFDKFSNDAAQYAIDHLDD"
FT   gene            663148..664107
FT                   /locus_tag="SPT_0692"
FT   CDS_pept        663148..664107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0692"
FT                   /product="glucokinase (Glucose kinase)"
FT                   /EC_number="2.7.1.2"
FT                   /note="identified by match to protein family HMM PF00480;
FT                   match to protein family HMM TIGR00744"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23221"
FT                   /protein_id="ACO23221.1"
FT                   /translation="MSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVD
FT                   DMIESIQHRLDLLGLAAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKA
FT                   LGIPFFIDNDANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGE
FT                   LGHITVDFDQPIACTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVT
FT                   AKTVFDLAKEGDDLALIVYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGV
FT                   QKVYDENSFPQVRTSTKLALATLGNDAGVIGAASLVLQ"
FT   gene            664204..665043
FT                   /gene="thyA"
FT                   /locus_tag="SPT_0693"
FT   CDS_pept        664204..665043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="SPT_0693"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="identified by match to protein family HMM PF00303;
FT                   match to protein family HMM TIGR03284"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22621"
FT                   /db_xref="GOA:C1CQE7"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQE7"
FT                   /protein_id="ACO22621.1"
FT                   /translation="MTKADTIFKENIERILKEGVFSEQARPKYKDGTVANSKYVTGAFS
FT                   EYDLSKGEFPITTLRPIAIKSAIKEVLWIYQDQSNSLEVLNDKYNVHYWNDWEVGDTGT
FT                   IGERYGAVVKKHDIINKLLKQLETNPWNRRNIISLWDYQAFEETDGLLPCAFQTMFDVR
FT                   RVDGEIYLDATLTQRSNDMLVAHHINAMQYVALQMMIAKHFGWKVGKFFYFINNLHIYD
FT                   NQFEQAQELLRREPSNCQPRLVLNVPDGTNFFDIKAEDFELVDYDPVKPQLKFDLAI"
FT   gene            complement(665090..665260)
FT                   /locus_tag="SPT_0694"
FT   CDS_pept        complement(665090..665260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0694"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24099"
FT                   /protein_id="ACO24099.1"
FT                   /translation="MAKGFAKGLVTGVAGTVAAVAGAVYAFKKKVIEPEEQKAAFIEEN
FT                   RKKAARRRVSR"
FT   gene            665381..666265
FT                   /gene="miaA"
FT                   /locus_tag="SPT_0695"
FT   CDS_pept        665381..666265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="SPT_0695"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="identified by match to protein family HMM PF01715;
FT                   match to protein family HMM TIGR00174"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23398"
FT                   /db_xref="GOA:C1CQE9"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQE9"
FT                   /protein_id="ACO23398.1"
FT                   /translation="MKTKIIVIVGPTAVGKTALAIEVAKRFNGEVVSGDSQQVYRGLDI
FT                   GTAKASPEEQAAVLHHLIDVREITESYSAFDFVSEAKMTIEDIHSRGKLAIIAGGTGLY
FT                   IQSLLEGYHLGGETPHEEILAYRASLEPYSDEELAHLVEQAGLEIPQFNRRRAMRALEI
FT                   AHFGQDLENQETLYEPLIICLDDERSQLYERINHRVDLMFEAGLLDEAKWLFDHSPNVQ
FT                   AAKGIGYKELFPYFRGEQTFEEASESLKQATRRFAKRQLTWFRNRMQVTFYQIGESGVQ
FT                   DRILSQIEEFLDD"
FT   gene            666258..667496
FT                   /gene="hflX"
FT                   /locus_tag="SPT_0696"
FT   CDS_pept        666258..667496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="SPT_0696"
FT                   /product="GTP-binding proten HflX"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR03156"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22969"
FT                   /protein_id="ACO22969.1"
FT                   /translation="MIETEKKEERVLLIGVELQGMDSFDLSMEELASLAKTAGAVVVDS
FT                   YRQKREKYDSKTFVGSGKLEEIALMVDAEEITTVIVNNRLTPRQNVNLEEVLGVKVIDR
FT                   MQLILDIFAMRARSHEGKLQVHLAQLKYLLPRLVGQGIMLSRQAGGIGSRGPGESQLEL
FT                   NRRSVRNQITDIERQLKVVEKNRATVREKRLESSTFKIGLIGYTNAGKSTIMNILTSKT
FT                   QYEADELFATLDATTKSIHLGGNLQVTLTDTVGFIQDLPTELVSSFKSTLEESKHVDLL
FT                   VHVIDASNPYHEEHEKTVLSIMKDLDMEDIPHLTLYNKADLVEDFTPTQTPYTLISAKS
FT                   EDSRENLQALLLDKIKEIFEAFTLRVPFSKSYKIHDLESVAILEERDYQEDGEVITGYI
FT                   SEKNKWRLEEFYD"
FT   gene            667489..668112
FT                   /locus_tag="SPT_0697"
FT   CDS_pept        667489..668112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0697"
FT                   /product="cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22234"
FT                   /protein_id="ACO22234.1"
FT                   /translation="MTDIKTLALKYGGYTSLDKVYLDQLLAGKTEQEQLTLITPPPSVV
FT                   NAYFAELYQKKSPQAATDYFAELSQELNLYNTEPSFTLENKPFIRLNLSGKSFGFCYES
FT                   DGFGRIFSENEEKISDDLLFEIAQIFSHQLVFEESGKIYMKPVKDEEVVSLESLTALTD
FT                   LERLADGRKRLKGYSQEDLLQEAAAFSGKRYFRSENRTAMLYID"
FT   gene            668127..669056
FT                   /gene="rnz"
FT                   /locus_tag="SPT_0698"
FT   CDS_pept        668127..669056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnz"
FT                   /locus_tag="SPT_0698"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM TIGR02651"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23385"
FT                   /db_xref="GOA:C1CQF2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQF2"
FT                   /protein_id="ACO23385.1"
FT                   /translation="MDIQFLGTGAGQPSKARNVSSLALKLLDEINEVWLFDCGEGTQNR
FT                   ILETTIRPRKVSKIFITHLHGDHIFGLPGFLSSRAFQANEEQTDLEIYGPQGIKSFVLT
FT                   SLRVSGSRLPYRIHFHEFDQDSLGKILETDKFTVYAEELDHTIFCVGYRVMQKDLEGTL
FT                   DAEKLKAAGVPFGPLFGKIKNGQDLVLEDGTEIKAADYISAPRPGKIITILGDTRKTDA
FT                   SVRLAVNADVLVHESTYGKGDEKIARNHGHSTNMQAAQVAVEAGAKRLLLNHISARFLS
FT                   KDISKLKKDAATIFENVHVVKDLEEVEI"
FT   gene            669077..669832
FT                   /locus_tag="SPT_0699"
FT   CDS_pept        669077..669832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0699"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23766"
FT                   /protein_id="ACO23766.1"
FT                   /translation="MPTILITGASGGLAQEMVKLLPNDQLILLGRNKEKLAQLYGNYSH
FT                   AELIEIDITDDSALEALVTDLYLRYGKIDVLINNAGYGIFEGFDQIADKDIHQMFEVNT
FT                   FALMNLSRHLAARMKESSKGHIINIVSMAGLIATGKSSLYSATKFAAIGFSNALRLELM
FT                   PYGVYVTTVNPGPIRTGFFDQADPDGTYLKSVDRFLLEADAVAKKIVKIIGKNKRELNL
FT                   PILLNLAHKFYTLFPKLADKLAGETFNYK"
FT   gene            complement(669886..670854)
FT                   /locus_tag="SPT_0700"
FT   CDS_pept        complement(669886..670854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0700"
FT                   /product="regulatory function on capsule expression"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23060"
FT                   /protein_id="ACO23060.1"
FT                   /translation="MLLIFLSSLAILRQVWYNKNMRIQQLHYIIKIVETGSMNEAAKQL
FT                   FITQPSLSNAVRDLENEMGIEIFIRNPKGITLTRDGMEFLSYARQVVEQTQLLEERYKN
FT                   PVAHRELFSVSSQHYAFVVNAFVSLLKKSDMEKYELFLRETRTWEIIDDVKNFRSEVGV
FT                   LFLNSYNRDVLTKMLDDNHLLAHHLFTAQPHIFVSKTNPLAKKDKVKLSDLENFPYLSY
FT                   DQGTHNSFYFSEEILSQEHHKKSIVVSDRATLFNLLIGLDGYTIATGILNSNLNGDNIV
FT                   SIPLDIDDPIELVYIQHEKTSLSKMGERFIDYLLEEVQFDS"
FT   gene            670858..671127
FT                   /locus_tag="SPT_0701"
FT   CDS_pept        670858..671127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0701"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06014"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22577"
FT                   /protein_id="ACO22577.1"
FT                   /translation="MSLFLKKTQNFARMSLMKTFYDVQQFLKRFGIIVYMGKRLYDIEL
FT                   MKLELSRIYDAGLMDKLDYLEAEAVLRREHKVELDYIEKNGEKN"
FT   gene            671127..671507
FT                   /locus_tag="SPT_0702"
FT   CDS_pept        671127..671507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0702"
FT                   /product="rhodanese family protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22662"
FT                   /protein_id="ACO22662.1"
FT                   /translation="MVTWILWALILAMLAWMGFNYLRIRRAAKIVDNEEFEALIRTGQL
FT                   IDLRDPAEFHRKHILGARNIPSSQLKTSLAALRKDKPVLLYENQRAQRVTNAALYLKKQ
FT                   GFSEIYILSYGLDSWKGKVKTS"
FT   gene            671596..671823
FT                   /locus_tag="SPT_0703"
FT   CDS_pept        671596..671823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24152"
FT                   /protein_id="ACO24152.1"
FT                   /translation="MKEKKKNPLFVGILSIILGLLFPIVGLILGIIGLVLAISYQKESQ
FT                   LDYKIEKILNILGIVISVVNWIVAIALIFR"
FT   gene            complement(671863..672588)
FT                   /locus_tag="SPT_0704"
FT   CDS_pept        complement(671863..672588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0704"
FT                   /product="ribosomal small subunit pseudouridine synthase A,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24092"
FT                   /protein_id="ACO24092.1"
FT                   /translation="MRLDNLLAQEKISRKAMKQALLKGEILVDGCPARSLAQNIDTGLQ
FT                   ELLFQDRIIQGYEHTYLMLHKPAGVVTANKDKELPTVMDLLPSDIQSDKLYAVGRLDRD
FT                   TTGLLLLTDSGPLGFQLLHPQYHVDKTYQVQVNGLLTPDHIQAFQKGIVFLDGTVCKPA
FT                   KLEILSASPSLSQASITISEGKFHQIKKMFLSVGVKVTSLKRIQFGDFTLNPDLAESNY
FT                   RPLNQKELQIIKNYLEMSR"
FT   gene            672750..674591
FT                   /gene="typA"
FT                   /locus_tag="SPT_0705"
FT   CDS_pept        672750..674591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="SPT_0705"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23651"
FT                   /protein_id="ACO23651.1"
FT                   /translation="MTKLREDIRNIAIIAHVDHGKTTLVDELLKQSETLDARTELAERA
FT                   MDSNDIEKERGITILAKNTAVAYNGTRINIMDTPGHADFGGEVERIMKMVDGVVLVVDA
FT                   YEGTMPQTRFVLKKALEQDLVPIVVVNKIDKPSARPAEVVDEVLELFIELGADDDQLDF
FT                   PVVYASAINGTSSLSDDPADQEATMAPIFDTIIDHIPAPVDNSDEPLQFQVSLLDYNDF
FT                   VGRIGIGRVFRGTVKVGDQVTLSKLDGTTKNFRVTKLFGFFGLERREIQEAKAGDLIAV
FT                   SGMEDIFVGETITPTDAVEALPILHIDEPTLQMTFLVNNSPFAGKEGKWVTSRKVEERL
FT                   QAELQTDVSLRVDPTDSPDKWTVSGRGELHLSILIETMRREGYELQVSRPEVIVKEIDG
FT                   VKCEPFERVQIDTPEEYQGSVIQSLSERKGEMLDMISTGNGQTRLVFLVPARGLIGYST
FT                   EFLSMTRGYGIMNHTFDQYLPLIPGEIGGRHRGALVSIDAGKATTYSIMSIEERGTIFV
FT                   NPGTEVYEGMIIGENSRENDLTVNITKAKQMTNVRSATKDQTAVIKTPRILTLEESLEF
FT                   LNDDEYMEVTPESIRLRKQILNKAEREKANKKKKSAE"
FT   gene            674611..674865
FT                   /locus_tag="SPT_0706"
FT   CDS_pept        674611..674865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0706"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22373"
FT                   /protein_id="ACO22373.1"
FT                   /translation="MVYLVLGILLLLLYVFATPESIKGTVNIVAMVCILVALLILLVLS
FT                   FLKIFQLPTEIFLAIAMLILAYFSVRDITLMPVKKSKRR"
FT   gene            675230..675529
FT                   /locus_tag="SPT_0707"
FT   CDS_pept        675230..675529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0707"
FT                   /product="bacteriocin, lactococcin 972 family"
FT                   /note="identified by match to protein family HMM TIGR01653"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23993"
FT                   /protein_id="ACO23993.1"
FT                   /translation="MKTKKHRLLALALISSFTLLGAASAAVQYPDGGVWTYGEGSGGGW
FT                   AFSNYYHGKKYHYSSIVSRWNGHSDKGEAPAGKTSYAWIWTKWGEQVAFYCDYD"
FT   gene            675600..677621
FT                   /locus_tag="SPT_0708"
FT   CDS_pept        675600..677621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0708"
FT                   /product="bacteriocin-associated integral membrane protein"
FT                   /note="identified by match to protein family HMM PF07242;
FT                   match to protein family HMM TIGR01654"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22777"
FT                   /protein_id="ACO22777.1"
FT                   /translation="MKKLFILLSTFFLSFFLAWIIVLRAPQYLYASYDSVSLLRVKKDT
FT                   QEPTREVFEQELENFANSEQSLIARRIVEPSKDGTTHFIYATYGQGTLPKEFQEASQES
FT                   RERSDPLNSYLLLSGSLTKEKLADKLGDLGYKASADRKIPPYFLAFRILLNPLILISLA
FT                   IFGLSFFALVIITRIKEMRAAGIKLFSGQTLLSIMGHSLSTDIKWLLLSALLSFLGGGV
FT                   VLFSQGLFYPILLATYGFGISFYLLFLLAISILLMLLYLMSLNYKALVPVIKGRLPLKR
FT                   LMILTLLCQLVAVFTVGYAVKTGLTSYQRLKELEISKQAWQDRADYYQISFGLGDRGKD
FT                   IENQSKWYAFAKEAIEEEQALYVKDNLLHFANPQGKNEQGETLDTYSPDANTLYVSPSY
FT                   LDKEKVVVDAETKQKLAHLQKGEFILLLPEHLRSREAELKKVFEERLSYYGKSGEEASA
FT                   PLDYEMKAHVSYLSMGEKRFVYNNGENPVSTQYLTDPILVVFTPTSTGDSFISLSSWSI
FT                   NAGKQLFIKGYESGLELLKKAGIYEQVSYLKEGRSVYLTRYNEVQTETATLILGAIVGI
FT                   ASSLLLFYSVNILYFEQFRRDILIKRISGLRFFETHAQYMVSQFASFVFGASLFILSSR
FT                   DLVIGLLTLLVFLASAVLTLYRQAQKESRVSMTIMKGK"
FT   gene            677623..678264
FT                   /locus_tag="SPT_0709"
FT   CDS_pept        677623..678264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0709"
FT                   /product="ABC transporter ATP-binding protein-sodium
FT                   transport"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22720"
FT                   /protein_id="ACO22720.1"
FT                   /translation="MIELKNISKKFGSRQLFSDTNLHFEGGKIYALIGTSGCGKTTLLN
FT                   MIGRLEPYDKGQIIYDGTSLKDIKPSVFFRDYLGYLFQDFGLIESQTVKENLNLGLVGK
FT                   KLKEKEKISLMKQALNRVNLSYLDLKQPIFELSGGEAQRVALAKIILKDPPLILADEPT
FT                   ASLDPKNSEELLSILESLKNPNRTIIIATHNPLIWEQVDQVIRVTDLSHR"
FT   gene            678368..679720
FT                   /gene="murD"
FT                   /locus_tag="SPT_0710"
FT   CDS_pept        678368..679720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SPT_0710"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01087"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24105"
FT                   /db_xref="GOA:C1CQG4"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQG4"
FT                   /protein_id="ACO24105.1"
FT                   /translation="MKVIDQFKNKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFED
FT                   NPAAQCLLEEGIKVITGGHPLELLDEEFALMVKNPGIPYNNPMIEKALAKGIPVLTEVE
FT                   LAYLISEAPIIGITGSNGKTTTTTMIGEVLTAAGQHGLLSGNIGYPASQVAQIATDKNT
FT                   LVMELSSFQLMGVQEFHPEIAVITNLMPTHIDYHGLFEEYVAAKWNIQNKMAAADFLVL
FT                   NFNQDLAKDLASKTEATVVPFSTLEKVDGAYLEDGQLYFRGEVVMAANEIGVPGSHNVE
FT                   NALATIAVAKLRGVDNQTIKETLSAFGGVKHRLQFVDDIKGVKFYNDSKSTNILATQKA
FT                   LSGFDNSKVVLIAGGLDRGNEFDELVPDITGLKKMVILGQSAERVKRAADKAGVAYVEA
FT                   TDIADATRKAYELATQGDVVLLSPANASWDMYANFEVRGDLFIDTVAELKE"
FT   gene            679722..680780
FT                   /locus_tag="SPT_0711"
FT   CDS_pept        679722..680780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0711"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="identified by match to protein family HMM PF03033;
FT                   match to protein family HMM PF04101"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23515"
FT                   /db_xref="GOA:C1CQG5"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQG5"
FT                   /protein_id="ACO23515.1"
FT                   /translation="MKKIVFTGGGTVGHVTLNLLLMPKFIEDGWEVHYIGDKRGIEHQE
FT                   ILKSGLDVTFHSIATGKLRRYFSWQNMLDVFKVGWGIVQSLFIMLRLRPQTLFSKGGFV
FT                   SVPPVIAARVSGVPVFIHESDLSMGLANKIAYKFATKMYSTFEQASSLSKVEHVGAVTK
FT                   VSDQKNPEPDELVDIQSHFNHKLPTVLFVGGSAGARVFNQLVTDHKKELTERYNIINLT
FT                   GDSSLNELSQNLFRVDYVTDLYQPLMELADIVVTRGGANTIFELLAIAKLHVIVPLGRE
FT                   ASRGDQIENAAYFVKKGYAEDLQESDLTLDSLEEKLSHLLSHKEDYQAKMKASKELKSL
FT                   ADFYQLLKKDLS"
FT   gene            680790..682010
FT                   /locus_tag="SPT_0712"
FT   CDS_pept        680790..682010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0712"
FT                   /product="cell division protein DivIB"
FT                   /note="identified by match to protein family HMM PF03799;
FT                   match to protein family HMM PF08478"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24065"
FT                   /protein_id="ACO24065.1"
FT                   /translation="MSKDKKNEDKEILEELKELSEWQKRNQEYLKKKAEEEAALAEEKE
FT                   KERQARMGEESEKSEDKQDQESETDQEDSESAKEKSEEKVASSEADKEKEEKEESESKE
FT                   KEEQDKKLAKKAIKEKPAKAKIPGIHILRAFTILFPSLLLLIVSAYLLSPYATMKDIRV
FT                   EGTVQTTADDIRQASGIQDSDYTINLLLDKAKYEKQIKSNYWVESAQLVYQFPTKFTIK
FT                   VKEYDIVAYYISGENHYPILSSGQLETSSVSLNSLPETYLSVLFNDSEQIKAFVSELAQ
FT                   ISPELKAAIQKVELAPSKVTSDLIRLTMNDSDEVLVPLSEMSKKLPYYSKIKPQLSEPS
FT                   VIDMEAGIYSYTVADKLIMEAEEKAKQEAKEAEKKQEEEQKRLEEEQKKQEEESNRNQT
FT                   TQRSSRR"
FT   gene            682243..682944
FT                   /gene="pyrF"
FT                   /locus_tag="SPT_0713"
FT   CDS_pept        682243..682944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="SPT_0713"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="identified by match to protein family HMM PF00215;
FT                   match to protein family HMM TIGR01740"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22740"
FT                   /db_xref="GOA:C1CQG7"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQG7"
FT                   /protein_id="ACO22740.1"
FT                   /translation="MREHRPIIALDFPSFEAVKEFLALFPAEESLYLKVGMELYYAAGP
FT                   EIVSYLKGLGHSVFLDLKLHDIPNTVKSAMKVLSQLGVDMTNVHAAGGVEMMKAAREGL
FT                   GSQAKLIAVTQLTSTSEAQMQEFQNIQTSLQESVIHYAKKTAEAGLDGVVCSAQEVQVI
FT                   KQATNPDFICLTPGIRPAGVAVGDQKRVMTPADAYQIGSDYIVVGRPITQAEDPVAAYH
FT                   AIKDEWTQDWN"
FT   gene            682978..683610
FT                   /gene="pyrE"
FT                   /locus_tag="SPT_0714"
FT   CDS_pept        682978..683610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="SPT_0714"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23169"
FT                   /protein_id="ACO23169.1"
FT                   /translation="MTLAKDIASHLLKIQAVYLKPEEPFTWASGIKSPIYTDNRVTLAY
FT                   PETRTLIENGFVEAIKEAFPEVEVIAGTATAGIPHGAIIADKMDLPFAYIRSKPKDHGA
FT                   GNQIEGRVAQGQKMVVVEDLISTGGSVLEAVAAAKREGADVLGVVAIFSYQLPKADKNF
FT                   ADAGVKLVTLSNYSELIHLAQEEGYITPEGLDLLKRFKEDQENWQEG"
FT   gene            684071..684193
FT                   /locus_tag="SPT_0715"
FT   CDS_pept        684071..684193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0715"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23319"
FT                   /protein_id="ACO23319.1"
FT                   /translation="MYYNGGGDNYIGSGTRLAMAPQFGNHVRIHTSGSWSPDSY"
FT   gene            684289..685053
FT                   /locus_tag="SPT_0716"
FT   CDS_pept        684289..685053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0716"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24005"
FT                   /protein_id="ACO24005.1"
FT                   /translation="MEFFICNLVRVVQSPRFYMSLFLTLLCMSLGNFLAFNGIYKIEGL
FT                   SIFFAASSIRGFSPISLVAALICTLPYSSQIIEDAESHFLTAQLCRISKKRYLAIVGST
FT                   AIISSFLVFFLPYLLLLGINLLVTPYQEIYIGDYSGALKELFDSNQFLYSLVTTLWYGV
FT                   WGAVFSIFGLASALLVKKKLGAIFIPVAYMMVGGILWAILGLSYLEPVTTLALGYQKDI
FT                   SLSLVSGHLAFILFVSCLVVYGTFFLHSEDYV"
FT   gene            685002..685535
FT                   /locus_tag="SPT_0717"
FT   CDS_pept        685002..685535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0717"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22910"
FT                   /protein_id="ACO22910.1"
FT                   /translation="MFGCLWYIFSTFRGLCIMKQFVQFYKKDFLAVLVYFILLLSCVLS
FT                   STVYLLRCRQYSIHPNVLEWILVLLQDMTTGVYCFPFTYILFFFYLMNNYFNRLECRIR
FT                   LKSIKHFTSFSFKLAALSTGIWTATLFLLIFLIAFSNGFSFSLEIKEVDFLREFYGISI
FT                   ANNASFFIGFFSLI"
FT   gene            685808..686512
FT                   /locus_tag="SPT_0718"
FT   CDS_pept        685808..686512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0718"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22439"
FT                   /protein_id="ACO22439.1"
FT                   /translation="MEMGKLSSHMWRLNQIIYTKYFWGYVLFWILICLGLWYWLEGNDR
FT                   LVIEILKGPNLSQNSFLVLSIWLLHWFIIHTFFLAVVYRRRASDFFMEVIRFSSIKLWI
FT                   RYQIWTCFLYGLILIMVKVLVIQFMLQLPNWDIGVLFIVDSLNACVLVLFCFMLYALGA
FT                   NVQMNFACVSFFLLMIVFGGLFVGNRTNYLFYILNRGNGDIGRDLFLQLLFLVFLFKSI
FT                   FYFTRQKRRFIE"
FT   gene            686509..687156
FT                   /locus_tag="SPT_0719"
FT   CDS_pept        686509..687156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0719"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22575"
FT                   /protein_id="ACO22575.1"
FT                   /translation="MNEIIILKNIELKLKKTCVFQNLNFSCKQGEIIGITGANGSGKSV
FT                   LFKLIAGLYSPSYGEVLINGENIVPERKIPANLGALIEEPGFINYYSGFKNLQYLASIR
FT                   GVVGNQEINDTLKIVGLYEQKDQKVKTYSLGMRKKLGIAQAIMENPSILLLDEPMNALD
FT                   KSSVENMRTLFRKLSSEKGTTILIASHSEEDIRILCDKVYAIEDKVCTLCSD"
FT   gene            complement(687236..688101)
FT                   /pseudo
FT                   /locus_tag="SPT_0721"
FT                   /note="ABC-type amino acid transport/signal transduction
FT                   system, periplasmic component/domain, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            complement(688113..688870)
FT                   /pseudo
FT                   /locus_tag="SPT_0722"
FT                   /note="glutamate/aspartate transport ATP-binding protein
FT                   GltL, authentic frameshift; this gene contains a frame
FT                   shift which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF00005"
FT   gene            complement(688871..689062)
FT                   /locus_tag="SPT_0723"
FT   CDS_pept        complement(688871..689062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0723"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23308"
FT                   /protein_id="ACO23308.1"
FT                   /translation="MGSLVVLIGVVEVTKVGQQIIDSNRLTIPTASFWIYGTILVLYFA
FT                   VCYPISKLSTHLEKHWRN"
FT   gene            689222..690567
FT                   /pseudo
FT                   /locus_tag="SPT_0724"
FT                   /note="Spn1 transposase, authentic frameshift; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01609"
FT   gene            complement(690634..691257)
FT                   /locus_tag="SPT_0726"
FT   CDS_pept        complement(690634..691257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0726"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22821"
FT                   /protein_id="ACO22821.1"
FT                   /translation="MQDSGIQVLFQGNNLLRILQGLGVTIGISILSVLLSMMFGTVMGI
FT                   IMTSHSRIIRFLTRLYLEFIRIMPQLVLLFIVYFGLARNFNINISGETSAIIVFTLWGT
FT                   AEMGDLVRGAITSLPKHQFESGQALGLTNVQLYYHIIIPQVLRRLLPQAINLVTRMIKT
FT                   TSFPNHSYLSQLDVTYKTPDLMSHFLPPHEVSFTFCCSSIVFPR"
FT   gene            complement(691217..691897)
FT                   /locus_tag="SPT_0727"
FT   CDS_pept        complement(691217..691897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0727"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-glutamine transport"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22344"
FT                   /protein_id="ACO22344.1"
FT                   /translation="MDWSIVEQYLPLYQKAFFLTLHIAVWGILGSFLLGLIVSIIRHYR
FT                   IPVLAQVATAYIELSRNTPLLIQLFFLYFGLPRIGIVLSSEVCATLGLVFLGGSYMAES
FT                   FRSGLEAISQTQQEIGLAIGLTPLQVFRYVVLPQATAVALPSFSANIIFLIKETSVFSA
FT                   VALADLMYVAKDLIGLYYETDIALAMLVVAYLIMLLPISLVFSWIERRLRHAGFGNPST
FT                   LSRK"
FT   gene            692112..692258
FT                   /locus_tag="SPT_0728"
FT   CDS_pept        692112..692258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0728"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23719"
FT                   /protein_id="ACO23719.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAGDTFT
FT                   SFQ"
FT   gene            692386..693876
FT                   /gene="lysS"
FT                   /locus_tag="SPT_0729"
FT   CDS_pept        692386..693876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SPT_0729"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23017"
FT                   /protein_id="ACO23017.1"
FT                   /translation="MSTEHMEELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELK
FT                   DKYANLDKEQLHDKNETATIAGRLITKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENY
FT                   EIFKKADLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRK
FT                   RYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHN
FT                   AQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADF
FT                   QDIMDLTEGIIQHAAKSVKGDGPVNYQGTEIKINELFKRVHMVDAIREITGVDFWQDMT
FT                   LEEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNP
FT                   EDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEA
FT                   LEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK"
FT   gene            694296..695642
FT                   /locus_tag="SPT_0730"
FT   CDS_pept        694296..695642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0730"
FT                   /product="Spn1 transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22546"
FT                   /protein_id="ACO22546.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKER
FT                   ISKYLATNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGF
FT                   FGDKTDSSTLIKNEVRMIMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVR
FT                   TGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPGRKASLMMH"
FT   gene            696209..697345
FT                   /gene="lctO"
FT                   /locus_tag="SPT_0731"
FT   CDS_pept        696209..697345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctO"
FT                   /locus_tag="SPT_0731"
FT                   /product="L-lactate oxidase"
FT                   /EC_number="1.1.3.-"
FT                   /note="identified by match to protein family HMM PF01070;
FT                   match to protein family HMM TIGR02708"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23973"
FT                   /protein_id="ACO23973.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFT
FT                   LRENIRAFNHKLIVPHTLCDVENPSTEIEFAGEKLSSPIIMAPVAAHKLANEQGEVATA
FT                   RGVHEFGSLYTTSSYSTVDLPEISEALQGTPHWFQFYFSKDDGINRHIMDRVKAEGYKA
FT                   IVLTADATVGGNREVDKRNGFVFPVGMPIVEEYLPEGAGKSMDFVYKSAKQRLSPRDVE
FT                   FIAEYSGLPVYVKGPQCREDVERSLAAGASGIWVTNHGGRQIDGGPAAFDSLQEVAEAV
FT                   DRRVPIVFDSGVRRGQHVFKALASGADLVAIGRPVIYGLALGGSVGVRQVFEHLNAELK
FT                   TVMQLSGAQTIEDVKHFKLRHNPYNPTFPVDPRDLKLY"
FT   misc_binding    697597..697685
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); riboswitch00005"
FT   gene            697901..698569
FT                   /locus_tag="SPT_0732"
FT   CDS_pept        697901..698569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0732"
FT                   /product="tena/thi-4 family"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23424"
FT                   /protein_id="ACO23424.1"
FT                   /translation="METQDYAFQPGLTVGELLKSSQKDWQAAINHRFVKELFAGTIENK
FT                   VLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLGFLEADEDGYFQKAFKELK
FT                   VAENDYLEVTLHPVTKAFQDLMYSAVASSDYAHLLVMLVIAEGLYLDWGSKDLALPEVY
FT                   IHSEWINLHRGPFFAEWVQFLVDELNRVGKNREDLTELQQRWNQAVALELAFFDIGYDV
FT                   "
FT   gene            698806..699588
FT                   /gene="thiM"
FT                   /locus_tag="SPT_0733"
FT   CDS_pept        698806..699588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="SPT_0733"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="identified by match to protein family HMM PF02110;
FT                   match to protein family HMM TIGR00694"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22303"
FT                   /db_xref="GOA:C1CQI2"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQI2"
FT                   /protein_id="ACO22303.1"
FT                   /translation="MTSLKLLKEKAPLVICITNDVVKNFTANGLVALGASPAMSEFPAD
FT                   LEDLLKYAGGLLINIGTLTDENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADD
FT                   LINNYKLAAIRGNAGEIASLVGIDVASKGVDSAGVDNIDEIALAANEKFNIPIVVTGEV
FT                   DAIAVNGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLEKGQELKSLETAMLVYNIAG
FT                   EIAEKRPNGHLPGTFKAEFINALYEITDEDVKEFKRVK"
FT   gene            699590..700219
FT                   /gene="thiE1"
FT                   /locus_tag="SPT_0734"
FT   CDS_pept        699590..700219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE1"
FT                   /locus_tag="SPT_0734"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22970"
FT                   /protein_id="ACO22970.1"
FT                   /translation="MFHKELLKLYFICGTTTCQGKNLYTVVEEALKGGITLFQFREKGE
FT                   GALEGLEKLELAIQIKELCKKYNVPFIVNDDIDLAMEIDADGVHVGQDDIGVDEIRKLM
FT                   PDKIIGLSIRNEEEFQQSKVEYVDYVGVGPVFDTQSKDDAGGAIGYEGLELMRKLLPQM
FT                   PLVAIGGIQTKHIKDIIKTNVDGVSIISAISYAKNIEKTVREMSEQ"
FT   misc_binding    700428..700516
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); riboswitch00004"
FT   gene            700778..701338
FT                   /locus_tag="SPT_0735"
FT   CDS_pept        700778..701338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0735"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24262"
FT                   /protein_id="ACO24262.1"
FT                   /translation="MLKKWQLKDVILLAFLSIFFGGVFVGSGYVYNILSLLLTPLGLQA
FT                   FANEILFGLWCMAAPIAAIFVPRVGSATIGEVLAALAEVLYGSQFGLGALLSGLVQGLG
FT                   SEFGFIVTKNRYESWLSLTANSIGITLVSFVYEYIKLGYYAFSLPFVLSLLVVRFISVY
FT                   FFCTILVRAIVKLYHQFATGGKA"
FT   gene            701339..702724
FT                   /locus_tag="SPT_0736"
FT   CDS_pept        701339..702724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0736"
FT                   /product="ABC transporter ATP-binding protein-cobalt or
FT                   other cation transport"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23842"
FT                   /protein_id="ACO23842.1"
FT                   /translation="MGLELRAIQSPIFSEPFDFTFHAQAFTLLVGSSGSGKSSLFQVIA
FT                   QVSSLPYSGQVLIDGSEVSQLSIIARVQKVGILFQNPNHQFTMENLFEELIFTLENIGY
FT                   HLQEIDSKIAEVVQQCRCEAILHRPIHHLSGGEKQKAALAVLFAMNPRVYLLDEPFASI
FT                   DRKSRIEILEILKELALDGKTVILCDHDLSDYKAYIDHMVELRDGKLREVFQIPSYEMT
FT                   QVASKEVASSPELFHMNRVTGELGNRPLFSIADFTFYQGISCILGDNGVGKSTLFRSIL
FT                   QFQKYKGRIAWKGTVLKKKKSLYRDLTGVVQEAEKQFIRVSLREELQLDGPDSERNQRI
FT                   FQALRYFDLEQAVDKSPYQLSGGQQKILQLLTILTSKASVILLDEPFAGLDDRACHYFC
FT                   KWIVEERNQGRSFLLISHRLDPLISVVDYWIEMTSQGLSHVKEVTITKPLTSQSSNTQG
FT                   EVR"
FT   gene            702726..703376
FT                   /locus_tag="SPT_0737"
FT   CDS_pept        702726..703376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0737"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23984"
FT                   /protein_id="ACO23984.1"
FT                   /translation="MVKVATQTPIISLFLLILSLETSFIPSIALNLSVVAFCILFMLYY
FT                   RRFKMLAWMIILAILPSLANYWAVQLHGDASQAVMLGTRAFVTVCIGLVFVSSISLKEL
FT                   LLYLAQKGLSRSWSYALIVVFNSFPLIQQEIKSLKEACLLRGQELHFWSPLIYSKVLMT
FT                   VFRWRHLYLRALSAHGYDEHAQLKNSYRTFYIPKKTKLIYLLFFLLLQTSLFL"
FT   gene            703387..704079
FT                   /locus_tag="SPT_0738"
FT   CDS_pept        703387..704079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0738"
FT                   /product="tena/thi-4 family"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23404"
FT                   /protein_id="ACO23404.1"
FT                   /translation="MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDA
FT                   YYLKAFSEIYHLLADKTSNQEMKRLLKQNAQGLVEGELFIRQQFFKEMEISDQEMEQHP
FT                   IAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYHDIGKSLNLKPSPNPLYQQWIETY
FT                   ITDELEQQIREEGALVNQLYRESDETDKQKMLDAFYISVHMEAKFWEMAYQHQTWKSDL
FT                   QSLEKGEE"
FT   gene            704084..704608
FT                   /gene="thiW"
FT                   /locus_tag="SPT_0739"
FT   CDS_pept        704084..704608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiW"
FT                   /locus_tag="SPT_0739"
FT                   /product="ThiW protein"
FT                   /note="identified by match to protein family HMM TIGR02359"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23114"
FT                   /protein_id="ACO23114.1"
FT                   /translation="MRKHQLQVHKLTILSMMIALDVVLTPIFRIEGMAPMSSVVNILAG
FT                   IMMGPVYALAMATVTAFIRMTTQGIPPLALTGATFGALLAGLFYKYGRKFHYSALGEIL
FT                   GTGIIGSIVSYPVMVLFTGSAAKLSWFIYTPRFFGATLIGTAISFIAFRFLIKQEFFKK
FT                   VQGYFFSERID"
FT   gene            704608..705411
FT                   /locus_tag="SPT_0740"
FT   CDS_pept        704608..705411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0740"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /note="identified by match to protein family HMM PF02110"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22523"
FT                   /db_xref="GOA:C1CQI9"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQI9"
FT                   /protein_id="ACO22523.1"
FT                   /translation="MQEFTNPFPIDSSSLIHCMTNEISCEMLANGILALGCKPVMADDP
FT                   REVLDFTKQSQALFINLGHLSAEKEKAIRIAASYAAQVCLPMVVDAVGVTTSSIRKSLV
FT                   KDLLDYRPTVLKGNMSEIRSLVGLKHHGVGVDASAKDQETEDLLQVLKDWCQTYPGMSF
FT                   LVTGPKDLIVSENQVAVLENGCTELDWITGTGDLVGALTAVFLSQGKTGFEASCLAVSY
FT                   LNIAAEKIVVQGMGLEEFRYQVLNQLSLLRRDENWLDTIKGEAYE"
FT   gene            705404..706036
FT                   /gene="thiE2"
FT                   /locus_tag="SPT_0741"
FT   CDS_pept        705404..706036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE2"
FT                   /locus_tag="SPT_0741"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22674"
FT                   /protein_id="ACO22674.1"
FT                   /translation="MNREALRLYLVTNRYQDSVESFLAKVETACRSGVTIVQLREKNLT
FT                   TNQYYQLAKQVKEITDAYQVPLIIDDRLDVCLAVDAAGLHIGDDELPVSVARQVLGPEK
FT                   ILGVTAKTVKRALEAEKSGADYLGTGAIFPTTTKENAPITLISTLKTICQTVAIPIVAI
FT                   GGLTSENIDQLMGTGIAGVAVVRDLMQAEDIEAKTQAFLTKLHDILS"
FT   gene            complement(706245..707036)
FT                   /gene="thiD"
FT                   /locus_tag="SPT_0742"
FT   CDS_pept        complement(706245..707036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SPT_0742"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM PF08543;
FT                   match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24103"
FT                   /protein_id="ACO24103.1"
FT                   /translation="MTYLPVALTIAGTDPSGGAGIMADLKSFQARDVYGMAVVTSLVAQ
FT                   NTRGVQLIEHVSPQMLKAQLESVFSDIPPQAVKTGMLATTEIMEIIQPYLKKLDCPYVL
FT                   DPVMVATSGDALIDSNARDYLKTNLLPLATIITPNLPEAEEIVGFSIHDPEDMQRAGRL
FT                   ILKEFGPQSVVIKGGHLKGGAKDFLFTKNEQFVWESPRIQTCHTHGTGCTFAAVITAEL
FT                   AKGKSLYQAVDKAKAFITKAIQDAPQLGHGSGPVNHTTFKD"
FT   misc_binding    complement(707120..707218)
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); riboswitch00007"
FT   gene            707402..707797
FT                   /locus_tag="SPT_0743"
FT   CDS_pept        707402..707797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0743"
FT                   /product="copper transport repressor, CopY/TcrY family"
FT                   /note="identified by match to protein family HMM PF03965;
FT                   match to protein family HMM TIGR02698"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22377"
FT                   /protein_id="ACO22377.1"
FT                   /translation="MQISDAEWQVMKIIWMQGEQTSTDLIRVLAERFDWSKSTVQTLLA
FT                   RLVEKECLTRKKEGKFFVYSALLTLDQSRDLLVQDIKDKVCSRRIRNLLADLIVECEFT
FT                   QTDLEDLEAVISEKKSSAVTEVRCNCM"
FT   gene            707808..708179
FT                   /locus_tag="SPT_0744"
FT   CDS_pept        707808..708179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0744"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23852"
FT                   /protein_id="ACO23852.1"
FT                   /translation="MLNSIVTIICIALIAFILFWFFKKPEKSGQKAQQKNGYQEIRVEV
FT                   MGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEIMPEQA
FT                   GEFGFACGMNMMHGKMIVE"
FT   gene            708189..710432
FT                   /locus_tag="SPT_0745"
FT   CDS_pept        708189..710432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0745"
FT                   /product="cation-transporting ATPase PacS"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24120"
FT                   /protein_id="ACO24120.1"
FT                   /translation="MTEIVKASLENGIQKIRIRAEKGYHPAHIQLQKGIPAEITFHRAT
FT                   PSNCYKEILFEEEGILEPIGVDEEKVIRFTPQELGRHEFSCGMKMQKGSYTVVEKTRKS
FT                   LSLLQRFWITSIFTVPLVILMIGMLTGSISHQVMHWGTFLATTPIMLVAGKPYIQSAWA
FT                   SFKKHNANMDTLVALGTLVAYFYSLVALFAGLPVYFESAGFILFFVLLGAVFEEKMRKN
FT                   TSQAVEKLLDLQAKTAEVLSDDSYVQVPLEQVKVGDLIRVRPGEKIAVDGVVVEGVSSI
FT                   DESMVTGESLPVDKTVGDTVIGSTINHSGTLVFRAEKVGSETVLAQIVDFVKKAQTSRA
FT                   PIQDLTDKISGIFVPVVVILGIMTFWVWFVLLRDSVVVLGASFVSSLLYGVAVLIIACP
FT                   CALGLATPTALMVGTGRSAKMGVLLKNGTVLQEIQKVQTLVFDKTGTLTEGKPVVTDVI
FT                   GDEVEVFGLAASLEDASQHPLAEAIVKRASEAGLEFQTVENFQTLHGKGVSGRINGKQV
FT                   LLGNAKMLDGMDISNTYQDKLEELEKEAKTVVFLAVDNEIKGLLALQDIPKENAKLVIS
FT                   QLKKRGLRTVMLTGDNAGVARAIADQIGIEEVIAGVLPEEKAHEIHKLQQSGKVAFVGD
FT                   GINDAPALSVADVGIAMGAGTDIAIESADLVLTTNNLLGVVRAFDMSKKTFHRILLNLF
FT                   WAFIYNVVGIPIAAGVFSGVGLALNPELAGLAMAFSSVSVLTSSLLLNFSKID"
FT   gene            710639..712414
FT                   /gene="spxB"
FT                   /locus_tag="SPT_0746"
FT   CDS_pept        710639..712414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spxB"
FT                   /locus_tag="SPT_0746"
FT                   /product="pyruvate oxidase"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR02720"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23530"
FT                   /protein_id="ACO23530.1"
FT                   /translation="MTQGKITASAAMLNVLKTWGVDTIYGIPSGTLSSLMDALAEDKDI
FT                   RFLQVRHEETGALAAVMQAKFGGSIGVAVGSGGPGATHLINGVYDAAMDNTPFLAILGS
FT                   RPVNELNMDAFQELNQNPMYNGIAVYNKRVAYAEQLPKVIDEACRAAVSKKGPAVVEIP
FT                   VNFGFQEIDENSYYGSGSYERSFIAPALNEVEIDKAVEILNNAERPVIYAGFGGVKAGE
FT                   VITELSRKIKAPIITTGKNFEAFEWNYEGLTGSAYRVGWKPANEVVFEADTVLFLGSNF
FT                   PFAEVYEAFKNTEKFIQVDIDPYKLGKRHALDASILGDAGQAAKAILDKVNPVESTPWW
FT                   RANVKNNQNWRDYMNKLEGKTEGELQLYQVYNAINKHADQDAIYSIDVGNTTQTSTRHL
FT                   HMTPKNMWRTSPLFATMGIALPGGIAAKKDNPDRQVWNIMGDGAFNMCYPDVITNVQYD
FT                   LPVINLVFSNAEYGFIKNKYEDTNKHLFGVDFTNADYAKIAEAQGAVGFTVDRIEDIDA
FT                   VVAEAVKLNKEGKTVVIDARITQHRPLPVEVLELDPKLHSEEAIKAFKEKYEAEELVPF
FT                   RLFLEEEGLQSRAIK"
FT   gene            712525..712872
FT                   /locus_tag="SPT_0747"
FT   CDS_pept        712525..712872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0747"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22405"
FT                   /protein_id="ACO22405.1"
FT                   /translation="MNLNQLDIIVSNVPQVCADLEHILDKKADYADDGFAQFTIGSHCL
FT                   MLSQNHLVPLENFQSGIIIHIEVEDVDQNYKRLNELGIKVLHGPTVTDWGTESLLVQGP
FT                   AGLVLDFYRMK"
FT   gene            complement(712989..713642)
FT                   /locus_tag="SPT_0748"
FT   CDS_pept        complement(712989..713642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0748"
FT                   /product="transposase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24163"
FT                   /protein_id="ACO24163.1"
FT                   /translation="MVGEILRHVQNILRKQTLKPLSHLKIKSQFKKTRKRFKTSRPFHK
FT                   VRLMYQDEAGFGRISKLGSCWSPIGVGPHVHSHYIREFRYCYGAVDAHTGESFFLIAGR
FT                   CNTEWMNAFLEELSQAYPYDYFLLVIDNAIWHKSSTLKIPTNIGFAFIPPYTPEMNPID
FT                   QVWKEIRKRGFKNKAFRTLEDVMNQLQDVIQGLEKEVIKSIVNRRWTRMLFESR"
FT   gene            complement(713530..713796)
FT                   /locus_tag="SPT_0749"
FT   CDS_pept        complement(713530..713796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0749"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22751"
FT                   /protein_id="ACO22751.1"
FT                   /translation="MTVEEEKAFLARHLKATEAGEFVTIDALFQAYKKELGRSYTRDAF
FT                   YQLLKRHGWRNITPRPEHPKKADAQTIVASKNKISIQEDKKAL"
FT   gene            complement(713793..714035)
FT                   /locus_tag="SPT_0750"
FT   CDS_pept        complement(713793..714035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0750"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22337"
FT                   /protein_id="ACO22337.1"
FT                   /translation="MKLTKEEIQTIKTLLKDSRTAKYHKRLQIVLFRLMGKSYKEIIEL
FT                   LDCNQTTIWRNVKNMRSSDSTLSFKKHVVVVTMHI"
FT   gene            714100..714396
FT                   /locus_tag="SPT_0751"
FT   CDS_pept        714100..714396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0751"
FT                   /product="6-phospho-beta-glucosidase AscB"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23946"
FT                   /protein_id="ACO23946.1"
FT                   /translation="MDTPDENGYVADDYRITYLEAHIKAMRDAIYQDGVDLLGYTTWGC
FT                   IDPVSAGTGEMNKRYGFIYVDRDNVGNGVLKRSKKKSFYWYKDVIDSNGASIE"
FT   gene            714517..715461
FT                   /gene="manA"
FT                   /locus_tag="SPT_0752"
FT   CDS_pept        714517..715461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="SPT_0752"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="identified by match to protein family HMM PF01238;
FT                   match to protein family HMM TIGR00218"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23483"
FT                   /protein_id="ACO23483.1"
FT                   /translation="MSEPLFLQSVMQEKIWGGTKLRDEFGYDIPSEKVGEYWAISAHLN
FT                   GVSKVANGRYEGTDLATLYAEHRELFGNRPEPVFPLLTKILDANDWLSVQVHPDDAYGL
FT                   EHEGELGKTECWYIIAADEGSEIIYGHNAKSKEELRQQIEDKNWDTLLTKVPVKAGDFF
FT                   YVPSGTMHAIGTGILILETQQSSDTTYRVYDFDRKDDKGNLRELHLEKSIDVLNIGEPA
FT                   NSRPVTVKADDLRSTLLVSNDFFAVYKWEITGKVDFEKTADYSLLSVLAGQGQLTVDGK
FT                   NYPIQKGRHFILPSDVEAWTLEGQGLELIVSHP"
FT   gene            complement(715482..716813)
FT                   /locus_tag="SPT_0753"
FT   CDS_pept        complement(715482..716813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0753"
FT                   /product="sodium-dependent transporter"
FT                   /note="identified by match to protein family HMM PF00209"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22522"
FT                   /protein_id="ACO22522.1"
FT                   /translation="MVFLTDLRKHNRIVKSINQTEGYLTTQVAFSYFEKGDQSLTMSEK
FT                   SQWGSKLGFILASAGSVIGLGSVWKFPYMTAANGGGGFLLIFLISTILIGFPLLLAEFA
FT                   LGRSAGVSAIKTFGKLGKNNKYNFIGWIGAFALFILLSFYSVIGGWILVYLGIEFGKLF
FT                   QLGGTGDYAQLFTSIISNPAIALVAQAAFILLNIFIVSRGVQKGIERASKVMMPLLFII
FT                   FVVIIGRSLSLPNAMEGVLYFLKPDFSKLTSAGLLYALGQSFFALSLGVTVMMPLLFIV
FT                   LPQLFDKMPFGTIFYVLFLFATVTSSVVMLEINVGNITNQDNSKRAKWSVILGILTFVF
FT                   GIPSALSYGVMADVHIFGKIFFDAMDFLASNLLMPFGALYLSLFTGYIFKKALAMEELH
FT                   LDERAWKQGLFQVWLFLLRFFVSSFQSSSLWSSLPNLCNQKGLE"
FT   gene            716896..717650
FT                   /pseudo
FT                   /locus_tag="SPT_0754"
FT                   /note="regulator of the multidrug efflux pump PmrA,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   match to protein family HMM PF07739; match to protein
FT                   family HMM PF09278"
FT   gene            complement(717672..718125)
FT                   /pseudo
FT                   /locus_tag="SPT_0755"
FT                   /note="MutT/nudix family protein, authentic point mutation;
FT                   this gene contains a premature stop which is not the result
FT                   of sequencing error; identified by match to protein family
FT                   HMM PF00293"
FT   gene            complement(718145..719320)
FT                   /locus_tag="SPT_0756"
FT   CDS_pept        complement(718145..719320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0756"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM PF03486; match to protein
FT                   family HMM TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22768"
FT                   /protein_id="ACO22768.1"
FT                   /translation="MKHFDTIVIGGGPAGMMATISSSFYGQKTLLIEKNRKLGKKLAGT
FT                   GGGRCNVTNNGSLDNLLAGIPGNGRFLYSVFSQFDNHDIINFFTENGVKLKVEDHGRVF
FT                   PASDKSRTIIEALEKKITELGGQVATQIEIVSVKKVDDQFVLKSADQTFTCEKLIVTTG
FT                   GKSYPSTGSTGFGHEIARHFKHTITELEAAESPLLTDFPHKALQGISLDDVTLSYGKHV
FT                   ITHDLLFTHFGLSGPAALRMSSFVKGGEVLSLDVLPQLSEKDLVTFLEENREKSLKNAL
FT                   KTLLPERLAEFFVQGYPEKVKQLTEKEREQLVQSIKELKIPVTGKMSLAKSFVTKGGVS
FT                   LKEINPKTLESKLVPGLHFAGEVMDINAHTGGFNITSALCTGWVAGSLHYD"
FT   gene            complement(719379..720224)
FT                   /locus_tag="SPT_0757"
FT   CDS_pept        complement(719379..720224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0757"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23813"
FT                   /protein_id="ACO23813.1"
FT                   /translation="MTWKIIADSGCDYRQLPTPAINTTFVSVPLTIQVADQVFVDDASL
FT                   DIDQMMETMYATAEASKSACPSPDDYLRAFEGAKNIFLVTITGTLSGSHNSAQLAKNIY
FT                   LEDHPDTKIHVIDSLSAGGEVDLLVEKLNDLIDQGLSFEEVVEAITAYQEKTKLLFVLA
FT                   KVDNLVKNGRLSKLIGTVVGLLNIRMVGKASETGTLELLQKARGSKKSVQAAYDELVKA
FT                   GYAGGRIVMAQRNNEKCCQQLSERIRETFPQADIKILPTSGLCSFYAEEGGLLMGYEID
FT                   "
FT   gene            720349..720906
FT                   /locus_tag="SPT_0758"
FT   CDS_pept        720349..720906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0758"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23343"
FT                   /protein_id="ACO23343.1"
FT                   /translation="MSERRISEKSLENLRKSNQESNLLTREAIETALLQLLEKKELTKI
FT                   SISELVKRAGVSRAAFYRNYDSKEEILESVFKRTVHNIMEQLHHYDLKTDLYLVWVHLF
FT                   REARKEARVIQLALDYHLEKIFVQAMQEFLEKYHGKSKGVSSYLHSFWSSAIVSVLLKW
FT                   IKDGMKVPAEKIADLGLPFFKK"
FT   gene            720925..721392
FT                   /locus_tag="SPT_0759"
FT   CDS_pept        720925..721392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0759"
FT                   /product="ComE operon protein 2"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23686"
FT                   /protein_id="ACO23686.1"
FT                   /translation="MTEKRLAWDEYFAAQALLIANRSTCKRAKVGAILVKDNKVISTGY
FT                   NGSVSGTEHCIDHECLVIEGHCVRTLHAEVNAILQGAERGVPKGFTAYVTHFPCLNCTK
FT                   QLLQVGCKRVVYINQYRMDDYAQYLYQEKGTELTHLPLETVQTALKEADLM"
FT   gene            721460..722110
FT                   /gene="upp"
FT                   /locus_tag="SPT_0760"
FT   CDS_pept        721460..722110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="SPT_0760"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01091"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23245"
FT                   /protein_id="ACO23245.1"
FT                   /translation="MKEGIPKMGKIEVINHPLIQHKLSILRRTDTSTKAFRELVDEIAM
FT                   LMGYEVLRDLPLEDVEIETPITKTVQKQLAGKKLAIVPILRAGIGMVDGLLSLVPAAKV
FT                   GHIGMYRDEETLQPVEYLVKLPEDIDQRQIFVVDPMLATGGSAILAVDSLKKRGASNIK
FT                   FVCLVSAPEGVKALQEAHPDVEIFTAALDERLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            722284..722874
FT                   /gene="clpP"
FT                   /locus_tag="SPT_0761"
FT   CDS_pept        722284..722874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SPT_0761"
FT                   /product="Clp protease"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by match to protein family HMM PF00574"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23127"
FT                   /db_xref="GOA:C1CQK8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQK8"
FT                   /protein_id="ACO23127.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNTLEKILAENSGQSME
FT                   KVHADAERDNWMSAQETLEYGFIDEIMANNSLN"
FT   gene            722953..723201
FT                   /locus_tag="SPT_0762"
FT   CDS_pept        722953..723201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0762"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22381"
FT                   /db_xref="GOA:C1CQK9"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQK9"
FT                   /protein_id="ACO22381.1"
FT                   /translation="MFEKVNRSGLIIYLYYNRDAKKLQDYGDITYHSKKHRYLQLYVPT
FT                   QEVEQLVGRLSKEKFIKKVRVCHIQELETPFVGNLYR"
FT   gene            723303..724463
FT                   /locus_tag="SPT_0763"
FT   CDS_pept        723303..724463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0763"
FT                   /product="ABC transporter substrate-binding
FT                   protein-branched chain amino acid transport"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24023"
FT                   /protein_id="ACO24023.1"
FT                   /translation="MKKKFALSFVALASVALLAACGEVKSGAVNTAGNSVEEKTIKIGF
FT                   NFEESGSLAAYGTAEQKGAQLAVDEINAAGGIDGKQIEVVDKDNKSETAEAASVTTNLV
FT                   TQSKVSAVVGPATSGATAAAVANATKAGVPLISPSATQDGLTKGQDYLFIGTFQDSFQG
FT                   KIISNYVSEKLNAKKVVLYTDNASDYAKGIAKSFRESYKGEIVADETFVAGDTDFQAAL
FT                   TKMKGKDFDAIVVPGYYNEAGKIVNQARGMGIDKPIVGGDGFNGEEFVQQATAEKASNI
FT                   YFISGFSTTVEVSAKAKAFLDAYRAKYNEEPSTFAALAYDSVHLVANAAKGAKNSGEIK
FT                   DNLAKTKDFEGVTGQTSFDADHNTVKTAYMMTMNNGKVEAAEVVKP"
FT   gene            724731..725600
FT                   /locus_tag="SPT_0764"
FT   CDS_pept        724731..725600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0764"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system permeaseprotein LivH (LIV-I protein H)"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23456"
FT                   /protein_id="ACO23456.1"
FT                   /translation="MLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAF
FT                   IGYFLINSFQMNFFVALIVAMLATAILGVVIEFLAYRPLRHSTRIAVLITAIGVSFLLE
FT                   YGMVYLVGANTRAFPQAIQTVRYDLGPISLTNVQLMILGISLILMILLQVIVQKTKMGK
FT                   AMRAVSVDSDAAQLMGINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTPGLK
FT                   SFVAAVLGGIGIIPGAALGGFVIGLLETFATAFGMSDFRDAIVYGILLLILIVRPAGIL
FT                   GKNVKEKV"
FT   gene            725604..726560
FT                   /locus_tag="SPT_0765"
FT   CDS_pept        725604..726560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0765"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-branched chain amino acid transport"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23502"
FT                   /protein_id="ACO23502.1"
FT                   /translation="MKENLKVNILWLLLLLAGYSLISVLVSVGVLNLFYVQILQQIGIN
FT                   IILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAIIGSKSPTYGAFFGAMLVGALLSGAV
FT                   ALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAGILGIPNFTTWQMVYFF
FT                   VVITTIATLNFLRSPIGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSLQ
FT                   AGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQDVASVRMII
FT                   YALALVLVMIFRPGGLLGTWELSLSRFFKKSKKEEQN"
FT   gene            726560..727324
FT                   /locus_tag="SPT_0766"
FT   CDS_pept        726560..727324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0766"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   ATP-binding proteinlivG (LIV-I protein G)"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22788"
FT                   /protein_id="ACO22788.1"
FT                   /translation="MALLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTL
FT                   FNLLTGVYEPSEGTVTLDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFG
FT                   NHHKQHVFTSFLRLPAFYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIV
FT                   RALATEPKILFLDEPAAGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERI
FT                   YVLEYGRLIAQGTPDEIKTNKRVIEAYLGGEA"
FT   gene            727324..728034
FT                   /locus_tag="SPT_0767"
FT   CDS_pept        727324..728034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0767"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   ATP-binding proteinlivF (LIV-I protein F)"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22640"
FT                   /protein_id="ACO22640.1"
FT                   /translation="MSMLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTI
FT                   LRTLSGLVRPSSGKIEFLGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAF
FT                   LKKNREENQANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEP
FT                   SMGLAPIFIQEIFDIIQDIQKQGTTVLLIEQNANKALAISNRGYVLETGKIVLSGTGKE
FT                   LASSEEVRKAYLGG"
FT   gene            728448..729104
FT                   /locus_tag="SPT_0768"
FT   CDS_pept        728448..729104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0768"
FT                   /product="AcuB family protein"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23882"
FT                   /protein_id="ACO23882.1"
FT                   /translation="MAVKDFMTRKVVYISPDTTVSHAADLMREQGLHRLPVIENDQLVG
FT                   LVTEGTIAQASPSKATSLSIYEMNYLLNKTKVKDVMIRDVVTVSGYASLEDATYLMLKN
FT                   KIGILPVVDNYQVYGVITDRDVFQAFLEIAGYGEEGIRVRFVTEDEVGVLGKIVSLIVE
FT                   ENLNISHTVNIPRKDGKVIIEVQIDESIDLPALKEKFEANGIQVEEIARTSAKVL"
FT   gene            729318..730307
FT                   /gene="prfB"
FT                   /locus_tag="SPT_0769"
FT   CDS_pept        729318..730307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="SPT_0769"
FT                   /product="peptide chain release factor 2"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM PF03462; match to protein
FT                   family HMM TIGR00020"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23224"
FT                   /protein_id="ACO23224.1"
FT                   /translation="MENKMTEPDFWNDNIAAQKTSQELNELKNTYNTFHKMEELQDEVE
FT                   ILLDFLAEDESVHDELVAQLAELDKIMTSYEMTLLLSEPYDHNNAILEIHPGSGGTEAQ
FT                   DWGDMLLRMYTRYGNAKGFKVEVLDYQAGDEAGIKSVTLSFEGPNAYGLLKSEMGVHRL
FT                   VRISPFDSAKRRHTSFTSVEVMPELDDTIEVEIREDDIKMDTFRSGGAGGQNVNKVSTG
FT                   VRLTHIPTGIVVQSTVDRTQYGNRDRAMKMLQAKLYQMEQDKKAAEVDSLKGEKKEITW
FT                   GSQIRSYVFTPYTMVKDHRTSFEVAQVDKVMDGDLDGFIDAYLKWRIS"
FT   gene            730325..731017
FT                   /gene="ftsE"
FT                   /locus_tag="SPT_0770"
FT   CDS_pept        730325..731017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="SPT_0770"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR02673"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22649"
FT                   /protein_id="ACO22649.1"
FT                   /translation="MSIIEMRDVVKKYDNGTTALRGVSVSVQPGEFAYIVGPSGAGKST
FT                   FIRSLYREVKIDKGSLSVAGFNLVKIKKKDVPLLRRSVGVVFQDYKLLPKKTVYENIAY
FT                   AMEVIGENRRNIKRRVMEVLDLVGLKHKVRSFPNELSGGEQQRIAIARAIVNNPKVLIA
FT                   DEPTGNLDPDNSWEIMNLLERINLQGTTILMATHNSQIVNTLRHRVIAIENGRVVRDES
FT                   KGEYGYDD"
FT   gene            731010..731936
FT                   /locus_tag="SPT_0771"
FT   CDS_pept        731010..731936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0771"
FT                   /product="cell division ABC transporter, permease protein
FT                   FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24136"
FT                   /protein_id="ACO24136.1"
FT                   /translation="MISRFFRHLFEALKSLKRNGWMTVAAVSSVMITLTLVAIFASVIF
FT                   NTAKLATDIENNVRVVVYIRKDVEDNSQTIEKEGQTVTNNDYHKVYDSLKNMSTVKSVT
FT                   FSSKEEQYEKLTEIMGDNWKIFEGDANPLYDAYIVEANTPNDVKTIAEDAKKIEGVSEV
FT                   QDGGANTERLFKLASFIRVWGLGIAALLIFIAVFLISNTIRITIISRSREIQIMRLVGA
FT                   KNSYIRGPFLLEGAFIGLLGAIAPSVLVFIVYQIVYQSVNKSLVGQNLSMISPDLFSPL
FT                   MIALLFVIGVFIGSLGSGISMRRFLRI"
FT   gene            732222..734402
FT                   /locus_tag="SPT_0772"
FT   CDS_pept        732222..734402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0772"
FT                   /product="pts system, iibc component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM PF00367; match to protein
FT                   family HMM PF02378; match to protein family HMM TIGR00826;
FT                   match to protein family HMM TIGR00830; match to protein
FT                   family HMM TIGR02003"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23548"
FT                   /protein_id="ACO23548.1"
FT                   /translation="MMKDTFKNVLSFEFWQKFGKALMVVIAVMPAAGLMISIGKSIVMI
FT                   NPTFTPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRIT
FT                   GTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAY
FT                   NKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQ
FT                   ETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGAAKGTQVFGQDPLW
FT                   LAWVTDLVNLKGTDASQYQHLLDTVHPARFKVGQMIGSFGILMGVIVAIYRNVDADKKH
FT                   KYKGMMIATALATFLTGVTEPIEYMFMFIATPMYLVYSLVQGAAFAMADVVNLRMHSFG
FT                   SIEFLTRTPIAISAGIGMDIVNFVWVTVLFAVIMYFIANFMIQKFNYATPGRNGNYETA
FT                   EGSEETSSEVKVAAGSQAVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKA
FT                   EGAMGLVMKGQGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDL
FT                   TEEVYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAF
FT                   GIVTEAGLEVLVHIGLDTVSLEGKPFTVHVAEGQKVAAGDLLVTADLNAIRAAGRETST
FT                   VVVFTNGDAIKSVKLEKTGSLAAKTAVAKVEL"
FT   gene            734454..735269
FT                   /locus_tag="SPT_0773"
FT   CDS_pept        734454..735269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0773"
FT                   /product="metal-dependent hydrolase"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22398"
FT                   /protein_id="ACO22398.1"
FT                   /translation="MKFLTLNTHSWMEKEAEEKFQILLEDILEKDYDLICFQEINQEMT
FT                   SSEVEVNDLYQALPAAEPIHQDHYVRLLVEKLLEQGKNYYWTWAYNHIGYDRYHEGVAI
FT                   LSKTPIEAREILVSDVDDPTDYHTRRVALAETVVDGKELAVASVHLSWWDKGFQEEWAR
FT                   FEAVLKKLNKPLLLAGDFNNPAGQEGYQAILASPLGLQDAFEVAQEKSGSYTVPPEIDG
FT                   WKGNTEPLRIDYVFTTKELAVENLHVVFDGNKSPQVSDHYGLNAMLNWK"
FT   gene            735409..736752
FT                   /locus_tag="SPT_0774"
FT   CDS_pept        735409..736752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0774"
FT                   /product="superfamily II DNA and RNA helicase"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22961"
FT                   /protein_id="ACO22961.1"
FT                   /translation="MSFTKFQFKNYIREALKELKFTTPTEVQDKLIPIVLAGRDLVGES
FT                   KTGSGKTHTFLLPIFQQLDEASDSVQAVITAPSRELATQIYQVARQISAHSDVEVRVVN
FT                   YVGGTDKARQIEKLASNQPHIVIGTPGRIYDLVKSGDLAIHKAKTFVVDEADMTLDMGF
FT                   LETVDKIAGSLPKDLQFMVFSATIPQKLQPFLKKYLSNPVMEKIKTKTVISDTIDNWLI
FT                   STKGHDKNAQIYQLTQLMQPYLAMIFVNTKTRADELHSYLTAQGLKVAKIHGDIAPRER
FT                   KRIMNQVQNLDFEYIVATDLAARGIDIEGVSHVINDAIPQDLSFFVHRVGRTGRNGLPG
FT                   TAITLYQPSDDSDIRELEKLGIKFSPKIVKDGEFQDTYDRDRRANREKKQDKLDIEMIG
FT                   LVKKKKKKVKPGYKKKIQWAVDEKRRKTKRAENRARGRAERKAKRQTF"
FT   gene            737129..738319
FT                   /gene="metK"
FT                   /locus_tag="SPT_0775"
FT   CDS_pept        737129..738319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="SPT_0775"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23265"
FT                   /db_xref="GOA:C1CQM2"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQM2"
FT                   /protein_id="ACO23265.1"
FT                   /translation="MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAET
FT                   AVYTGSVHVFGEISTNAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDI
FT                   AQGVNEALEVRGNADQDPLDLIGAGDQGLMFGFAVDETEELMPLPIALSHKLVRRLAEL
FT                   RKSGEISYLRPDAKSQVTVEYDENDRPVRVDTVVISTQHDPEATNEQIHQDVIDKVIKE
FT                   VIPSSYLDDKTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDAT
FT                   KVDRSASYAARYIAKNIVAADLAKKAEVQLAYAIGVAQPVSVRIDTFGTGTVAESQLEK
FT                   AARQIFDLRPAGIIQMLDLKRPIYRQTSAYGHMGRTDIDLPWERLDKVDALKEAVK"
FT   gene            complement(738409..738573)
FT                   /locus_tag="SPT_0776"
FT   CDS_pept        complement(738409..738573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0776"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23851"
FT                   /protein_id="ACO23851.1"
FT                   /translation="MIIYYEEKSQPLSFLKKYSKMKQEQEKSIRTVKSISNNVLEVEVY
FT                   YSSFNLLYM"
FT   gene            738872..739807
FT                   /locus_tag="SPT_0777"
FT   CDS_pept        738872..739807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0777"
FT                   /product="dihydroorotate dehydrogenase (dihydroorotate
FT                   oxidase)(dhodehase) (dhodase) (dhod)"
FT                   /EC_number="1.3.98.1"
FT                   /note="identified by match to protein family HMM PF01180;
FT                   match to protein family HMM TIGR01037"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23527"
FT                   /protein_id="ACO23527.1"
FT                   /translation="MVSTKTQIAGFEFDNCLMNAAGVACMTIEELEEVKNSAAGTFVTK
FT                   TATLDFRQGNPEPRYQDVPLGSINSMGLPNNGLDYYLDYLLDLQEKESNRTFFLSLVGM
FT                   SPEETHTILKKVQESDFRGLTELNLSCPNVPGKPQIAYDFETTDRILAEVFAYFTKPLG
FT                   IKLPPYFDIVHFDQAAAIFNKYPLKFVNCVNSIGNGLYIEDESVVIRPKNGFGGIGGEY
FT                   IKPTALANVHAFYQRLNPQIQIIGTGGVLTGRDAFEHILCGASMVQVGTTLHKEGVSAF
FT                   DRITNELKAIMVEKGYESLEDFRGKLRYID"
FT   gene            739841..740878
FT                   /gene="holA"
FT                   /locus_tag="SPT_0778"
FT   CDS_pept        739841..740878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="SPT_0778"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF06144;
FT                   match to protein family HMM TIGR01128"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24066"
FT                   /protein_id="ACO24066.1"
FT                   /translation="MLAIEESQKLTLSNLPSLSLFTGTDQGQFEVMKSQVLKQIGYDSA
FT                   DLNFAYFDMKEVVYKDVELELVSLPFFADEKIVILDYFMDITTAKKRFLTDDELKSFEE
FT                   YLDNPSPTTKLIIFAEGKLDSKRRLVKLLKRDAKVFDAVEVKEQELRQYFQKWSQKQGL
FT                   QFTNHSFENLLIKSGFQFSEIQKNLLFLQSYKANSVIEEEDIVNAIPKTLQDNIFDLTQ
FT                   FILTKKMDQARDLVRDLTLQGEDEIKLIAVMLGQFRTFTQVKILAESGQTESQIASSLG
FT                   SYLGRNPNPYQIKFALRDSRGLSLSFLKQAISYLIETDYQIKTGLYEKGFLFEKALLQI
FT                   ASQVN"
FT   gene            741051..741656
FT                   /locus_tag="SPT_0779"
FT   CDS_pept        741051..741656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0779"
FT                   /product="superoxide dismutase [Mn] (General stress protein
FT                   24)(GSP24)"
FT                   /EC_number="1.15.1.1"
FT                   /note="identified by match to protein family HMM PF00081;
FT                   match to protein family HMM PF02777"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22391"
FT                   /protein_id="ACO22391.1"
FT                   /translation="MAIILPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEK
FT                   HPEIGEDLEALLADVESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAID
FT                   ATFGSFEEFQAAFTAAATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLD
FT                   VWEHAYYVKYRNVRPDYIKAFFSVINWNKVDELYAAAK"
FT   gene            741813..742343
FT                   /locus_tag="SPT_0780"
FT   CDS_pept        741813..742343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0780"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF06265"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22880"
FT                   /protein_id="ACO22880.1"
FT                   /translation="MRKEIAPELYNYNKFPGPEFHLHGDKVETEGIAFSLVENIKDAFD
FT                   VTTFNQRFSEVLTKFDYIVGDWSNEQLRLRGFYKDDRTEEKLEKISRLQDYLLEYCSYG
FT                   CAYFVLENEAPKRASFDKKMRKTEEETPSRKGKKPTQTKRKSNADKKNRRRQKDQHSQK
FT                   EDKGQRHFVIRQK"
FT   gene            742364..743266
FT                   /locus_tag="SPT_0781"
FT   CDS_pept        742364..743266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0781"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="identified by match to protein family HMM TIGR00048"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23782"
FT                   /protein_id="ACO23782.1"
FT                   /translation="MKPSIHSLAHQTMQKWVLEQGEKKFRADQIWEWLYRKRVQSFEEM
FT                   TNLSKDLIAKLNDQFVVNPLKQRIVQESADGTVKYLFELPDGMLIETVLMRQHYGLSVC
FT                   VTTQVGCNIGCTFCASGLIKKQRDLNNGEIVAQIMLVQKYFADEGVQVNLAVSLHAPNN
FT                   ELRSSIMKINRAFPIEKLFAAIEYYIETTNRRVTFEYIMLNEVNDGVEQALELAELLKN
FT                   IKKLSYVNLIPYNPVSEHDQYSRSPKERVLAFYDTLKKKGGNCVVRQEHGTDIDAACGQ
FT                   LRFNTMKRDRQKAVAAVNP"
FT   gene            743266..743748
FT                   /locus_tag="SPT_0782"
FT   CDS_pept        743266..743748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0782"
FT                   /product="VanZ family protein"
FT                   /note="identified by match to protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22387"
FT                   /protein_id="ACO22387.1"
FT                   /translation="MMKKTYNHILVWGVIFYSICIVCFCFTPQEQSTVGVGTPGIQHLG
FT                   RLVFLLTPFNSLWKLGEVSDIGQLCWIFLQNILNVFLFFPLIFQLLYLFPNLRKTKKVL
FT                   LFSFLVSLGIECTQLILDFFFDFNRVFEIDDLWTNTLGGYLAWLLYKRLHKNKVRN"
FT   gene            743750..745291
FT                   /locus_tag="SPT_0783"
FT   CDS_pept        743750..745291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0783"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23636"
FT                   /protein_id="ACO23636.1"
FT                   /translation="MSILEVKNLSHGFGDRAIFEDVSFRLLKGEHIGLVGANGEGKSTF
FT                   MSIVTGKMLPDEGKVEWSKYVTAGYLDQHSVLAERQSVRDVLRTAFDELFKAEARINDL
FT                   YMKMAEDGADVDALMEEVGELQDRLESRDFYTLDAKIDEVARALGVMDFGMDTDVTSLS
FT                   GGQRTKVLLAKLLLEKPDILLLDEPTNYLDAEHIDWLKRYLQNYENAFVLISHDIPFLN
FT                   DVINIVYHVENQQLTRYSGDYYQFQEVYAMKKSQLEAAYERQQKEIADLKDFVARNKAR
FT                   VATRNMAMSRQKKLDKMDIIELQSEKPKPSFDFKPARTPGRFIFQAKNLQIGYDRPLTK
FT                   PLNLTFERNQKVAIIGANGIGKTTLLKSLLGIISPIAGEVERGDYLELGYFEQEVEGGN
FT                   RQTPLEAVWNAFPALNQAEVRAALARCGLTTKHIESQIQVLSGGEQAKVRFCLLMNREN
FT                   NVLVLDEPTNHLDVDAKDELKRALKEYRGSILMVCHEPDFYEGWIDQIWDFNNLT"
FT   gene            complement(745347..746150)
FT                   /locus_tag="SPT_0784"
FT   CDS_pept        complement(745347..746150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0784"
FT                   /product="peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin-type"
FT                   /note="identified by match to protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22438"
FT                   /protein_id="ACO22438.1"
FT                   /translation="MKKLATLLLLSTVALAGCSSVQRSLRGDDYVDSSLAAEESSKVAA
FT                   QSAKELNDALTNENANFPQLSKEVAEDEAEVILHTSQGDIRIKLFPKLAPLAVENFLTH
FT                   AKEGYYNGITFHRVIDGFMVQTGDPKGDGTGGQSIWHDKDKTKDKGTGFKNEITPYLYN
FT                   IRGALAMANTGQPNTNGSQFFINQSSTDTSSKLPTSKYPQKIIEAYKEGGNPSLDGKHP
FT                   VFGQVIDGMDVVDKIAKAEKDEKDKPTTAITIDSIEVVKDYDFKS"
FT   gene            complement(746234..746446)
FT                   /locus_tag="SPT_0785"
FT   CDS_pept        complement(746234..746446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0785"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22728"
FT                   /protein_id="ACO22728.1"
FT                   /translation="MSFYGLFYNGIAITPNTYLSAWFVNFIAALPLNFLIVEPIARFIL
FT                   SSFQKPFTGEEVEDFQDDDEIPTII"
FT   gene            complement(746925..747125)
FT                   /locus_tag="SPT_0786"
FT   CDS_pept        complement(746925..747125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0786"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23193"
FT                   /protein_id="ACO23193.1"
FT                   /translation="MNTILEKFYKKHQVKPFISPERELDTWLLSPKPVPKRNMDLLVDD
FT                   SLAGDIILLWRIQFGTFTTET"
FT   gene            747304..747576
FT                   /gene="rpsP"
FT                   /locus_tag="SPT_0787"
FT   CDS_pept        747304..747576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="SPT_0787"
FT                   /product="ribosomal protein S16"
FT                   /note="identified by match to protein family HMM PF00886;
FT                   match to protein family HMM TIGR00002"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23342"
FT                   /db_xref="GOA:C1CQN4"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQN4"
FT                   /protein_id="ACO23342.1"
FT                   /translation="MAVKIRLTRMGSKKKPFYRINVADSRSPRDGRFIETVGTYNPLVA
FT                   ENQVTLKEDRVLAWLANGAQPSDTVRNILSKEGVLKKFHDSKFSK"
FT   gene            747596..747835
FT                   /locus_tag="SPT_0788"
FT   CDS_pept        747596..747835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0788"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23794"
FT                   /protein_id="ACO23794.1"
FT                   /translation="MDTIENLIIAIVKPLISQPDALTIKIEDTPEFLEYHLNLDQSDVG
FT                   RVIGRKGRTISAIRTIVYSVPTEYKKVRIVIDEK"
FT   gene            complement(748227..749573)
FT                   /locus_tag="SPT_0789"
FT   CDS_pept        complement(748227..749573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0789"
FT                   /product="Spn1 transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23373"
FT                   /protein_id="ACO23373.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKER
FT                   ISKYLATNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGF
FT                   FGDKTDSSTLIKNEVRMIMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVR
FT                   TGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPGRKASLMMH"
FT   gene            749858..750208
FT                   /locus_tag="SPT_0792"
FT   CDS_pept        749858..750208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0792"
FT                   /product="transposase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22905"
FT                   /protein_id="ACO22905.1"
FT                   /translation="MKSTKEEIQTIKTLLKDSRTAKYHKRLQIVLFRLMGKSYKEIIEL
FT                   LDCNQTTIWRNVKKYEEFGLDSLLQETRGGRNHAYMTVEEEKAFLARHLKATEAGEFVT
FT                   IPYFRLISFLHT"
FT   gene            complement(750952..752034)
FT                   /pseudo
FT                   /locus_tag="SPT_0794"
FT                   /note="DEAD RNA helicase, authentic point mutation; this
FT                   gene contains a premature stop which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00270; match to protein family HMM PF00271"
FT   gene            complement(752031..753008)
FT                   /locus_tag="SPT_0795"
FT   CDS_pept        complement(752031..753008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0795"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF01408"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23296"
FT                   /protein_id="ACO23296.1"
FT                   /translation="MLKLGVIGTGAISHHFIEAAHTSGEYQLVAIYSRKLETAATFASR
FT                   YQNIQLFDQLEVFFKSSFDLVYIASPNSLHFAQAKAALSAGKHVILEKPAVTQPQEWFD
FT                   LIQTAEKNNCFIFEAARNYHEKAFTTIKNFLADKQVLGADFNYAKYSSKMPDLLAGQTP
FT                   NVFSDRFAGGALMDLGIYPLYAAVRLFEKANDATYHAQQLDNSIDLNGDGILFYPDYQV
FT                   HIKAGKNITSNLPCEIYTTDGTLTLNTIEHIRSAIFTDHQGNQVQLPIQQAPHTMTEEV
FT                   AAFAHMIQQPDLNLYQTWLYDAGSVHELLYTMRQTAGIRFEAEK"
FT   gene            753223..753600
FT                   /locus_tag="SPT_0796"
FT   CDS_pept        753223..753600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0796"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23254"
FT                   /protein_id="ACO23254.1"
FT                   /translation="MICQFIRDMLDLPAKNVTILEGSNIHVLPSMPYSAQDFYTSIDVL
FT                   AELDNGIQVIIEIQVHHQNFFINRLWAYLCSQVNQNLEKIRQREGDTHQSYKQIAPVYA
FT                   IAIVDSNYFSDDLAFHSFIVK"
FT   gene            753784..755226
FT                   /locus_tag="SPT_0797"
FT   CDS_pept        753784..755226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0797"
FT                   /product="peptidoglycan GlcNAc deacetylase"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22645"
FT                   /protein_id="ACO22645.1"
FT                   /translation="MPNCIIEIIAQICYDINMNKSRLGRGRHGKTRHVLLALIGILAIS
FT                   ICLLGGFIAFKIYQQKSFEQKIESLKKEKDDQLSEGNQKEHFRQGQAEVIAYYPLQGEK
FT                   VISSVRELINQDVKDKLESKDNLVFYYTEQEESGLKGVVNRNVTKQIYDLVAFKVEETE
FT                   KTSLGKVHLTEDGQPFTLDQLFSDASKAKEQLIKELTSFIEDKKIEQDQSEQIVKNFSD
FT                   QDLSAWNFDYKDSQIILYPSPVVENLEEIALPVSAFFDVIQSSYLLEKDAALYQSYFDK
FT                   KYQKVVALTFDDGPNPATTPQVLETLAKYDIKATFFVLGKNVSGNEDLVKRIKSEGHVV
FT                   GNHSWSHPILSQLSLDEAKKQITDTEDVLTKVLGSSSKLMRPPYGAITDDIRNSLDLSF
FT                   IMWDVDSLDWKSKNEASILTEIQHQVANGSIVLMHDIHSPTVNALPRVIEYLKNQGYTF
FT                   VTIPEMLNTRLKAHELYYSRDE"
FT   gene            755340..756182
FT                   /locus_tag="SPT_0798"
FT   CDS_pept        755340..756182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0798"
FT                   /product="2,5-diketo-d-gluconic acid reductase a
FT                   (2,5-dkgreductase a) (2,5-dkgr a) (25dkgr-a) (akr5c)"
FT                   /EC_number="1.1.1.274"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24137"
FT                   /protein_id="ACO24137.1"
FT                   /translation="MNTYQLNNGVEIPVLGFGTFKAKDGEEAYRAVLEALKAGYRHIDT
FT                   AAIYQNEKSVGQAIKDSGVPREEMFVTTKLWNSQQTYEQTRQALEKSIEKLGLDYLDLY
FT                   LIHWPNPKPLRENDAWKTRNAEVWRAMEDLYQEGKIRAIGVSNFLPHHLDALLETATIV
FT                   PAVNQVRLAPGVYQDQVVAYCREKGILLEAWGPFGQGELFDSKQVQEIAANHGKSIAQI
FT                   ALAWSLAEGFLPLPKSVTTSRIQANLDCFGIELSHEERENLKTIAVQSGAPRVDDVDF"
FT   gene            756455..757216
FT                   /locus_tag="SPT_0799"
FT   CDS_pept        756455..757216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0799"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22964"
FT                   /protein_id="ACO22964.1"
FT                   /translation="MDNLYLVKDDSQLATFRDFVVRNTEKLKDYQSFLKNELAVCDLPQ
FT                   AVIWSDFNAATQIIRESAVPAYTNNRRMVMAPDLAVWKELYLYQLMDYECSQQTQAIES
FT                   HYHSLSENFLLQIVGHELAHWSEHFLDDFDGYDSYIWFEEGMVEYISRKYFLTEEEFQA
FT                   EKICNQSLVELFQKKYGWHSLNDFGSSTYDKNYASIFYEYWRSFLTVDKLVENLGSVQA
FT                   VLDSYHLWANTEKTFPLLDWFVQQKLIEKEI"
FT   gene            757409..758326
FT                   /locus_tag="SPT_0800"
FT   CDS_pept        757409..758326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0800"
FT                   /product="glycyl-tRNA synthetase alpha chain (Glycine--tRNA
FT                   ligasealpha chain) (GlyRS)"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22411"
FT                   /db_xref="GOA:C1CQP3"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQP3"
FT                   /protein_id="ACO22411.1"
FT                   /translation="MSKKLTFQEIILTLQQFWNDQGCMLMQAYDNEKGAGTMSPYTFLR
FT                   AIGPEPWNAAYVEPSRRPADGRYGENPNRLYQHHQFQVVMKPSPSNIQELYLESLEKLG
FT                   INPLEHDIRFVEDNWENPSTGSAGLGWEVWLDGMEITQFTYFQQVGGLATGPVTAEVTY
FT                   GLERLASYIQEVDSVYDIEWADGVKYGEIFIQPEYEHSKYSFEISDQEMLLENFDKFEK
FT                   EAGRALEEGLVHPAYDYVLKCSHTFNLLDARGAVSVTERAGYIARIRNLARVVAKTFVA
FT                   ERKRLGYPLLDEETRVKLLAEDAE"
FT   gene            758586..760622
FT                   /locus_tag="SPT_0801"
FT   CDS_pept        758586..760622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0801"
FT                   /product="glycyl-tRNA synthetase beta chain (Glycine--tRNA
FT                   ligasebeta chain) (GlyRS)"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23899"
FT                   /db_xref="GOA:C1CQP4"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQP4"
FT                   /protein_id="ACO23899.1"
FT                   /translation="MTKNLLVELGLEELPAYVVTPSEKQLGEKMAAFLKENRLSFEAIQ
FT                   TFSTPRRLAVRVTGLSDKQSDLTEDFKGPAKKIALDSDGNFTKAAQGFVRGKGLTVEDI
FT                   EFREIKGEEYVYVTKEEVGQSVEAIVPGVVDVLKSLTFPVSMHWAGNSFEYIRPVHTLT
FT                   VLLDEQEFDLDFLDIKGSRVSRGHRFLGKETKIQSALSYEEDLRKQFVIADPCEREQMI
FT                   VDQIKEIEAKHGVHIEIDADLLNEVLNLVEYPTAFMGSFDAKYLEVPEEVLVTSMKEHQ
FT                   RYFVVRDQDGKLLPNFISVRNGNAERLKNVIKGNEKVLVARLEDGEFFWREDQKLVISD
FT                   LVEKLNNVTFHEKIGSLREHMIRTGQITVLLAEKAGLSVDETVDLARAAAIYKFDLLTG
FT                   MVGEFDELQGIMGEKYTLLAGETPAVAAAIREHYMPTSAEGELPESKVGAVLAIADKLD
FT                   TILSFFSVGLIPSGSNDPYALRRATQGVVRILDAFGWHIAMDELIDSLYALKFDSLTYE
FT                   NKAEVMDFIKARVDKMMGSTPKDIKEAVLAGSNFVVADMLEAASALVEVSKEEDFKPSV
FT                   ESLSRAFNLAEKAEGVATVDSALFENDQEKALAEAVETLVLSGPASQQLKQLFALSPVI
FT                   DAFFENTMVMAEDQAVRQNRLAILSQLTKKAAKFACFNQINTK"
FT   gene            760664..760921
FT                   /locus_tag="SPT_0802"
FT   CDS_pept        760664..760921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0802"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05979"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23700"
FT                   /db_xref="GOA:C1CQP5"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQP5"
FT                   /protein_id="ACO23700.1"
FT                   /translation="MDPKKIARINELAKKKKTEGLTPEEKVEQAKLREEYIEGYRRAVR
FT                   HHIEGIKIVDEEGNDVTPEKLRQVQREKGLHGRSLDDPNS"
FT   gene            complement(761038..762282)
FT                   /locus_tag="SPT_0803"
FT   CDS_pept        complement(761038..762282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0803"
FT                   /product="NADPH-dependent fmn reductase domain protein"
FT                   /note="identified by match to protein family HMM PF03358"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23396"
FT                   /protein_id="ACO23396.1"
FT                   /translation="MKFVGLVGSNYDQSYNRKLLEFIRRYFKLKFELEVLEIDEVPMFN
FT                   QDEKWDESFQLRYLYNKITRADGVIIATPEHNHTISASLKSVLEWLSYEVHPFENKPVM
FT                   IVGASYYDQGTSRAQVHLRKILDAPGVNAYTLPGNEFLLGKAKEAFDNNGNITNEGTVK
FT                   FLETCLDNFVKYVGVVSKLKKPKPIESEDLDCGKPIATTITEVDPDDPEWVEKVAAITG
FT                   AVSGDTYVKLDHGILTVNQIDMFLKAMPFELTYADDNNQFLYYNNAHQDPDTMFAKRVP
FT                   PQSGSRMSTVHGSLPPARMKNVEWVIGTLRNGNQEYVRTIVPGSPAGVINTHNYQAMYY
FT                   PDGSYAGINEIVFNFQPWLDWYLKETGQRLVGGSGPFAPAAGSHGDADATSGASDSGDA
FT                   GGHGGDADATAGASY"
FT   gene            complement(762301..762906)
FT                   /locus_tag="SPT_0804"
FT   CDS_pept        complement(762301..762906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0804"
FT                   /product="NADPH-dependent fmn reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23063"
FT                   /protein_id="ACO23063.1"
FT                   /translation="MLKLIAIVGTNSKRSTNRQLLQYMQKHFADKAEIELVEIKAIPVF
FT                   NKPADKQVPAEILEIAAKIEETDGVIIGTPEYDHSIPAVLMSALAWLSYGIYPLLNKPI
FT                   MITGASYGTLGSSRAQLQLRQILNAPEIKANVLPDEFLLSHSLQAFNPSGDLVDLDVIK
FT                   KLDAIFDDFRIFVKITEKLRNAQELLRKDAEDFDWENL"
FT   gene            complement(762966..763889)
FT                   /locus_tag="SPT_0805"
FT   CDS_pept        complement(762966..763889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0805"
FT                   /product="thiamine biosynthesis lipoprotein"
FT                   /note="identified by match to protein family HMM PF02424"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22705"
FT                   /protein_id="ACO22705.1"
FT                   /translation="MTLRSHSERLMGTTITISLVDEQADIFLQKSFDLLKELEYRFNAN
FT                   SQESELMEINYQAGIAPVTVHPDLFELISLGLEHSLALSSHLNISIGPLIQTWRIGFSD
FT                   AKVAQPQEIESVLPLINPHGIELDSSTSTVFLKQKGMKIDLGCLAKGYSADKVAQFLRK
FT                   EGVTSALINLGGNILTIGKNQARGDNPWQIGIQDPANPRGNHLMTIPVVNKSVVTSGIY
FT                   ERHLTVDGQDYHHIFDSQTGYPVETELASLTIISDKSVDGEIWTTRLFGERPASILWQV
FT                   ESLEGIEVILIDKEGHLSCSSGIPTL"
FT   gene            764183..765562
FT                   /locus_tag="SPT_0806"
FT   CDS_pept        764183..765562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0806"
FT                   /product="NADH oxidase (noxase)"
FT                   /EC_number="1.6.99.3"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24167"
FT                   /protein_id="ACO24167.1"
FT                   /translation="MSKIVVVGANHAGTACINTMLDNFGNENEIVVFDQNSNISFLGCG
FT                   MALWIGEQIDGAEGLFYSDKEKLEAKGAKVYMNSPVLSIDYDNKVVTAEVEGKEHKESY
FT                   EKLIFATGSTPILPPIEGVEIVKGNREFKATLENVQFVKLYQNAEEVINKLSDKSQHLD
FT                   RIAVVGGGYIGVELAEAFERLGKEVVLVDIVDTVLNGYYDKDFTQMMAKNLEDHNIRLA
FT                   LGQTVKAIEGDGKVERLITDKESFDVDMVILAVGFRPNTALADGKIELFRNGAFLVDKK
FT                   QETSIPDVYAVGDCATVYDNARKDTSYIALASNAVRTGIVGAYNACGHELEGIGVQGSN
FT                   GISIYGLHMVSTGLTLEKAKAAGYNATETGFNDLQKPEFMKHDNHEVAIKIVFDKDSRE
FT                   ILGAQMVSHDIAISMGIHMFSLAIQEHVTIDKLALTDLFFLPHFNKPYNYITMAALTAE
FT                   K"
FT   gene            765714..766589
FT                   /locus_tag="SPT_0807"
FT   CDS_pept        765714..766589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0807"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF01680;
FT                   match to protein family HMM TIGR00343"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23901"
FT                   /db_xref="GOA:C1CQQ0"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQQ0"
FT                   /protein_id="ACO23901.1"
FT                   /translation="MTENRYELNKNLAQMLKGGVIMDVQNPEQARIAEAAGAAAVMALE
FT                   RIPADIRAAGGVSRMSDPKMIKEIQEAVSIPVMAKVRIGHFVEAQILEAIEIDYIDESE
FT                   VLSPADDRFHVDKKEFQVPFVCGAKDLGEALRRIAEGASMIRTKGEPGTGDIVQAVRHM
FT                   RMMNQEIRRIQNLREDELYVAAKDLQVPVELVQYVHEHGKLPVVNFAAGGVATPADAAL
FT                   MMQLGAEGVFVGSGIFKSGDPVKRASAIVKAVTNFRNPQILAQISEDLGEAMVGINENE
FT                   IQILMAERGK"
FT   gene            766590..767171
FT                   /locus_tag="SPT_0808"
FT   CDS_pept        766590..767171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0808"
FT                   /product="SNO glutamine amidotransferase family
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF01174;
FT                   match to protein family HMM PF07685"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23310"
FT                   /db_xref="GOA:C1CQQ1"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQQ1"
FT                   /protein_id="ACO23310.1"
FT                   /translation="MKIGILALQGAFAEHAKVLDQLGVESVELRNLDDFQQDQSDLSGL
FT                   ILPGGESTTMGKLLRDQNMLLPIREAILSGLPVFGTCAGLILLAKEITSQKESHLGTMD
FT                   MVVERNAYGRQLGSFYTEAECKGVGKIPMTFIRGPIISSVGEGVEILATVNNQIVAAQE
FT                   KNMLVSSFHPELTDDVRLHQYFINMCKEKS"
FT   gene            complement(767192..767839)
FT                   /locus_tag="SPT_0809"
FT   CDS_pept        complement(767192..767839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0809"
FT                   /product="hemolysin-3 (Hemolysin III) (Hly-III)"
FT                   /note="identified by match to protein family HMM PF03006;
FT                   match to protein family HMM TIGR01065"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22952"
FT                   /protein_id="ACO22952.1"
FT                   /translation="MNTSLKLSKQLSFGEEIANSVTHAVGAVIMLILLPISSIYSYEAH
FT                   GFLSSIGVSIFVISLFLMFLSSTIYHSMAYGSTHKYVLRIIDHSMIYVAIAGSYTPVVL
FT                   TLMNNWFGYLIIVIQWGTTIFGILYKIFAKKVNEKFSLALYLIMGWLVLAIIPAIINQT
FT                   TPVFWSLMVTGGLCYTVGAGFYAKKKPYFHMIWHLFILAASVLQYIAIVYYM"
FT   gene            complement(767836..768282)
FT                   /locus_tag="SPT_0810"
FT   CDS_pept        complement(767836..768282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0810"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08876"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22350"
FT                   /protein_id="ACO22350.1"
FT                   /translation="MKTTFSYPKWAEIPNIDLYLDQVLLYVNQVCAPISPNKDKGLTAS
FT                   MVNNYVKNGYLTKPDKKKYQRQQIARLIAITTLKSVFSIQEIAQTLNTLQTQASSDQLY
FT                   DAFVDYMNQGIDPANPIIQTSCQTVKLYHQTLDLIDHTQEEVIQ"
FT   gene            768417..768911
FT                   /locus_tag="SPT_0811"
FT   CDS_pept        768417..768911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0811"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24172"
FT                   /protein_id="ACO24172.1"
FT                   /translation="MEIRLAFPNEVDAIMQVMEDAKKCLADAGSDQWQNGYPNADVIID
FT                   DIISGQAYVALEEGELLAYAAVTKSPEEAYEAIYEGNWQAGESEYLVFHRIAVAADVQG
FT                   KGVAQTFLEGLIEGFDYLDFRSDTHAENKVMQHIFEKLGFKQVGKVPVDGERLAYQKLK
FT                   K"
FT   gene            768911..769441
FT                   /locus_tag="SPT_0812"
FT   CDS_pept        768911..769441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0812"
FT                   /product="O6-methylguanine-DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23756"
FT                   /protein_id="ACO23756.1"
FT                   /translation="MQKKYVKILYSSPIGILSLVADDHYLYGIWVQEQKHFERGLGDET
FT                   IEEVVSHPILDPVIACLDDYFKGKPQDLSNLLLAPIGTNFEKRVWDYLQGIPYGQTVTY
FT                   GQIAQDLQVASAQAIGGAVGRNPWSILVPCHRVLGAGKRLTGYAAGVEKKAWLLEHEGV
FT                   DFKDRNNRRRSTC"
FT   gene            769435..769791
FT                   /locus_tag="SPT_0813"
FT   CDS_pept        769435..769791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0813"
FT                   /product="arsenate reductase"
FT                   /note="identified by match to protein family HMM PF03960;
FT                   match to protein family HMM TIGR01617"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23175"
FT                   /protein_id="ACO23175.1"
FT                   /translation="MLEFIEYPKCSTCKKAKQELNQLGVDYKAVHIVEETPSQEVILNW
FT                   LETSGFELKQFFNTSGIKYRELGLKDKVGSLSNQEAAELLASDGMLLKRPILVENGTVK
FT                   QIGYRKSYEELGLK"
FT   gene            769949..770749
FT                   /locus_tag="SPT_0814"
FT   CDS_pept        769949..770749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0814"
FT                   /product="ABC transporter membrane-spanning
FT                   permease-aspartate/glutamate transport"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23557"
FT                   /protein_id="ACO23557.1"
FT                   /translation="MNVTTILASDWYQNLMQLIPDGKLFSLRSVFDGIPRIVQQLPTTI
FT                   MLTIGGALFGLVLALLFAIVKINRVKILYPLQAFFVSFLKGTPILVQLMLTYYGIPLAL
FT                   KALNQQWGTGLNINAIPAAAFAIVAFAFNEAAYASETIRAAILSVNPGEIEAARSLGMT
FT                   RAQVYRRVIIPNAAVVATPTLINSLIGLTKGTSLAFSAGVVEVFAQAQILGGADYRYFE
FT                   RFISVALVYWVVNIGIESLGRFIERKMAISAPDTVQTDVKGDLR"
FT   gene            770749..771492
FT                   /locus_tag="SPT_0815"
FT   CDS_pept        770749..771492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0815"
FT                   /product="L-cystine import ATP-binding protein TcyN"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23277"
FT                   /protein_id="ACO23277.1"
FT                   /translation="MIKISNLSKSFSGQTVLDHLNLDIQKGEVVALIGSSGAGKSTFLR
FT                   SLNYLETPDSGSIQIDGFSVDFSKITQEEILALRRKLSMVFQQFNLFERRTALDNVKEG
FT                   LVVVKKLSDQEATKIAKEELAKVGLSDRENHYPRHLSGGQKQRVALARALAMKPDVLLL
FT                   DEPTSALDPELVGEVEKSIADAAKSGQTMILVSHDMSFVAQVADKILFLDKGKIIESGT
FT                   PDEIIHTPKEERTKEFFASYKRTYI"
FT   gene            771570..771794
FT                   /locus_tag="SPT_0816"
FT   CDS_pept        771570..771794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0816"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22641"
FT                   /protein_id="ACO22641.1"
FT                   /translation="MLLQLFSLYFESLILTTILVLIFLGIWIGLRAMSGVDKTARARQA
FT                   HLYDMIMIGVLVVPVLSFAVMSLILVFKA"
FT   gene            771860..772771
FT                   /gene="trxB"
FT                   /locus_tag="SPT_0817"
FT   CDS_pept        771860..772771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="SPT_0817"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF03486; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR01292"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22407"
FT                   /protein_id="ACO22407.1"
FT                   /translation="MYDTIIIGAGPAGMTAALYAARSNLKVALIEGGLPGGQMNNTSDI
FT                   ENYPGYANISGPELAEKMFEPLENLGVEHIYGYVENVEDHGDFKKVMTDDQTYETRTVI
FT                   VATGSKHRPLGVPGEEELNSRGVSYCAVCDGAFFRDQDLLVVGGGDSAVEEALFLTRFA
FT                   KTVTIVHRRDQLRAQKVLQDRAFANEKISFIWDSVVREIKGENRVESVVFENVKTGQVT
FT                   EQVFGGVFIYVGLDPLSDFVKELNIQDQAGWIVTDNHMKTAVDGIFAVGDVRLKDLRQV
FT                   TTAVGDGAIAGQEAYKFITEHS"
FT   gene            complement(772809..773537)
FT                   /locus_tag="SPT_0818"
FT   CDS_pept        complement(772809..773537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0818"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22900"
FT                   /protein_id="ACO22900.1"
FT                   /translation="MKTNDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATE
FT                   KKVSISWTSKKSLSEITEGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLT
FT                   DPHNLGSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDK
FT                   LKDEGFWTFGTDMNGTPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQ
FT                   SLNASVAAAILMYEVFRNRL"
FT   gene            complement(773582..774193)
FT                   /gene="def1"
FT                   /locus_tag="SPT_0819"
FT   CDS_pept        complement(773582..774193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /locus_tag="SPT_0819"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23646"
FT                   /db_xref="GOA:C1CQR2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQR2"
FT                   /protein_id="ACO23646.1"
FT                   /translation="MSAIERITKAAHLIDMNDIIREGNPTLRAIAEEVTFPLSDQEIIL
FT                   GEKMMQFLKHSQDPVMAEKMGLRGGVGLAAPQLDISKRIIAVLVPNIVEEGETPQEAYD
FT                   LEAIMYNPKIVSHSVQDAALGEGEGCLSVDRNVPGYVVRHARVTVDYFDKDGEKHRIKL
FT                   KGYNSIVVQHEIDHINGIMFYDRINEKDPFAVKDGLLILE"
FT   gene            complement(774517..774630)
FT                   /locus_tag="SPT_0820"
FT   CDS_pept        complement(774517..774630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0820"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24076"
FT                   /protein_id="ACO24076.1"
FT                   /translation="MTSQGIPWKLSNNKIKPIDKPTASKSIATNPLLLHLR"
FT   gene            774706..775758
FT                   /pseudo
FT                   /locus_tag="SPT_0822"
FT                   /note="enzyme of poly-gamma-glutamate biosynthesis,
FT                   authentic point mutation; this gene contains a premature
FT                   stop which is not the result of sequencing error"
FT   gene            775780..776607
FT                   /locus_tag="SPT_0823"
FT   CDS_pept        775780..776607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0823"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0823"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23372"
FT                   /protein_id="ACO23372.1"
FT                   /translation="MMIKVIATDMDGTLLDARGQLDLPRLEKILDQLDQRGIRFVIATG
FT                   NEIHRMRQLLSPLVDRVVLVVANGARIFENNELIQAQTWDDAIVNKALAHFKGRACQDQ
FT                   FVVTGMKGDFVKEGTIFTDLESFMTPEMIEKFYQRMQFVDELTSDLFGGVLKMSMVVGE
FT                   ERLSSVLEEINALFDGRVRAVSSGYGCIDILQAGIHKAWGLEELLKRWDLKSQEIMAFG
FT                   DSENDVEMLEMAGIAYAMENADEKAKAVATALAPANSQGGVYQVLENWLEKGE"
FT   gene            776609..777244
FT                   /locus_tag="SPT_0824"
FT   CDS_pept        776609..777244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0824"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0824"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23690"
FT                   /protein_id="ACO23690.1"
FT                   /translation="MAVQLLENWLLKEQEKIQTKYRHLNHISVVEPNILFIGDSIVEYY
FT                   PLQELFGTSKMIVNRGIRGYQTGLLLENLDAHLYGGAVDKIFLLIGTNDIGKDVPVNET
FT                   LNNLEAIIQSVARDYPLTEIKLLSILPVNEGEEYQQAVYIRSNEKIQNWNQAYQELASA
FT                   YMQVEFVPVFDCLTDQAGQLKKEYTTDGLHLSIAGYQALSKALKDYLY"
FT   gene            777328..778053
FT                   /locus_tag="SPT_0825"
FT   CDS_pept        777328..778053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0825"
FT                   /product="CppA protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0825"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22415"
FT                   /protein_id="ACO22415.1"
FT                   /translation="MNVNQIVRIIPTLKANNRKLNETFYIETLGMKALLEESAFLSLGD
FT                   QTGLEKLVLEEAPSMRTRKVEGRKKLARLIVKVENPLEIEGILSKTDSIHRLYKGQNGY
FT                   AFEIFSPEDDLILIHAEDDRASLVEVGEKPEFQTDLASISLSKFEISMELHLPTDIESF
FT                   LESSEIGASLDFIPAQGQDLTVDNTVTWDLSMLKFLVNELDIASLRQKFESTEYFIPKS
FT                   EKFFLGKDRNNVELWFEEV"
FT   gene            778050..778985
FT                   /locus_tag="SPT_0826"
FT   CDS_pept        778050..778985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0826"
FT                   /product="beta-lactamase"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0826"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22785"
FT                   /protein_id="ACO22785.1"
FT                   /translation="MKWTKIIKKIEEQIEAGIYPGASFAYFKDNQWTEFYLGQSDPEHG
FT                   LQTEAGLVYDLASVSKVVGVGTVCTFLWEIGQLDIDRLVIDFLPESDYPDITIRQLLTH
FT                   ATDLDPFIPNRDLLTAPELKEAMFHLNRRSQPAFLYSDVHFLLLGFILERIFNQDLDVI
FT                   LKDQVWKPWGMTETKFGPVELAVPTVRGVEAGIVHDPKARLLGRHAGSAGLFSTIKDLQ
FT                   IFLEHYLADDFARDLSQNFSPLDDKERSLAWNLEGDWLDHTGYTGTFIMWNRQKQEATI
FT                   FLSNRTYEKDERAQWILDRNQVMNLIRKEE"
FT   gene            778994..779890
FT                   /locus_tag="SPT_0827"
FT   CDS_pept        778994..779890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0827"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23683"
FT                   /protein_id="ACO23683.1"
FT                   /translation="MSNSLKGTLLTVVAGIAWGLSGTSGQYLMAHGISALVLTNLRLLI
FT                   AGGILMLLAYATAKDKILVFLKDRKSLLSLLIFALIGLFLNQFAYLSAIQETNAGTATV
FT                   LQYVCPVGILIYSCIKDRVAPTLGEIVSIIFTIGGTFLIATHGQLDQLSMTPAGLFWGL
FT                   FSALTYALYIILPIALIKKWGSSLVIGVGMVIAGLVALPFTGVLQADIPTSLDFLLAFA
FT                   GIILIGTVFAYTAFLKGASLIGPVKSSLLASIEPISAVFFAFLIMNEQFYPIDFLGMAM
FT                   ILFAVTLISLKDLFLEK"
FT   gene            complement(779933..780631)
FT                   /locus_tag="SPT_0828"
FT   CDS_pept        complement(779933..780631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0828"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0828"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24238"
FT                   /protein_id="ACO24238.1"
FT                   /translation="MLPAYMKIHDQIKKDIDEYRWAIGERLPSERDLAEQFAVSRMTLR
FT                   QAVSLLVEEGVLERRVGSGTFVSSTRVQEKMRGTTSFTEIVKSQGKVPSSQLISYKKTI
FT                   PNEQEVAKLGIFPTDNIIRMERVRYADQVPLVYEVASIPERFIKDFKKEEITSHFFQTL
FT                   QKHGYRIGKSQQTIYARLAKEKIAHYLEVEKGHAILGLTQVSYLEDGTAFEYVKSQYVG
FT                   ERFEFYLENN"
FT   gene            780773..782335
FT                   /locus_tag="SPT_0829"
FT   CDS_pept        780773..782335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0829"
FT                   /product="GMP synthase [glutamine-hydrolyzing]
FT                   (Glutamineamidotransferase) (GMP synthetase)"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0829"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23001"
FT                   /db_xref="GOA:C1CQS0"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1CQS0"
FT                   /protein_id="ACO23001.1"
FT                   /translation="MSNISTDLQDVEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKI
FT                   SAAEVREVNPVGIILSGGPNSVYEDGSFDIDPEIFELGIPILGICYGMQLLTHKLGGKV
FT                   VPAGDAGNREYGQSTLTHTPSALFESTPDEQTVLMSHGDAVTEIPADFVRTGTSADCPY
FT                   AAIENPDKHIYGIQFHPEVRHSVYGNDILRNFALNICKAKGDWSMDNFIDMQIKKIRET
FT                   VGDKRVLLGLSGGVDSSVVGVLLQKAIGDQLICIFVDHGLLRKGEADQVMDMLGGKFGL
FT                   NIVKADAAKRFLDKLAGVSDPEQKRKIIGNEFVYVFDDEASKLKDVKFLAQGTLYTDVI
FT                   ESGTDTAQTIKSHHNVGGLPEDMQFELIEPLNTLYKDEVRALGTELGMPDHIVWRQPFP
FT                   GPGLAIRVMGEITEEKLETVRESDAILREEIAKAGLDRDIWQYFTVNTGVRSVGVMGDG
FT                   RTYDYTIAIRAITSIDGMTADFAKIPWEVLQKISVRIVNEVDHVNRIVYDITSKPPATV
FT                   EWE"
FT   gene            complement(782508..783832)
FT                   /pseudo
FT                   /locus_tag="SPT_0832"
FT                   /note="transposase, degenerate; this region contains one or
FT                   more premature stops and/or frameshifts"
FT   gene            784177..784323
FT                   /locus_tag="SPT_0833"
FT   CDS_pept        784177..784323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0833"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0833"
FT                   /db_xref="EnsemblGenomes-Tr:ACO24241"
FT                   /protein_id="ACO24241.1"
FT                   /translation="MSSKLLKAKEQVKSQDKDKKSILGQIKSFKTDDKSKSNKKDHSKG
FT                   AER"
FT   gene            complement(784445..785437)
FT                   /locus_tag="SPT_0834"
FT   CDS_pept        complement(784445..785437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0834"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0834"
FT                   /db_xref="EnsemblGenomes-Tr:ACO22627"
FT                   /protein_id="ACO22627.1"
FT                   /translation="MSYYDFVKDYMKVDECKNNEKYSSAGHTFCWKKENSTYTEGLYWF
FT                   YEGGSFIIDIHDFYIKEEVVQNSTYSMSDYVSIYSSYIVSANGEKFNPYQTITANSLCT
FT                   FDFDNIKDDFVFLLHENCCYLAVSIGFKKELIEKHLASININPESFYSTLLQPNQIILT
FT                   KALERVAMEILNCKMDAPAADFFFKAKANEWISIVIDTYLNRKKYKIEIDDDKALEDVA
FT                   RFLDDHFATNVNQGTLEKISKMSGTKLKNLFKEKYCQSITEYTQRKRMNVAETLLLNTE
FT                   LPIKEIAESVGYSSASKFSIYYKRYKGKLPSEVRNLACKHHNFKCDYCD"
FT   gene            785597..787351
FT                   /locus_tag="SPT_0835"
FT   CDS_pept        785597..787351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0835"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0835"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23082"
FT                   /protein_id="ACO23082.1"
FT                   /translation="MKIYKKLFAYVQDKKYLGVLAIIFSAISALLTVYGYYLIYKFLDK
FT                   LIINSNLSGAESIALKSVITLTSGAIFYFVSGMFSHILGFRLETNLRKRGIDGLEKASF
FT                   RFFDLNPSGQIRKIIDDNAAQTHQVVAHMIPDSSQAIVTPILVLVLGFIVSIRVGITLL
FT                   ALTIIGGLILGAMMGEQEFMKIYQEALSKLSAETVEYVRGMQVVKIFKANVESFKIFYK
FT                   AIKDYSKYAYDYSLSCKRPYVLYQWLFFGLIAILIIPIVYFMTSLASAKVILLELIMIL
FT                   FLSGVLFVSFMRMMWYSMYISQGNYAVDTLEALYEDMQKDKLVHSNVNNFKNYNIEFEN
FT                   VSFAYNDKAVIENLSFNLEEGKSYALVGSSGSGKSTVAKLISGFYNVNKGSIKIGGIAI
FT                   SEYSDEALIKAISFVFQDSKLFKKSIYDNVALANKDATKDDVMRALKLAGCDLILDKFP
FT                   ERENTIIGSKGVYLSGGEKQRIAIARAILKDSKIIIMDEASASIDPDNEFELQKAFKNL
FT                   MKDKTVIMIAHRLSTIKDLDEIIVMDSGKIIERGSDKELMSKDTRYKSLQEMFNSANEW
FT                   RVSNERVL"
FT   gene            787335..789056
FT                   /locus_tag="SPT_0836"
FT   CDS_pept        787335..789056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0836"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPT_0836"
FT                   /db_xref="EnsemblGenomes-Tr:ACO23487"
FT                   /protein_id="ACO23487.1"
FT                   /translation="MKEFYKKRFALTDGGARNLSKATLASFFVYCINMLPAILLMIFAQ
FT                   EVLENMGKSNGFYIVFSVLTLIAMYILLSIEYDKLYNTTYQESADLRIRTAENLSKLPL
FT                   SYFSKHDISDISQTIMADIEGIEHAMSHSIPKVGGMVLFFPLISVMMPAGNVKMGLAVI
FT                   IPSILNFIFIPLSKKYQVNGQNRYYDVLRKNSESFQENIEMQMEIKAYNLSKDIKDDLY
FT                   KKMEDSERVHLKAEVTTILTLSISSIFSFISLAVVIFVGVNLIINKEINSLYLIGYLLA
FT                   AMKIKDSLDASKEGLMEIFYLSPKIERLKEIQNQDLQEGDDYSLKKFDIDLKDVEFAYN
FT                   KDAKVLNGVSFKAKQGEVTALVGASGCGKTTILKLISRLYDYDKGQILIDGKDIKEIST
FT                   ESLFDKVSIVFQDVVLFNQSVMENIRIGKQDASDEEVKRAAKLANCTDFIEKMDKGFDT
FT                   VIGENGAELSGGERQRLSIARAFLKEAPILILDEITASLDVNNEKKIQESLNNLVKDKT
FT                   VVIISHRMKSIENADKIVVLQNGRVESEGKHEELLQKSKIYKNLIEKTKMAEEFIY"
FT   gene            789067..789651
FT                   /locus_tag="SPT_0837"
FT   CDS_pept        789067..789651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPT_0837"
FT                   /product="c